📜 ___Samudayasaccaniddesavaṇṇanā

34. Samudayasaccaniddese [V1.134 P1.158] yāyaṃ taṇhāti yā ayaṃ taṇhā.

AI Translation based on Nissaya

In the exposition of the truth of the origin of suffering [V1.134 P1.158], the phrase 'yāyaṃ taṇhā' should be parsed as 'yā ayaṃ taṇhā' (whatever craving this is).

Vietnamese AI Translation

Trong phần giải thích về Tập Đế [V1.134 P1.158], cụm từ 'yāyaṃ taṇhā' nên được phân tích thành 'yā ayaṃ taṇhā' (bất kỳ ái nào đây).

AI Translation Nissaya

samudayasaccaniddese=in the exposition of the truth of the origin of suffering. ; yāyaṃ taṇhātipadassa=of the phrase 'yāyaṃ taṇhā'. ; yā ayaṃ taṇhāti padacchedo=the division into 'yā ayaṃ taṇhā'. ; kātabbo=should be made. ; yāyaṃ taṇhā=whatever craving there is. ;

Myanmar Nissaya

samudayasaccaniddese=၌။ ; yāyaṃ taṇhātipadassa=၏။ ; yā ayaṃ taṇhāti padacchedo=ဟူ၍ ပုဒ်ဖြတ်ခြင်းကို။ ; kātabbo=၏။ ; yāyaṃ taṇhā=အကြင်တဏှာသည်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2955 | Chunk: 49

Ponobhavikāti punabbhavakaraṇaṃ punobhavo, punobhavo sīlamassāti ponobhavikā.

AI Translation based on Nissaya

As for 'leading to renewed existence': the making of a new existence again is 'renewed existence'. Since this craving has renewed existence as its nature, it is called 'leading to renewed existence'.

Vietnamese AI Translation

Đối với 'dẫn đến tái hữu': việc tạo ra một sự hiện hữu mới một lần nữa là 'tái hữu'. Vì khát ái này có tái hữu làm bản chất của nó, nên nó được gọi là 'dẫn đến tái hữu'.

AI Translation Nissaya

ponābhavikāti=as for 'leading to renewed existence'. ; punabbhavakaraṇaṃ=the making of a new existence again. ; punobhavo=is called 'renewed existence'. ; assa=for that craving. ; punobhavo=renewed existence, which is the making of a new existence again. ; sīlaṃ=as its nature. ; atthi=it has. ; iti tasmā=therefore. ; ponobhavikā=it is called 'leading to renewed existence'. ;

Myanmar Nissaya

ponābhavikāti=ကား။ ; punabbhavakaraṇaṃ=တဖန်ဘဝသစ်ကို ပြုခြင်းသည်။ ; punobhavo=မည်၏။ ; assa=ထိုတဏှာအား။ ; punobhavo=တဖန်ဘဝသစ်ကို ပြုခြင်းတည်းဟူသော။ ; sīlaṃ=အလေ့သည်။ ; atthi=၏။ ; iti tasmā=‌ ကြောင့်။ ; ponobhavikā=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2956 | Chunk: 49

Apica punabbhavaṃ deti, punabbhavāya saṃvattati, punappunaṃ bhave nibbattetīti ponobhavikā.

AI Translation based on Nissaya

Furthermore, it gives a new existence, therefore it is 'leading to renewed existence'. It leads to a new existence, therefore it is 'leading to renewed existence'. It brings about existence again and again, therefore it is 'leading to renewed existence'.

Vietnamese AI Translation

Hơn nữa, nó cho một sự hiện hữu mới, do đó nó là 'dẫn đến tái hữu'. Nó dẫn đến một sự hiện hữu mới, do đó nó là 'dẫn đến tái hữu'. Nó mang lại sự hiện hữu lặp đi lặp lại, do đó nó là 'dẫn đến tái hữu'.

AI Translation Nissaya

apica=furthermore. ; punabbhavaṃ=a new existence. ; deti=it gives. ; iti tasmā=therefore. ; ponobhavikā=it is called 'leading to renewed existence'. ; punabbhavāya=for a new existence. ; saṃvattati=it leads. ; iti tasmā=therefore. ; ponobhavikā=it is called 'leading to renewed existence'. ; punappunaṃ=again and again. ; bhave=existence. ; nibbatteti=it brings about. ; iti tasmā=therefore. ; ponobhavikā=it is called 'leading to renewed existence'. ;

Myanmar Nissaya

apica=တနည်းလည်း။ ; punabbhavaṃ=တဖန်ဘဝသစ်ကို။ ; deti=ပေးတတ်၏။ ; iti tasmā=ကြောင့်။ ; ponobhavikā=မည်၏။ ; punabbhavāya=တဖန်ဘဝသစ်အလို့ငှ။ ; saṃvattati=ဖြစ်၏။ ; iti tasmā=ကြောင့်။ ; ponobhavikā=မည်၏။ ; punappunaṃ=အဖန်တလဲလဲ။ ; bhave=ဘဝကို။ ; nibbatteti=ဖြစ်စေတတ်၏။ ; iti tasmā=ကြောင့်။ ; ponobhavikā=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2957 | Chunk: 49

Sā panesā punabbhavassa dāyikāpi atthi adāyikāpi, punabbhavāya saṃvattanikāpi atthi asaṃvattanikāpi, dinnāya paṭisandhiyā upadhivepakkamattāpi.

AI Translation based on Nissaya

Now, regarding the nature of this phenomenon: that craving can be a giver of new existence, or not a giver. It can be what leads to new existence, or not what leads to it. There is also craving whose kamma, once rebirth-linking has been given, ripens only in the mental aggregates of result which form the substrata of existence.

Vietnamese AI Translation

Bây giờ, liên quan đến bản chất của hiện tượng này: khát ái đó có thể là một kẻ ban cho sự hiện hữu mới, hoặc không phải là kẻ ban cho. Nó có thể là thứ dẫn đến sự hiện hữu mới, hoặc không phải là thứ dẫn đến nó. Cũng có khát ái mà nghiệp của nó, một khi đã tạo mối liên kết tái sinh, chỉ chín muồi trong các tâm uẩn quả hình thành các căn bản của sự hiện hữu.

AI Translation Nissaya

pana=now, to speak of the nature of the phenomenon, aside from the meaning of the particle. ; sā esā taṇhā=that craving. ; punabbhavassa=of a new existence. ; dāyikāpi=craving that gives. ; atthi=there is. ; adāyikāpi=craving that does not give. ; atthi=there is. ; punabbhavāya=for a new existence. ; saṃvattanikāpi=craving that leads to. ; atthi=there is. ; asaṃvattanikāpi=craving that does not lead to. ; atthi=there is. ; paṭisandhiyā=rebirth-linking. ; dinnāya=when given. ; upadhivepakkamattāpi=craving that has its kamma ripening only in the mental aggregates of result, which are the substrata of existence. ; atthi=there is. ;

Myanmar Nissaya

pana=သဒ္ဒါ၏ အနက်မှ တပါး တရား၏ သ‌ဘောကို ဆိုဦးအံ့။ ; sā esā taṇhā=ထိုတဏှာသည်။ ; punabbhavassa=တဖန်ဘဝသစ်ကို။ ; dāyikāpi=ပေးတတ်သော တဏှာသည်လည်း။ ; atthi=၏။ ; adāyikāpi=မပေးတတ်သော တဏှာသည်လည်း။ ; atthi=၏။ ; punabbhavāya=တဖန် ဘဝသစ်အလို့ငှါ။ ; saṃvattanikāpi=ဖြစ်စေတတ်သော တဏှာသည်လည်း။ ; atthi=၏။ ; asaṃvattanikāpi=မဖြစ်စေတတ်သော တဏှာသည်လည်း ။ ; atthi=၏။ ; paṭisandhiyā=ကို။ ; dinnāya=ပေးပြီးသည်ရှိသော်။ ; upadhivepakkamattāpi=ဝိပါက် နာမက္ခန္ဓာတည်းဟူသော ဥပဓိ၌ အကျိုးပေးတတ်သော ကံရှိသော တဏှာသည်လည်း။ ; atthi=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2958 | Chunk: 49

Sā tippakārāpi ponobhavikāti nāmaṃ labhati.

AI Translation based on Nissaya

That craving, in all three of its forms—giving renewed existence, leading to renewed existence, and ripening in the substrata of existence—obtains the name 'leading to renewed existence'.

Vietnamese AI Translation

Khát ái đó, trong cả ba hình thức của nó—ban cho tái hữu, dẫn đến tái hữu, và chín muồi trong các căn bản của sự hiện hữu—đạt được tên gọi 'dẫn đến tái hữu'.

AI Translation Nissaya

kippakārāpi=having three divisions. ; sā=that craving which gives renewed existence, leads to renewed existence, and ripens in the substrata. ; ponābhavikāti nāmaṃ=the name 'leading to renewed existence'. ; labhati=obtains. ;

Myanmar Nissaya

kippakārāpi=သုံးပါး အပြားရှိသည်လည်းဖြစ်သော။ ; sā=ထိုပုနဗ္ဘဝဒါယိက တဏှာ, ပုနဗ္ဘသံဝတ္တနိကတဏှာ, ဥပဓိဝေပက္ကတဏှာ သည်။ ; ponābhavikāti nāmaṃ=ဟူသော အမည်ကို။ ; labhati=ရ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2959 | Chunk: 49

Ponabbhavikātipi pāṭho, soyevattho.

AI Translation based on Nissaya

There is also the reading 'ponabbhavikā'; the meaning is the same as what has been stated.

Vietnamese AI Translation

Cũng có cách đọc 'ponabbhavikā'; ý nghĩa giống như điều đã được nêu.

AI Translation Nissaya

ponabbhavikātipi=as 'ponabbhavikā'. ; pāṭho=there is also a reading. ; attho=the meaning. ; soyeva=is just the same as what was said. ;

Myanmar Nissaya

ponabbhavikātipi=ဟူ၍လည်း။ ; pāṭho=ပါဌ်ရှိ၏။ ; attho=ကား။ ; soyeva=ထိုဆိုအပ်သော အနက်ပင်လျှင်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2960 | Chunk: 49

Abhinandanasaṅkhātena nandirāgena saha gatāti nandirāgasahagatā.

AI Translation based on Nissaya

It is accompanied by delight and greed, which is called 'great delight'; therefore, it is called 'accompanied by delight and greed'.

Vietnamese AI Translation

Nó được kèm theo sự hoan hỷ và tham lam, điều này được gọi là 'đại hoan hỷ'; do đó, nó được gọi là 'kèm theo hoan hỷ và tham lam'.

AI Translation Nissaya

abhinandanasaṅkhātena=which is called 'great delight'. ; nandirāgena=with delight and greed. ; sahagatā=it is accompanied. ; iti tasmā=therefore. ; nandirāgasahagatā=it is called 'accompanied by delight and greed'. ;

Myanmar Nissaya

abhinandanasaṅkhātena=အလွန်နှစ်သက်ခြင်းဟု ဆိုအပ်သော။ ; nandirāgena=နန္ဒိရာဂနှင့်။ ; sahagatā=တကွဖြစ်သည်တည်း။ ; iti tasmā=‌ ‌ကြောင့်။ ; nandirāgasahagatā=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2961 | Chunk: 49

Nandirāgena saddhiṃ atthato ekattameva gatāti vuttaṃ hoti.

AI Translation based on Nissaya

It is said to have reached, in meaning, the very state of being one with that great delight.

Vietnamese AI Translation

Người ta nói rằng nó đã đạt đến, về ý nghĩa, chính trạng thái hòa hợp với sự đại hoan hỷ đó.

AI Translation Nissaya

nandirāgena=with great delight. ; saddhi့=together. ; atthato=in meaning. ; ekattameva=to the very state of being one with craving. ; gatā=it has gone. ; iti=thus. ; vuttaṃ vutto=it is said. ; hoti=to be. ;

Myanmar Nissaya

nandirāgena=အလွန်နှစ်သက်ခြင်းနှင့်။ ; saddhi့=ကွ။ ; atthato=အားဖြင့်။ ; ekattameva=တဏှာနှင့်တူသည်၏ အဖြစ်သို့သာလျှင်။ ; gatā=ရောက်၏။ ; iti=သို့။ ; vuttaṃ vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2962 | Chunk: 49

Tatra tatrābhinandinīti yatra yatra attabhāvo nibbattati, tatra tatra abhinandinī.

AI Translation based on Nissaya

'Finding delight in this or that' means: wherever an individual existence arises, there it finds delight.

Vietnamese AI Translation

'Tìm thấy hoan hỷ trong điều này hay điều kia' có nghĩa là: bất cứ nơi nào một sự hiện hữu cá nhân khởi lên, ở đó nó tìm thấy hoan hỷ.

AI Translation Nissaya

tatra tatrābhinandinīti=as for 'finding delight in this or that'. ; yatra yatra=wherever, in whatever of the three realms of existence. ; attabhāvo=an individual existence. ; nibbattati=arises. ; tatratatra=there, in that place of individual existence in the three realms. ; abhinandinī=it finds delight. ;

Myanmar Nissaya

tatra tatrābhinandinīti=ကား။ ; yatra yatra=အကြင်အကြင် သုံးဘဝ၌။ ; attabhāvo=သည်။ ; nibbattati=ဖြစ်၏။ ; tatratatra=ထိုထိုအတ္တဘော၏ ဖြစ်ရာ သုံးဘဝ၌။ ; abhinandinī=အလွန်နှစ်သက်တတ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2963 | Chunk: 49

Rūpādīsu vā ārammaṇesu tatra tatrābhinandinī, rūpābhinandinī saddagandharasaphoṭṭhabbadhammābhinandinīti attho.

AI Translation based on Nissaya

Or, 'delighting here and there' in sense objects such as visible forms means habitually delighting in visible form, and habitually delighting in sound, odor, taste, tangible object, and mental object. This is the meaning.

Vietnamese AI Translation

Hoặc, 'hoan hỷ ở đây và ở đó' trong các đối tượng giác quan như sắc có nghĩa là thường xuyên hoan hỷ trong sắc, và thường xuyên hoan hỷ trong tiếng, mùi, vị, vật xúc chạm, và pháp trần. Đây là ý nghĩa.

AI Translation Nissaya

vā=Or. ; rūpādīsu=in visible forms, etc. ; ārammaṇesu=in the sense objects. ; tatratatra=in those various sense objects. ; abhinandinī=it habitually delights exceedingly. ; rūpābhinandinī=it habitually delights in visible form. ; saddagandharasaphoṭṭhabbadhammābhinandinī=it habitually delights exceedingly in sound, odor, taste, tangible object, and mental object. ; iti=this. ; attho=is the meaning. ;

Myanmar Nissaya

vā=ကား။ ; rūpādīsu=ရူပါရုံ အစရှိကုန်သော။ ; ārammaṇesu=တို့တွင်။ ; tatratatra=ထိုထိုအာရုံ၌။ ; abhinandinī=အလွန်နှစ်သက်တတ်၏။ ; arūpābhinandīni=ရူပါရုံ၌ နှစ်သက်တတ်၏။ ; saddagandharasaphoṭṭhabbadhammābhinandinī=သဒ္ဒါရုံ ။လ။ ဓမ္မာရုံ၌ အလွန်နှစ်သက်တတ်၏။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2964 | Chunk: 50

Tatra tatrābhinandītipi pāṭho, tatra tatra abhinandayatīti attho.

AI Translation based on Nissaya

There is also the reading 'tatra tatrābhinandī'ti'. The meaning is that in this or that existence, it causes the phenomena associated with it and the beings endowed with it to greatly delight. This is the meaning.

Vietnamese AI Translation

Cũng có cách đọc 'tatra tatrābhinandī'ti'. Ý nghĩa là trong sự hiện hữu này hay sự hiện hữu kia, nó khiến các pháp liên quan đến nó và các chúng sinh sở hữu nó rất hoan hỷ. Đây là ý nghĩa.

AI Translation Nissaya

tatra tatr'abhinandī'ti pi=There is also the reading. ; pāṭho=a reading. ; tatra tatra=in this or that existence. ; sa-sampayuttā=associated with itself. ; dhamme=the phenomena. ; sa-samaṅgī=endowed with itself. ; satte=the beings. ; abhinandayati=it causes to delight exceedingly. ; iti=this. ; attho=is the meaning. ;

Myanmar Nissaya

tatra tatrabhinandītipi=ဟူ၍လည်း။ ; pāṭho=၏။ ; tatra tatra=ထိုထိုဘုံဘဝ၌။ ; sasampayuttā=မိမိနှင့် ယှဉ်ကုန်သော။ ; dhamme=တို့ကို။ ; tanaññaḥ= ; sasamaṅgī=မိမိနှင့် ပြည့်စုံကုန်သော။ ; satte=တို့ကို။ ; abhinandayati=အလွန်နှစ်သက်စေတတ်၏။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2965 | Chunk: 50

Seyyathidan ti nipāto, tassa sā katamā iti ceti attho.

AI Translation based on Nissaya

Seyyathidaṃ is a particle. Its meaning should be understood as introducing the question, 'And what is that (craving)?'

Vietnamese AI Translation

**Seyyathidaṃ** là một tiểu từ. Ý nghĩa của nó nên được hiểu là để đưa ra câu hỏi: 'Và đó (khát ái) là gì?'

AI Translation Nissaya

seyyathidaṃ'ti=The word 'seyyathidaṃ'. ; (saddo=word.) ; nipāto=is a particle. ; tassa=Of that particle 'seyyathidaṃ'. ; sā=that (craving). ; katamā=what is it? ; iti=thus. ; ce vadeyya=if one were to say. ; iti attho=this is the meaning. ; veditabbo=is to be understood. ;

Myanmar Nissaya

seyyathidanti=သော။ ; (saddo=သည်။) ; nipāto=တည်း။ ; tassa=ထိုသေယျထိဒံဟူသော နိပါတ်ပုဒ်၏။ ; sā=ထိုတဏှာဟူသည်။ ; katamā=နည်း။ ; iti=သို့။ ; ce vadeyya=အကယ်၍ ဆိုငြားအံ့။ ; iti attho=ကို။ ; veditabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2966 | Chunk: 50

Kāmataṇhāti kāme taṇhā, pañcakāmaguṇikarāgassetaṃ adhivacanaṃ.

AI Translation based on Nissaya

Craving for sensual pleasures is craving for sensual objects. It is a designation for the lust that has the five strands of sensual pleasure as its object.

Vietnamese AI Translation

**Ái dục** là khát ái đối với các đối tượng dục. Đó là một tên gọi cho tham ái mà có năm sợi dây dục lạc làm đối tượng.

AI Translation Nissaya

kāmataṇhā'ti=As for 'craving for sensual pleasures'. ; kāme=for sensual objects. ; pavatto=is the craving that occurs. ; taṇhā=is craving. ; etaṃ=This name, 'craving for sensual pleasures'. ; pañcakāmaguṇika-rāgassa=is for the lust that has the five strands of sensual pleasure as its object. ; adhivacanaṃ=is a designation. ;

Myanmar Nissaya

kāmataṇhāti=ကား။ ; kāme=ဝတ္ထုကာမ၌။ ; pavatto=သော။ ; taṇhā=တည်း။ ; etaṃ=ဤကာမတဏှာဟူသော အမည်သည်။ ; pañcakāmaguṇikarāgassa=ငါးပါးသော ကာမ ဂုဏ်လျှင် အာရုံရှိသော ရာဂ၏။ ; adhivacanaṃ=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2967 | Chunk: 50

Bhavataṇhāti bhave taṇhā.

AI Translation based on Nissaya

Craving for existence is craving for existence.

Vietnamese AI Translation

**Hữu ái** là khát ái đối với sự hiện hữu.

AI Translation Nissaya

bhavataṇhā'ti=As for 'craving for existence'. ; bhave=for existence. ; pavatto=is the craving that occurs. ; taṇhā=is craving. ;

Myanmar Nissaya

bhavataṇhāti=ကား။ ; bhave=၌။ ; pavatto=သော။ ; taṇhā=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2968 | Chunk: 50

Bhavapatthanāvasena uppannassa sassatadiṭṭhisahagatassa rāgassa rūpārūpabhavarāgassa ca jhānanikantiyā ca etaṃ adhivacanaṃ.

AI Translation based on Nissaya

This is a designation for the lust that has arisen by way of longing for existence and is accompanied by the view of eternalism, and for the lust for fine-material and immaterial existence, and for the delight in jhāna.

Vietnamese AI Translation

Đây là một tên gọi cho tham ái đã khởi lên bằng cách mong mỏi sự hiện hữu và được kèm theo tà kiến thường kiến, và cho tham ái đối với sắc giới và vô sắc giới, và cho sự hoan hỷ trong thiền.

AI Translation Nissaya

etaṃ=This name, 'craving for existence'. ; bhavapatthanāvasena=by way of longing for existence. ; uppannassa=of that which has arisen. ; sassatadiṭṭhisahagatassa=accompanied by the view of eternalism. ; rāgassa ca=of the lust, and. ; rūpārūpabhavarāgassa ca=of the lust for fine-material and immaterial existence, and. ; jhānanikantiyā ca=of the delight in jhāna, and. ; adhivacanaṃ=is a designation. ;

Myanmar Nissaya

etaṃ=ဤဘဝတဏှာဟူသော အမည်သည်။ ; bhavapatthanāvasena=ဘဝကို တောင့်တသည်၏ အစွမ်းဖြင့်။ ; uppannassa=သော။ ; sassatadiṭṭhisahagatassa=သဿတဒိဋ္ဌိနှင့် တကွဖြစ်သော။ ; rāgassaca=၏လည်းကောင်း။ ; rūpārūpabhavarāgassaca=ရူပဘဝ, အရူပဘဝ၌ တပ်တတ်သော ရာဂ၏လည်းကောင်း။ ; jhānanikantiyāca=ဈာန်၌ တပ်တတ်သော တဏှာ၏လည်းကောင်း။ ; adhivacanaṃ=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2969 | Chunk: 50

Vibhavataṇhāti vibhave taṇhā.

AI Translation based on Nissaya

Craving for non-existence is craving for the annihilation of existence.

Vietnamese AI Translation

**Phi hữu ái** là khát ái đối với sự đoạn diệt của sự hiện hữu.

AI Translation Nissaya

vibhavataṇhā'ti=As for 'craving for non-existence'. ; vibhave=for the annihilation of existence. ; pavatto=is the craving that occurs. ; taṇhā=is craving. ; etaṃ=This name 'craving for non-existence'. ;

Myanmar Nissaya

vibhavataṇhāti=ကား။ ; vibhave=ဘဝ၏ ကင်းခြင်း၌။ ; pavatto=သော။ ; taṇhā=တည်း။ ; etaṃ=ဤဝိဘဝဟူသော အမည်သည်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2970 | Chunk: 50

Ucchedadiṭṭhisahagatarāgassetaṃ adhivacanaṃ.

AI Translation based on Nissaya

It is a designation for the lust that is accompanied by the view of annihilationism.

Vietnamese AI Translation

Đó là một tên gọi cho tham ái được kèm theo tà kiến đoạn kiến.

AI Translation Nissaya

ucchedadiṭṭhisahagata-rāgassa=for the lust accompanied by the view of annihilationism. ; adhivacanaṃ=is a designation. ;

Myanmar Nissaya

ucchedadiṭṭhisahagatarāgassa=ဥစ္ဆေဒဒိဋ္ဌိနှင့် တကွဖြစ်သော ရာဂ၏။ ; adhivacanaṃ=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2971 | Chunk: 50

Idāni tassā taṇhāya vatthuṃ vitthārato dassetuṃ sā kho panesātiādimāha.

AI Translation based on Nissaya

Now, in order to show the basis of that craving in detail, he spoke the passage beginning with **'sā kho pan'esā'** (And this craving...).

Vietnamese AI Translation

Bây giờ, để chỉ ra cơ sở của khát ái đó một cách chi tiết, ngài đã nói đoạn văn bắt đầu bằng **'sā kho pan'esā'** (Và khát ái này...).

AI Translation Nissaya

idāni=Now. ; tassā taṇhāya=of that craving. ; vatthuṃ=the basis. ; vitthā‌rato=in detail. ; dassetuṃ=in order to show. ; sā‌ kho pan'esā'ti-ādiṃ=the passage beginning with 'sā kho pan'esā'. ; āha=he said. ;

Myanmar Nissaya

idāni=၌။ ; tassā taṇhāya=၏။ ; vatthuṃ=အကြောင်းကို။ ; vitthā‌rato=အားဖြင့်။ ; dassetuṃ=ငှါ။ ; sā‌ kho panasātiādiṃ=ကို။ ; āha=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2972 | Chunk: 50

Tattha uppajjatīti jāyati.

AI Translation based on Nissaya

Therein, uppajjati means it is born.

Vietnamese AI Translation

Trong đó, **uppajjati** có nghĩa là nó sinh ra.

AI Translation Nissaya

tattha=In that passage beginning with 'sā kho pan'esā'. ; uppajjatī'ti=the word 'uppajjati'. ; jāyati=means it is born. ;

Myanmar Nissaya

tattha=ထို သာ ခေါ ပနေသာ အစရှိသော ပါဌ်၌။ ; uppajjatīti=ကား။ ; jāyati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2973 | Chunk: 50

Nivisatīti punappunaṃ pavattivasena patiṭṭhāti.

AI Translation based on Nissaya

Nivisati means it becomes established by way of occurring again and again.

Vietnamese AI Translation

**Nivisati** có nghĩa là nó trở nên an trú bằng cách xảy ra lặp đi lặp lại.

AI Translation Nissaya

nivisatī'ti=the word 'nivisati'. ; punappunaṃ=again and again. ; pavattivasena=by way of occurring. ; patiṭṭhāti=it becomes established. ;

Myanmar Nissaya

nivisatīti=ကား။ ; punappanaṃ=တလုံလဲလဲ။ ; pavattivasena=ဖြစ်သည်၏ အစွမ်းဖြင့်။ ; patiṭṭhāti=တည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2974 | Chunk: 50

Uppajjamānā kattha uppajjati, nivisamānā kattha nivisatīti [P1.159] sambandho.

AI Translation based on Nissaya

The connection is [to ask]: 'When arising, where does it arise? When becoming established, where does it become established?' [P1.159].

Vietnamese AI Translation

Sự liên kết là [để hỏi]: 'Khi khởi lên, nó khởi lên ở đâu? Khi trở nên an trú, nó trở nên an trú ở đâu?' [P1.159].

AI Translation Nissaya

uppajjamānā=When arising. ; kattha=where. ; uppajjati=does it arise? ; nivisamānā=When becoming established. ; kattha=where. ; nivisati=does it become established? ; iti=this. ; sambandho=is the connection. ;

Myanmar Nissaya

uppajjamānā=ရှိသော်။ ; kattha=အဘယ်အရပ်၌. ; uppajjati=ဖြစ်သနည်း။ ; navisamānā=တည်သည်ရှိသော်။ ; kattha=၌။ ; nivisati=တည်သနည်း။ ; itiayaṃ=ကား။ ; sambandho=အစပ်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2975 | Chunk: 50

Yaṃ loke piyarūpaṃ sātarūpan ti yaṃ lokasmiṃ piyasabhāvañceva [M1.147] madhurasabhāvañca.

AI Translation based on Nissaya

'Whatever in the world is a dear form, an agreeable form' means whatever in the world of beings has a dear nature and a pleasant nature [M1.147].

Vietnamese AI Translation

**'Bất cứ gì trong thế gian là hình thái đáng yêu, hình thái dễ chịu'** có nghĩa là bất cứ gì trong thế giới chúng sinh có bản chất đáng yêu và bản chất dễ chịu [M1.147].

AI Translation Nissaya

yaṃ loke piyarūpaṃ sātarūpan'ti=The phrase 'Whatever in the world is a dear form, an agreeable form'. ; lokasmiṃ=In the world of beings. ; yaṃ piyasabhāvañceva=whatever has a dear nature and. ; yaṃ madhurasabhāvañca=whatever has a pleasant nature. ; atthi=there is. ;

Myanmar Nissaya

yaṃ loka piyarūpaṃ sātarūpanti=ကား။ ; lokasmiṃ=သတ္တလောက၌။ ; yaṃ piyasabhāvañceva=အကြင်ချစ်အပ်သော သဘောသည် လည်းကောင်း။ ; yaṃ madhurasabhāvañca=အကြင်သာယာအပ်သော သဘောသည်လည်းကောင်း။ ; atthi=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2976 | Chunk: 50

Cakkhu loketiādīsu lokasmiñhi cakkhuādīsu mamattena abhiniviṭṭhā sattā sampattiyaṃ patiṭṭhitā attano cakkhuṃ ādāsādīsu nimittaggahaṇānusārena vippasannaṃ pañcapasādaṃ suvaṇṇavimāne ugghāṭitamaṇisīhapañjaraṃ viya maññanti, sotaṃ rajatapanāḷikaṃ viya pāmaṅgasuttakaṃ viya ca maññanti, tuṅganāsāti laddhavohāraṃ ghānaṃ vaṭṭetvā ṭhapitaharitālavaṭṭiṃ viya maññanti, jivhaṃ rattakambalapaṭalaṃ viya mudusiniddhamadhurarasadaṃ maññanti, kāyaṃ sālalaṭṭhiṃ viya suvaṇṇatoraṇaṃ viya ca maññanti, manaṃ aññesaṃ manena asadisaṃ uḷāraṃ maññanti, rūpaṃ suvaṇṇakaṇikārapupphādivaṇṇaṃ viya, saddaṃ mattakaravīkakokilamandadhamitamaṇivaṃsanigghosaṃ viya, attanā paṭiladdhāni catusamuṭṭhānikagandhārammaṇādīni ‘‘kassaññassa evarūpāni atthī’’ ti maññanti, tesaṃ evaṃ maññamānānaṃ tāni cakkhādīni piyarūpāni ceva sātarūpāni ca honti.

AI Translation based on Nissaya

Regarding the passage beginning with 'The eye in the world': Indeed, in the world, beings who are established in good fortune and are attached with a sense of 'mine' to the eye and other faculties, consider their own eye—very clear according to the reflection in a mirror, and clear with five colors—to be like an opened, jeweled lion-window in a golden palace. They consider the ear to be like a silver pipe or a plumb-line. They consider the nose, known as a 'prominent nose,' to be like a shaped and placed stick of yellow orpiment. They consider the tongue, which provides soft, smooth, and sweet tastes, to be like a piece of bright red blanket. They consider the body to be like a sal sapling or a golden archway. They consider their mind to be sublime and unlike the minds of others. They consider form to be like the color of gold or a kaṇikāra flower, and sound to be like the call of an intoxicated karavīka bird or a cuckoo, or the gentle sound of a jeweled flute. Regarding the objects of smell and so on, which arise from the four causes and which they have obtained, they think, "What other person possesses such things?" For those who think in this way, these faculties, the eye and so on, are dear forms and agreeable forms.

Vietnamese AI Translation

Liên quan đến đoạn văn bắt đầu bằng **'Con mắt trong thế gian'**: Thật vậy, trong thế gian, những chúng sinh an trú trong vận may và chấp trước với ý nghĩ 'của tôi' vào mắt và các căn khác, xem mắt của chính họ—rất rõ ràng theo sự phản chiếu trong gương, và rõ ràng với năm màu sắc—là như một cửa sổ sư tử bằng ngọc đã mở trong một cung điện vàng. Họ xem tai là như một ống bạc hoặc một dây dọi. Họ xem mũi, được biết đến là 'mũi nổi bật', là như một que Hoàng hùng hoàng (orpiment) đã được tạo hình và đặt vào. Họ xem lưỡi, thứ cung cấp các vị mềm mại, trơn tru và ngọt ngào, là như một mảnh chăn màu đỏ tươi. Họ xem thân là như một cây sa la non hoặc một cổng vòm vàng. Họ xem tâm của họ là siêu phàm và không giống như tâm của người khác. Họ xem sắc là như màu vàng hoặc một bông hoa kaṇikāra, và tiếng là như tiếng hót của một con chim karavīka say rượu hoặc một con chim cu, hoặc âm thanh êm dịu của một cây sáo bằng ngọc. Đối với các đối tượng mùi và những thứ tương tự, mà phát sinh từ bốn nguyên nhân và mà họ đã đạt được, họ nghĩ: "Người khác nào sở hữu những thứ như vậy?" Đối với những người nghĩ theo cách này, các căn này, mắt và những thứ tương tự, là những hình thái đáng yêu và những hình thái dễ chịu.

AI Translation Nissaya

cakkhu loke'ti ādīsu=In the passage beginning with 'the eye in the world'. ; (attho=the meaning. ; evaṃ=thus. ; veditabbo=should be understood.) ; hi=Indeed. ; lokasmiṃ=in the world of beings. ; cakkhuādīsu=in the eye and other faculties. ; mamattena=with a sense of 'mine'. ; abhiniviṭṭhā=who are intent. ; sattā=beings. ; sampattiyaṃ=in good fortune (human or divine). ; patiṭṭhitā=established. ; patiṭṭhitā=established. ; sattā=beings. ; attano=their own. ; cakkhuṃ=eye-sensitivity together with its location. ; ādāsādisu=in a mirror and so forth. ; nimittaggahaṇānusārena=in accordance with the grasping of the sign (reflection). ; vippasannaṃ=is very clear. ; pañcapasādaṃ=is clear with five kinds of color. ; suvaṇṇavimāne=in a golden celestial mansion. ; ugghāṭita-maṇi-sīhapañcaraṃ viya=like an opened jeweled lion-window. ; maññanti=they imagine. ; sotaṃ=the ear. ; rajata-panāḷikaṃ viya=like a silver pipe and. ; pāmaṅga-suttakaṃ viya ca=like a plumb-line. ; maññanti=they imagine. ; tuṅganāsā=a prominent nose. ; iti=thus. ; laddhavohāraṃ=which has received the designation. ; ghānaṃ=the nose. ; vaṭṭetvā=having made into a roll. ; ṭhapita-haritāla-vaṭṭiṃ viya=like a placed stick of yellow orpiment. ; maññanti=they imagine. ; jivhaṃ=the tongue. ; mudu-siniddha-madhura-sadaṃ=which gives a soft, smooth, sweet taste. ; ratta-kambala-paṭalaṃ viya=like a sheet of bright red woolen cloth. ; maññanti=they imagine. ; kāyaṃ=the body. ; sāla-laṭṭhiṃ viya=like a sal-tree sapling and. ; suvaṇṇa-toraṇaṃ viya ca=like a golden archway. ; maññanti=they imagine. ; manaṃ=the mind. ; aññesaṃ=of others. ; manena=with the minds. ; asadisaṃ=as dissimilar. ; uḷāraṃ=as sublime. ; maññanti=they imagine. ; rūpaṃ=visible form. ; suvaṇṇa-kaṇikāra-pupphādi-vaṇṇaṃ viya=like the color of gold, a kaṇikāra flower, and so on. ; maññanti=they imagine. ; saddaṃ=sound. ; matta-karavīka-kokila-manda-dhamita-maṇi-vaṃsa-nigghosaṃ viya=like the sound of an intoxicated karavīka bird, a cuckoo, or the sound of a gently blown jeweled flute. ; maññanti=they imagine. ; attanā=by oneself. ; paṭiladdhāni=which are obtained. ; catusamuṭṭhānika-gandhārammaṇādīni=odorous objects etc. which have fourfold origination. ; aññassa=other than me. ; kassa=to what person. ; evarūpānihings of such a kind. ; atthi santi=are there? ; iti=thus. ; maññanti=they imagine. ; evaṃ=thus. ; maññamānānaṃ=of those who imagine. ; tesaṃ=for those beings. ; tāni cakkhādīni=those things, the eye etc.. ; piyarūpāni ceva=are dear forms and. ; honti=they are. ; sātarūpāni ca=are agreeable forms. ; honti=they are. ;

Myanmar Nissaya

cakkhuloketi ādīsu=တို့၌။ ; (attho=ကို။ ; evaṃ=သို့။ ; veditabbo=၏။) ; hi vitthāremi=အံ့။ ; lokasmiṃ=သတ္တလောက၌။ ; cakkhuādīsu=တို့၌။ ; mamattena=မြတ်နိုးသော အားဖြင့်။ ; abhiniviṭṭhā=နှလုံးသွင်းကုန်သော။ ; sattā=တို့သည်။ ; sampattiyaṃ=မနုဿသမ္ပတ္တိ ဒေဝသမ္ပတ္တိတို့၌။ ; patiṭṭhitā=တည်ကုန်၏။ ; tanaññaḥ= ; patiṭṭhitā=ကုန်သော။ ; sattā=တို့သည်။ ; attano=၏။ ; cakkhuṃ=တည်ရာနှင့်တကွဖြစ်သော စက္ခုပသာဒကို။ ; ādāsādisu=ကြေမုံပြင် အစရှိသည်တို့၌။ ; nimittaggahaṇānusārena=အရိပ်ကို ယူခြင်းကို အစဉ်လျှောက်သဖြင့်။ ; vippasannaṃ=အလွန်ကြည်လင်၏။ ; pañcapasādaṃ=ငါးပါးသော အဆင်းတို့ဖြင့် ကြည်လင်၏။ ; suvaṇṇavimāne=‌ ရွှေဗိမာန်၌။ ; ugghāṭitamaṇi sīhapañcaraṃviya=ဖွင့်လှစ်အပ်သော ပတ္တမြားစီချယ်၍ ခြင်္သေ့ခံသော လေသွန်တံခါးကဲ့သို့။ ; maññanti=မှတ်ထင်ကုန်၏။ ; sotaṃ=ကို။ ; rajatapanāḷikaṃviya=ငွေကျဉ်တောက်ကဲ့သို့ လည်းကောင်း။ ; pāmaṅgasuttakaṃviyaca=ဆောက်လုံးကြိုးကဲ့သို့လည်းကောင်း။ ; maññanti=အောက်မေ့ကုန်၏။ ; tuṅganāsā=ရှည်သော နှာခေါင်းတည်း။ ; iti=သို့။ ; laddhavohāraṃ=ရှိသော။ ; ghānaṃ=နှာခေါင်းကို။ ; vaṭṭetvā=အတောင့်ပြု၍။ ; ṭhapitaharitālavaṭṭhiṃviya=ထားအပ်သော ဆေးဒါန်း မြင်းသီလာ အတောင့်ကဲ့သို့။ ; maññanati=အောက်မေ့ကုန်၏။ ; jivhaṃ=လျှာကို။ ; mudusiniddhamadhurasadaṃ=နူးညံ့သိမ်မွေ့သည်ဖြစ်၍ ကောင်းမြတ်သော အရသာကို ပေးသော။ ; rattakambalapaṭalaṃviya=စွေးစွေးနီသော ကမ္ဗလာ အချပ်အလွှာကဲ့သို့။ ; maññanti=ကုန်၏။ ; kāyaṃ=ကို။ ; sālalaṭṭhiṃviya=အင်ကြင်းပင်ပျိုးကဲ့သို့ လည်းကောင်း။ ; suvaṇṇatoraṇaṃviyaca=ရွှေတုရိုဏ်းကဲ့သို့ လည်းကောင်း။ ; maññanti=ကုန်၏။ ; manaṃ=ကို။ ; aññesaṃ=တို့၏။ ; manena=နှင့်။ ; asadisaṃ=မတူသည်ကို။ ; uḷāraṃ=ပြန့်ပြောသည်ကို။ ; maññanti=ကုန်၏။ ; rūpaṃ=ရူပါရုံကို။ ; suvaṇṇakaṇikāra pupphāditaṇṇaṃviya=ရွှေ၏အဆင်း မဟာလှေကားပွင့် အစရှိသည်တို့၏ အဆင်းကဲ့သို့။ ; maññanti=ကုန်၏။ ; saddaṃ=ရုံကို။ ; mattakaravīkakokilamandadhamita maṇivaṃsanigghosaṃviya=ပန်းဝတ်ရည်ရစ်သော ကရဝိက် ငှက်သံ ဥဩသံ ညင်းညင်းသာသာမှုတ် အပ်သော ပတ္တမြားစီချယ်သော ပလွေအသံကဲ့သို့။ ; maññanti=ကုန်၏။ ; attano=သည်။ ; paṭiladdhāni=ရအပ်ကုန်သော။ ; catusamuṭṭhānikagandhārammaṇādīni=စတုသမုဋ္ဌာနိက ဂန္ဓာရုံ အစရှိကုန်သော။ ; aññassa=ငါ မှတပါးသော ။ ; kassa=အဘယ်မည်သော သူအား။ ; evarūpāni=ဤသို့ သဘောရှိသော အာရုံတို့သည်။ ; atthi santi=အံ့နည်း။ ; iti=သို့။ ; maññanti=ကုန်၏။ ; evaṃ=သို့။ ; maññamānānaṃ=‌ကုန်သော။ ; tesaṃ=ထိုသတ္တဝါတို့အား။ ; tāni cakkhādīni=တို့သည်။ ; piyarūpāniceva=ကုန်သည်လည်း။ ; honti=ကုန်၏။ ; sātarūpānica=ကုန်သည်လည်း ။ ; honti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2977 | Chunk: 50

Atha nesaṃ tattha anuppannā ceva taṇhā uppajjati [V1.135], uppannā ca punappunaṃ pavattivasena nivisati.

AI Translation based on Nissaya

Then, for them, craving that has not yet arisen, arises in regard to those things [V1.135], and the craving that has already arisen becomes established by occurring again and again.

Vietnamese AI Translation

Rồi, đối với họ, khát ái chưa khởi lên thì khởi lên liên quan đến những thứ đó [V1.135], và khát ái đã khởi lên thì trở nên an trú bằng cách xảy ra lặp đi lặp lại.

AI Translation Nissaya

atha=Then, when they think in this way. ; nesaṃ=for those beings. ; tattha=in that eye and so on. ; anuppannā=that has not yet arisen. ; taṇhā ceva=craving also. ; uppajjati=arises. ; uppannā=that has arisen. ; taṇhā ca=craving also. ; punappunaṃ=again and again. ; pavattivasena=by way of occurring. ; nivisati=becomes established. ;

Myanmar Nissaya

atha=ထိုသို့ အောက်မေ့သော အခါ၌။ ; nesaṃ=ထိုသတ္တဝါတို့အား။ ; tattha=ထိုစက္ခုအစရှိသည်တို့၌။ ; anuppannā=သေးသော။ ; taṇhāceva=သည်လည်း။ ; uppajjati=၏။ ; uppannā=ပြီးသော။ ; taṇhāca=သည်လည်း။ ; punappunaṃ=တလုံလဲလဲ။ ; pavattivasena=ဖြင့်။ ; nivisati=တည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2978 | Chunk: 50

Tasmā thero ‘‘cakkhu loke piyarūpaṃ sātarūpaṃ, etthesā taṇhā uppajjamānā uppajjatī’’ tiādimāha.

AI Translation based on Nissaya

Therefore, the Elder said, 'The eye in the world is a dear form, an agreeable form; when this craving arises, it arises here,' and so on.

Vietnamese AI Translation

Do đó, Trưởng lão đã nói: 'Con mắt trong thế gian là hình thái đáng yêu, hình thái dễ chịu; khi khát ái này khởi lên, nó khởi lên ở đây,' v.v.

AI Translation Nissaya

tasmā=Therefore. ; thero=the Elder, the General of the Dhamma. ; cakkhu loke... uppajjatī'ti ādiṃ=the passage beginning 'the eye in the world... it arises'. ; āha=said. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; thero=ဓမ္မသေနာပတိမထေရ်သည်။ ; cakkhuloke.la. uppajjatītiādiṃ=ကို။ ; āha=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2979 | Chunk: 50

Tattha uppajjamānāti yadā uppajjati, tadā ettha uppajjatīti attho.

AI Translation based on Nissaya

Therein, when arising means: when it arises, it arises here, in what is a dear and agreeable form. This is the meaning.

Vietnamese AI Translation

Trong đó, **khi khởi lên** có nghĩa là: khi nó khởi lên, nó khởi lên ở đây, trong những gì là hình thái đáng yêu và dễ chịu. Đây là ý nghĩa.

AI Translation Nissaya

tattha=In that passage beginning with 'the eye in the world'. ; uppajjamānā'ti=the phrase 'when arising'. ; yadā=when. ; uppajjati=it arises. ; tadā=then. ; ettha=in this dear form, this agreeable form. ; uppajjati=it arises. ; iti attho=this is the meaning. ;

Myanmar Nissaya

tattha=ထိုစက္ခု လောကေ အစရှိသော ပါဌ်၌။ ; uppajjamānāti=ကား။ ; yadā=၌။ ; uppajjati=၏။ ; tadā=၌။ ; ettha=ဤပိယရုပ် သာတ ရုပ်၌။ ; uppajjati=၏။ ; iti attho=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2980 | Chunk: 50

Samudayasaccaniddesavaṇṇanā niṭṭhitā.

AI Translation based on Nissaya

The commentary on the exposition of the Truth of the Origin is finished.

Vietnamese AI Translation

Phần chú giải về Tập Đế đã hoàn tất.

AI Translation Nissaya

samudayasacca-niddesa-vaṇṇanā=The commentary on the exposition of the truth of the origin. ; niṭṭhitā=is finished. ;

Myanmar Nissaya

samudayasaccaniddesavaṇṇanā=သည်။ ; niṭṭhitā=ပြီ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2981 | Chunk: 50

Nirodhasaccaniddese [P1.160] yo tassāyeva taṇhāyāti ettha ‘‘yo tasseva dukkhassā’’ ti vattabbe yasmā samudayanirodheneva dukkhaṃ nirujjhati, no aññathā.

AI Translation based on Nissaya

In the exposition of the Truth of Cessation [P1.160], in the phrase **'whatever of that very craving,'** although it should have been stated as 'whatever of that very suffering,' it is expressed this way because suffering ceases only through the cessation of its origin, and not otherwise.

Vietnamese AI Translation

Trong phần giải thích về Diệt Đế [P1.160], trong cụm từ **'bất cứ gì của chính khát ái đó,'** mặc dù lẽ ra nó nên được nêu là 'bất cứ gì của chính khổ đó,' nó được diễn đạt theo cách này bởi vì khổ chỉ chấm dứt thông qua sự chấm dứt của nguồn gốc của nó, chứ không phải cách khác.

AI Translation Nissaya

nirodhasacca-niddese=In the exposition of the truth of cessation. ; yo tassāyeva taṇhāyā'ti ettha=in the phrase 'whatever of that very craving'. ; yo tasseva dukkhassā'ti=as 'whatever of that very suffering'. ; vattabbe=although it should be said. ; yasmā=because. ; samudaya-nirodhena=through the cessation of the origin. ; dukkhaṃ=the truth of suffering. ; nirujjhati=ceases. ; aññathā=by other means. ; na nirujjhati=it does not cease. ;

Myanmar Nissaya

nirodhasaccaniddese=၌။ ; yo tassāyeva taṇhāyātiettha=ဟူသော ပါဌ်၌။ ; yo tasseva dukkhassāti=ဟူ၍။ ; vattabbe=မူသင့်လျက်။ ; yasmā=ကြောင့်။ ; samudaya nirodhena=သဖြင့်။ ; dukkhaṃ=ဒုက္ခသစ္စာသည်။ ; nirujjhati=၏။ ; aññathā=ဖြင့်။ ; nonirujjhati=မချုပ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2982 | Chunk: 50

Yathāha –

AI Translation based on Nissaya

As it is said:

Vietnamese AI Translation

Như đã được nói:

AI Translation Nissaya

yathāha=As it is said. ;

Myanmar Nissaya

yathāha=ကား။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2983 | Chunk: 50

‘‘Yathāpi mūle anupaddave daḷhe, chinnopi rukkho punareva rūhati;

AI Translation based on Nissaya

'Just as, when the root is unharmed and firm, a tree, though cut down, grows again;

Vietnamese AI Translation

'Cũng như, khi rễ không bị tổn hại và vững chắc, một cây, dù bị chặt, vẫn mọc lại;

AI Translation Nissaya

yathāpi mūle...la...=Just as when the root... etc... ;

Myanmar Nissaya

yathāpi mūle.la.= ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2984 | Chunk: 50

Evampi taṇhānusaye anūhate, nibbattatī dukkhamidaṃ punappunan’’ ti. ( dha. pa. 338);

AI Translation based on Nissaya

even so, when the underlying tendency to craving is not uprooted, this suffering arises again and again.' (Dhp. 338)

Vietnamese AI Translation

thì cũng vậy, khi tùy miên ái không bị nhổ tận gốc, khổ này lại khởi lên lặp đi lặp lại.' (Dhp. 338)

AI Translation Nissaya

punappunan'ti=again and again. ; āha=he said. ; Meaning of the verse: ; mūle=When the root. ; anupaddave=is undamaged. ; daḷhe=and firm. ; rukkho=a tree. ; chinno'pi=though cut down. ; punar eva=again. ; rūhati yathā=grows, just so. ; evam pi=even so. ; taṇhānusaye=when the underlying tendency of craving. ; anūhate=is not uprooted. ; idaṃ dukkhaṃ=this suffering. ; punappunaṃ=again and again. ; nibbattati=arises. ;

Myanmar Nissaya

punappunanti=ဟူ၍။ ; āha=၏။ ; ဂါထာအနက်။ ။ ; mūle=အမြစ်အရင်းသည်။ ; anupaddave=မပျက်သည်ဖြစ်၍။ ; daḷhe=ခိုင်ခံ့သည်ရှိသော်။ ; rukkho=ပင်စည်သည်။ ; chinnopi=ပြတ်‌ေသော်လည်း။ ; punareva=တဖန်သာလျှင်။ ; rūhati yathā=ပေါက်ရောက်ပြန်သကဲ့သို့။ ; evampi=လည်း။ ; taṇhānusaye=ကို။ ; anūhate=မပယ်ရသေးသည်ရှိသော်။ ; idaṃ dukkhaṃ=သစ္စာသည်။ ; punappunaṃ=လဲလဲ။ ; nibbattati=ဖြစ်လာပြန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2985 | Chunk: 50

Tasmā taṃ dukkhanirodhaṃ dassento samudayanirodhena dassetuṃ evamāha.

AI Translation based on Nissaya

Therefore, wishing to show the cessation of that suffering, he spoke in this way, beginning with 'whatever of that very craving,' in order to show it by means of the cessation of the truth of the origin.

Vietnamese AI Translation

Do đó, mong muốn chỉ ra sự chấm dứt của khổ đó, ngài đã nói theo cách này, bắt đầu bằng 'bất cứ gì của chính khát ái đó,' để chỉ ra nó bằng cách chấm dứt sự thật về nguồn gốc.

AI Translation Nissaya

tasmā=Therefore. ; taṃ dukkha-nirodhaṃ=the cessation of that suffering. ; dassento=wishing to show. ; samudaya-nirodhena=by means of the cessation of the truth of the origin. ; dassetuṃ=in order to show. ; evaṃ=thus. ; yo tassāyeva taṇhāyā'ti=as 'whatever of that very craving'. ; āha=he said. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; taṃ dukkhanirodhaṃ=ထိုဒုက္ခသစ္စာ၏ ချုပ်ခြင်းကို။ ; vassento=ပြတော်မူလိုရကား။ ; samudayanirodhena=သမုဒယသစ္စာ၏ ချုပ်ခြင်းဖြင့်။ ; dassetuṃ=ငှါ။ ; evaṃ=သို့။ ; yotassāyeva taṇhāyāti=ဟူ၍။ ; āha=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2986 | Chunk: 50

Sīhasamānavuttino hi tathāgatā, te dukkhaṃ nirodhentā dukkhanirodhañca dassentā hetumhi paṭipajjanti, na phale.

AI Translation based on Nissaya

Indeed, the Tathāgatas have conduct similar to that of a lion. When they bring about the cessation of suffering and when they teach the cessation of suffering, they act upon the cause, not upon the effect.

Vietnamese AI Translation

Thật vậy, các vị Như Lai có hành xử giống như sư tử. Khi các ngài thực hiện sự chấm dứt khổ và khi các ngài dạy về sự chấm dứt khổ, các ngài tác động vào nguyên nhân, chứ không phải vào kết quả.

AI Translation Nissaya

hi=Indeed. ; tathāgatā=the Tathāgatas. ; sīha-samāna-vuttino=have conduct similar to that of a lion. ; te=Those Tathāgatas. ; dukkhaṃ=suffering. ; nirodhentā ca=when causing to cease, and. ; dukkha-nirodhaṃ=the cessation of suffering. ; dassentā ca=when showing, and. ; hetumhi=on the cause, craving. ; paṭipajjanti=they act. ; phale=on the fruit, which is the effect of craving. ; na paṭipajjanti=they do not act. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; tathāgatā=ရှင်စောဘုရားတို့သည်။ ; sīhasamānavuttino=ခြင်္သေ့မင်းနှင့်တူသော ကျင့်ခြင်းရှိကုန်၏။ ; te=ထိုရှင်စောဘုရားတို့သည်။ ; dukkhaṃ=ဒုက္ခသစ္စာကို။ ; nirodhentāca=ချုပ်စေကုန်သော်လည်းကောင်း။ ; dukkhanirodhaṃ=ဒုက္ခ၏ ချုပ်ရာကို။ ; dassentāca=ပြကုန်သော်လည်းကောင်း။ ; hetumhi=အကြောင်းဖြစ်သော တဏှာ၌။ ; paṭipajjanti=ကျင့်တော်မူကြကုန်၏။ ; phale=တဏှာ၏ အကျိုးဖြစ်သော တရား၌။ ; napaṭipajjanti=ကုန်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2987 | Chunk: 50

Suvānavuttino pana aññatitthiyā [M1.148], te dukkhaṃ nirodhentā dukkhanirodhañca dassentā attakilamathānuyogena ceva tasseva ca desanāya phale paṭipajjanti, na hetumhīti.

AI Translation based on Nissaya

The sectarians outside this teaching, however [M1.148], have conduct similar to that of a dog. When they bring about the cessation of suffering and when they teach the cessation of suffering, they act upon the effect by practicing and teaching self-mortification; they do not act upon the cause.

Vietnamese AI Translation

Tuy nhiên, những người ngoại đạo ngoài giáo pháp này [M1.148] có hành xử giống như chó. Khi họ thực hiện sự chấm dứt khổ và khi họ dạy về sự chấm dứt khổ, họ tác động vào kết quả bằng cách thực hành và dạy về khổ hạnh; họ không tác động vào nguyên nhân.

AI Translation Nissaya

pana=On the other hand. ; aññatitthiyā=the sectarians outside this teaching. ; suvāna-vuttino=have conduct similar to that of a dog. ; te=Those sectarians. ; dukkhaṃ=suffering. ; nirodhentā ca=when causing to cease, and. ; dukkha-nirodhaṃ=the cessation of suffering. ; dassentā ca=when showing, and. ; attakilamathānuyogena=by the practice of self-mortification. ; tasseva=of that very self-mortification. ; desanāya ca=and by teaching it. ; phale=on the effect of craving. ; paṭipajjanti=they act. ; hetumhi=on the cause, craving. ; na paṭipajjanti=they do not act. ;

Myanmar Nissaya

pana=ဗျတိရိက်ကိုဆိုအံံ။ ; aññatitthiyā=သာသနာမှ အပဖြစ်သော တိတ္ထိတို့သည်။ ; suvānavuttino=ခွေးနှင့်တူသော အကျင့်ရှိကုန်၏။ ; te=ထိုအညတိတ္ထိတို့သည်။ ; dukkhaṃ=ဒုက္ခသစ္စာကို။ ; niredhentāca=ချုပ်စေကုန်သော် လည်းကောင်း။ ; dukkhanirodhaṃ=ဒုက္ခ၏ ချုပ်ရာကို။ ; dassentā=ပြကုန်သော်လည်းကောငး်။ ; attakilamathānuyogena=ကိုယ်ကို ပင်ပန်းစေခြင်းကို အားထုတ်သောအားဖြင့်။ ; tasseva=ထိုအတ္တကိလမထာနုယောဂကိုသာလျှင်။ ; desanātaca=ဟောသောအားဖြင့်လည်းကောင်း။ ; phale=တဏှာ၏ အကျိုး၌။ ; paṭipajjanti=ကျင့်ကုန်၏။ ; hetumhi=အကြောင်းဖြစ်သော တဏှာ၌။ ; napaṭipajjanti=ကုန်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2988 | Chunk: 50

Sīhasamānavuttitāya satthā hetumhi paṭipajjanto ‘‘yo tassāyevā’’ tiādimāha.

AI Translation based on Nissaya

Thus, because he has conduct similar to that of a lion, the Teacher, acting upon the cause, spoke the passage beginning **'whatever of that very...'**

Vietnamese AI Translation

Do đó, bởi vì ngài có hành xử giống như sư tử, Bậc Đạo Sư, tác động vào nguyên nhân, đã nói đoạn văn bắt đầu bằng **'bất cứ gì của chính đó...'**

AI Translation Nissaya

iti pi=Thus also. ; sīha-samāna-vuttitāya=because of having conduct similar to that of a lion. ; satthā=the Teacher. ; hetumhi=on the cause. ; paṭipajjanto=wishing to act. ; satthā=the Teacher. ; yo tassāyevā'ti-ādiṃ=the passage beginning 'whatever of that very'. ; āha=said. ;

Myanmar Nissaya

itipi=လည်း။ ; sīhasamānavuttitāya=အဖြစ်ကြောင့်။ ; sattā=သည်။ ; hetumhi=၌။ ; paṭipajjanto=ကျင့်တော်မူလိုသောကြောင့်။ ; satthā=သည်။ ; yo tassāyevātiādiṃ=ကို။ ; āha=၏ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2989 | Chunk: 50

Dhammasenāpatipi satthārā vuttakkamenevāha.

AI Translation based on Nissaya

The General of the Dhamma also spoke in the very same way as it was spoken by the Teacher.

Vietnamese AI Translation

Tổng Tư lệnh Pháp cũng nói chính xác theo cách mà Bậc Đạo Sư đã nói.

AI Translation Nissaya

dhammasenāpati pi=The General of the Dhamma also. ; satthārā=by the Teacher. ; vuttakkamena eva=in the very same way it was spoken. ; āha=said. ;

Myanmar Nissaya

dhammasenāpatipi=အရှင်သာရိပုတ္တရာသည်လည်း။ ; satthārā=သည်။ ; vuttakkameneva=သာလျှင်။ ; āha=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2990 | Chunk: 50

Tattha tassāyeva taṇhāyāti yā sā taṇhā ‘‘ponobhavikā’’ ti vatvā kāmataṇhādivasena vibhattā uppattinivesanavasena ca heṭṭhā pakāsitā, tassāyeva taṇhāya.

AI Translation based on Nissaya

Therein, **of that very craving** refers to that same craving which was described as 'leading to renewed existence,' analyzed by way of craving for sensual pleasures, etc., and explained below in the exposition of the truth of suffering by way of its arising and becoming established.

Vietnamese AI Translation

Trong đó, **của chính khát ái đó** ám chỉ chính khát ái đã được mô tả là 'dẫn đến tái hữu,' được phân tích theo ái dục, v.v., và được giải thích dưới đây trong phần giải thích về khổ đế theo cách khởi lên và an trú của nó.

AI Translation Nissaya

tattha=Therein, in the passage beginning 'yo tassāyeva'. ; tassāyeva taṇhāyā'ti=The phrase 'of that very craving'. ; yā sā taṇhā=that craving which. ; ponobhavikā'ti=as 'leading to renewed existence'. ; vatvā=having spoken. ; kāmataṇhādi-vasena=by way of craving for sensual pleasures, etc.. ; vibhattā ca=was also analyzed. ; uppatti-nivesana-vasena=by way of arising and settling. ; heṭṭhā=below, in the exposition of the truth of suffering. ; pakāsitā ca=was also explained. ; tassāyeva taṇhāya=of that very craving that was analyzed in the exposition of the truth of suffering below. ;

Myanmar Nissaya

tattha=ထိုယော တဿာ ယေဝ အစရှိသော ပါဌ်၌။ ; tassāyeva taṇhāyāti=ကား။ ; yāsā taṇhā=သည်။ ; ponābhavikāti=ဟူ၍။ ; vatvā=ဟောပြီး၍။ ; kāmataṇhādīvasena=ဖြင့်။ ; vitattāca=ဝေလည်း ဝေဖန်အပ်၏။ ; upattinivesanavasena=ဖြစ်ခြင်း တည်ခြင်း၏ အစွမ်းဖြင့်။ ; heṭṭhā=အောက်ဖြစ်သော ဒုက္ခသစ္စာနိဒ္ဒေသ၌။ ; pakāsitāca=ပြလည်းပြအပ်၏။ ; tassāyeva taṇhāya=ထိုအောက်ဖြစ်သော ဒုက္ခသစ္စာနိဒ္ဒေသ၌ ဝေဖန်အပ်သော တဏှာ၏ သာလျှင်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2991 | Chunk: 50

Asesavirāganirodhoti virāgo vuccati maggo, ‘‘virāgā vimuccatī’’ ti ( ma. ni. 1.245; saṃ. ni. 3.12; mahāva. 23) hi vuttaṃ.

AI Translation based on Nissaya

**The remainderless fading and cessation**: 'Fading away' (virāga) refers to the path, for it is said, 'Through fading away, one is liberated' (Ma.ni.1.245; Saṃ.ni.3.12; Mahāva.23). 'Through the fading of passion, one is liberated.'

Vietnamese AI Translation

**Sự ly tham và chấm dứt không còn sót lại**: 'Ly tham' (*virāga*) ám chỉ đạo lộ, vì có câu nói: 'Thông qua ly tham, người ta được giải thoát' (Ma.ni.1.245; Saṃ.ni.3.12; Mahāva.23). 'Thông qua sự ly tham, người ta được giải thoát.'

AI Translation Nissaya

asesa-virāga-nirodho'ti=the phrase 'the remainderless fading and cessation'. ; maggo=the path. ; virāgo'ti=as 'fading away'. ; vuccati=is called. ; hi=Indeed. ; virāgā vimuccatī'ti=as 'through fading away, one is liberated'. ; vuttaṃ=it is said. ; virāgā=Through the fading of passion. ; vimuccati=one is liberated. ;

Myanmar Nissaya

asesavirāganirodhoti=ကား။ ; maggo=ကို။ ; virāgoti=ဟူ၍။ ; vuccati=၏။ ; hi saccaṃ=၏။ ; virāgā vimuccatīti=ဟူ၍။ ; vuttaṃ=၏။ ; virāgā=ရာဂကင်းခြင်းကြောင့်။ ; vimuccati=လွတ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2992 | Chunk: 50

Virāgena nirodho virāganirodho, anusayasamugghātato aseso virāganirodho asesavirāganirodho.

AI Translation based on Nissaya

Cessation through fading away (virāgena nirodho) is 'fading-cessation' (virāganirodho). Because it uproots the underlying tendencies, it is a remainderless fading-cessation (asesavirāganirodho).

Vietnamese AI Translation

Sự chấm dứt thông qua ly tham (*virāgena nirodho*) là 'ly tham-diệt' (*virāganirodho*). Bởi vì nó nhổ tận gốc các tùy miên, nó là một sự ly tham-diệt không còn sót lại (*asesavirāganirodho*).

AI Translation Nissaya

virāgena=Through the path. ; nirodho=is the cessation of craving. ; virāga-nirodho=Cessation of craving through the path. ; anusayasamugghātato aseso virāganirodho asesavirāganirodho.

Myanmar Nissaya

virāgena=မဂ်ဖြင့်။ ; nirodho=တဏှာ၏ ချုပ်ခြင်းတည်း။ ; virāganirodheū=မဂ်ဖြင့် တဏှာ၏ ချုပ်ခြင်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2993 | Chunk: 50

Atha vā virāgoti hi pahānaṃ vuccati, tasmā aseso virāgo aseso nirodhoti evampettha yojanā daṭṭhabbā.

AI Translation based on Nissaya

Alternatively, since the term 'fading away' (virāga) refers to abandonment, the construction here should be understood as: remainderless fading away is remainderless cessation.

Vietnamese AI Translation

Hoặc cách khác, vì thuật ngữ 'ly tham' (*virāga*) ám chỉ sự từ bỏ, thì cấu trúc ở đây nên được hiểu là: ly tham không còn sót lại là sự chấm dứt không còn sót lại.

AI Translation Nissaya

athavā=Alternatively. ; hi=because. ; virāgo'ti padena=by the term 'virāga'. ; pahānaṃ=abandonment. ; vuccati=is spoken of. ; tasmā=therefore. ; aseso=remainderless. ; virāgo=abandonment of craving. ; aseso=remainderless. ; nirodho=cessation of craving. ; iti evam pi=thus also. ; ettha=in this term 'asesavirāganirodha'. ; yojanā=the connection. ; daṭṭhabbā=should be seen. ;

Myanmar Nissaya

athavā=ကား။ ; hi yasmā=ကြောင့်။ ; virāgotipadena=ဖြင့်။ ; pahānaṃ=ပယ်ခြင်းကို။ ; vuccati=၏။ ; tasmā=ကြောင့်။ ; aseso=အကြွင်းမရှိသော။ ; virāgo=တဏှာကို ပယ်ခြင်း။ ; aseso=သော။ ; nirodheū=တဏှာ၏ ချုပ်ခြင်း။ ; iti vavampi=သို့လည်း။ ; vattha=ဤအသေသဝိရာဂနိရောဓ ဟူသော ပုဒ်၌။ ; yojanā=ခြင်းကို။ ; daṭṭhabbā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2994 | Chunk: 50

Atthato pana sabbāneva panetāni asesavirāganirodhotiādīni nibbānasseva vevacanāni.

AI Translation based on Nissaya

In terms of meaning, however, all these terms, beginning with 'remainderless fading and cessation,' are synonyms for Nibbāna itself.

Vietnamese AI Translation

Tuy nhiên, về mặt ý nghĩa, tất cả các thuật ngữ này, bắt đầu bằng 'ly tham và chấm dứt không còn sót lại,' là các từ đồng nghĩa với chính Niết Bàn.

AI Translation Nissaya

pana=However, to speak of the meaning of the term 'asesavirāganirodha'. ; attato=in terms of meaning. ; sabbāneva=all of them. ; etāni asesavirāganirodho'ti ādīni=these terms beginning with 'remainderless fading and cessation'. ; nibbānassa eva=of Nibbāna itself. ; vevacanāni=are synonyms. ;

Myanmar Nissaya

pana=အသေသဝိရာဂနိရောဓ ဟူသော ပုဒ်၏ အနက်ကိုဆိုအံ့။ ; attato=ဖြင့်။ ; sabbāneva=ဥဿုံသာလျှင်ဖြစ်ကုန်သော။ ; etāni asesavirāganirodhoti ādīni=ဤ အသေသ။လ။ ဤသို့ အစရှိသော ပုဒ်တို့သည်။ ; nibbānasseva=သာလျှင်။ ; vevacanāni=တို့တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2995 | Chunk: 50

Paramatthato hi dukkhanirodhaṃ ariyasaccanti [V1.136] nibbānaṃ vuccati.

AI Translation based on Nissaya

Indeed, in the ultimate sense, Nibbāna is called 'the noble truth of the cessation of suffering' [V1.136].

Vietnamese AI Translation

Thật vậy, theo nghĩa tối hậu, Niết Bàn được gọi là 'Diệt Thánh Đế' [V1.136].

AI Translation Nissaya

hi=Indeed. ; paramatthato=in the ultimate sense. ; dukkhanirodhaṃ ariyasaccan'ti=as 'the noble truth of the cessation of suffering'. ; nibbānaṃ=Nibbāna. ; vuccati=is called. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; maramatthato=အားဖြင့်။ ; dukkhanirodhaṃ ariyasaccanti=ဟူ၍။ ; nibbānaṃ=ကို။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2996 | Chunk: 50

Yasmā pana taṃ āgamma taṇhā asesā virajjati nirujjhati, tasmā taṃ ‘‘tassāyeva taṇhāya asesavirāganirodho’’ ti vuccati.

AI Translation based on Nissaya

However, because craving fades away and ceases without remainder by taking Nibbāna as its object, Nibbāna is called **'the remainderless fading and cessation of that very craving.'**

Vietnamese AI Translation

Tuy nhiên, bởi vì khát ái ly tham và chấm dứt không còn sót lại bằng cách lấy Niết Bàn làm đối tượng của nó, Niết Bàn được gọi là **'sự ly tham và chấm dứt không còn sót lại của chính khát ái đó.'**

AI Translation Nissaya

pana=However. ; yasmā=because. ; taṃ=that Nibbāna. ; āgamma=by taking as object. ; taṇhā=craving. ; asesā=without remainder. ; virajjati=fades away. ; nirujjhati=ceases. ; tasmā=therefore. ; taṃ=that Nibbāna. ; tassāyeva ... nirodho'ti=as 'the remainderless fading and cessation of that very craving'. ; vuccati=is called. ;

Myanmar Nissaya

pana=သော်ကား။ ; yasmā=ကြောင့်။ ; taṃ=ထိုနိဗ္ဗာန်သို့။ ; āgamma=အာရုံပြုသော အားဖြင့်ရောက်၍။ ; taṇhā=သည်။ ; asesā=အကြွင်းမဲ့။ ; virajjati=ကင်း၏။ ; nirujjati=ချုပ်၏။ ; tasmā=ကြောင့်။ ; taṃ=ထိုနိဗ္ဗာန်ကို။ ; tassāyeva.la. nirodhoti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2997 | Chunk: 50

Nibbānañca āgamma taṇhā cajīyati paṭinissajjīyati [P1.161] muccati na allīyati, kāmaguṇālayesu cettha ekopi ālayo natthi, tasmā nibbānaṃ cāgo paṭinissaggo mutti anālayoti vuccati.

AI Translation based on Nissaya

Furthermore, by taking Nibbāna as the object, craving is relinquished, let go of; one is released from craving, and craving does not cling. And in this Nibbāna [P1.161], there is not a single abode among the abodes which are the strands of sensual pleasure. Therefore, Nibbāna is called **relinquishment, letting go, release, and non-abode.**

Vietnamese AI Translation

Hơn nữa, bằng cách lấy Niết Bàn làm đối tượng, khát ái được từ bỏ, buông bỏ; người ta được giải thoát khỏi khát ái, và khát ái không bám víu. Và trong Niết Bàn này [P1.161], không có một trú xứ nào trong số các trú xứ là năm sợi dây dục lạc. Do đó, Niết Bàn được gọi là **sự từ bỏ, sự buông xả, sự giải thoát, và sự không trú xứ.**

AI Translation Nissaya

ca=Furthermore. ; nibbānaṃ=Nibbāna. ; āgamma=by taking as a basis. ; nibbānaṃ=to Nibbāna. ; āgamma=by taking as an object and reaching. ; taṇhā=craving. ; cajīyati=is relinquished. ; paṭinissajjiyati=is let go of. ; taṇhā=from craving. ; muccati=one is released. ; taṇhā=craving. ; na allīyati=does not cling. ; ca=And. ; ettha=in this Nibbāna. ; kāmaguṇālayesu=among the abodes which are the strands of sensual pleasure. ; ekopi=even one. ; ālayo=abode. ; eko=one. ; ālayo'pi=abode at all. ; natthi=does not exist. ; tasmā=Therefore. ; nibbānaṃ=the unconditioned Nibbāna. ; cāgo paṭinissaggo mutti anālayo'ti=as 'relinquishment, letting go, release, non-abode'. ; vuccati=is called. ;

Myanmar Nissaya

ca=ထိုမှတပါး။ ; nibbānaṃ=ကို။ ; āgamma=စွဲ၍။ ; tanaññaḥ= ; nibbānaṃ=သို့။ ; āgamma=အာရုံပြုသော အားဖြင့် ရောက်၍။ ; taṇhā=ကို။ ; cajīyati=စွန့်အပ်၏။ ; paṭinissajjiyati=တဖန်စွန့်အပ်၏။ ; taṇhā=မှ။ ; muccati=၏။ ; taṇhā=သည်။ ; naallīyati=မကပ်ငြိ။ ; ca=ဆက်။ ; ettha=ဤနိဗ္ဗာန်၌။ ; kāmaguṇālayesu=ကာမဂုဏ်တည်းဟူသော တည်ရာတို့တွင်။ ; ekopi=တပါးလည်း ဖြစ်သော။ ; ālayo=တည်ရာသည်။ ; tanaññaḥ= ; eko=သော။ ; ālayopi=တည်ရာမျှလည်း။ ; natthi=မရှိ။ ; tasmā=ကြောင့်။ ; nibbānaṃ=အသင်္ခတနိဗ္ဗာန်ကို။ ; cāvo paṭinissaggo mutti anālayoti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2998 | Chunk: 50

Ekameva hi nibbānaṃ, nāmāni panassa sabbasaṅkhatānaṃ nāmapaṭipakkhavasena anekāni honti.

AI Translation based on Nissaya

Indeed, Nibbāna is just one, but its names are many, being the opposites of the names of all conditioned things.

Vietnamese AI Translation

Thật vậy, Niết Bàn chỉ là một, nhưng tên gọi của nó thì nhiều, là những từ đối lập với tên gọi của tất cả các pháp hữu vi.

AI Translation Nissaya

hi=Indeed. ; nibbānaṃ=Nibbāna. ; ekam eva=is just one. ; pana tathāpi=However, even so. ; assa=of that unconditioned Nibbāna. ; nāmāni=the names. ; sabbasaṅkhatānaṃ=of all conditioned things. ; nāma-paṭipakkha-vasena=by way of being the opposite of their names. ; anekāni=are many. ; honti=they are. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; nibbānaṃ=သည်။ ; ekameva=တပါးတည်းသာလျှင်တည်း။ ; pana tathāpi=ထိုသို့ဖြစ်သော်လည်း။ ; assa=ထိုအသင်္ခတနိဗ္ဗာန်၏။ ; nāmāni=အမည်တို့သည်။ ; sabbasaṅkhatānaṃ=တို့၏။ ; nāmapaṭipakkhavasena=အစွမ်းဖြင့်။ ; anekāni=များကုန်သည်။ ; honti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 2999 | Chunk: 50

Seyyathidaṃ – asesavirāgo asesanirodho cāgo paṭinissaggo mutti anālayo rāgakkhayo dosakkhayo mohakkhayo taṇhākkhayo anuppādo appavattaṃ animittaṃ appaṇihitaṃ anāyūhanaṃ appaṭisandhi anupapatti agati ajātaṃ ajaraṃ abyādhi amataṃ asokaṃ aparidevaṃ anupāyāsaṃ asaṃkiliṭṭhantiādīni.

AI Translation based on Nissaya

That is to say: the remainderless fading away, the remainderless cessation, relinquishment, letting go, release, the non-abode, the destruction of lust, the destruction of hatred, the destruction of delusion, the destruction of craving, non-arising, non-occurrence, the signless, the desireless, non-accumulation, no-relinking, non-rebirth, no-destination, the unborn, the unaging, the unailing, the deathless, the sorrowless, the unlamenting, the despairless, the undefiled, and so on.

Vietnamese AI Translation

Đó là: sự ly tham không còn sót lại, sự chấm dứt không còn sót lại, sự từ bỏ, sự buông xả, sự giải thoát, sự không trú xứ, sự đoạn tận tham, sự đoạn tận sân, sự đoạn tận si, sự đoạn tận ái, sự không sinh, sự không tái diễn, vô tướng, vô nguyện, không tích lũy, không tái kết nối, không tái sinh, không đích đến, vô sinh, không già, không bệnh, bất tử, không sầu, không than van, không tuyệt vọng, không ô nhiễm, v.v.

AI Translation Nissaya

idaṃ imāni nāmāni=These many names are. ; seyyathā katamāni=as follows. ; asesavirāgo=the remainderless fading away. ; asesanirodho=the remainderless cessation. ; cāgo=relinquishment. ; paṭinissaggo=letting go. ; mutti=release. ; mohakkhayo=the destruction of delusion. ; taṇhākkhayo=the destruction of craving. ; anuppādo=non-arising. ; appavattaṃ=non-occurrence. ; animittaṃ=the signless. ; appaṇihitaṃ=the desireless. ; anāyūhanaṃ=non-accumulation. ; appaṭisandhi=no relinking. ; anupapatti=non-rebirth. ; agati=no destination. ; ajātaṃ=the unborn. ; ajaraṃ=the unaging. ; abyādhi=the unailing. ; amataṃ=the deathless. ; asokaṃ=the sorrowless. ; aparidevaṃ=the unlamenting. ; anupāyāsaṃ=the despairless. ; asaṃkiliṭṭhaṃ=the undefiled. ; iti-ādīni=and so on. ;

Myanmar Nissaya

idaṃ imāni nāmāni=ဤများသော အမည်တို့ဟူသည်။ ; seyyathā katamāni=ကား။ ; asesavirāgo=လည်းကောင်း။ ; asesanirodho=လည်းကောင်း။ ; tago=လည်းကောင်း။ ; paṭinissaggo=လည်းကောင်း။ ; mutti=လည်းကောင်း။ ; mohakkhayo=လည်းကောင်း။ ; taṇhakkhayo=လည်းကောင်း။ ; anuppādo=လည်းကောင်း။ ; appavattaṃ=လည်းကောင်း။ ; animittaṃ=လည်းကောင်း။ ; appaṇihitaṃ=လည်းကောင်း။ ; anāyūhanaṃ=လည်းကောင်း။ ; appaṭisandhi=လည်းကေငး်။ ; anupapatti=လည်းကောင်း။ ; agati=လည်းကောင်း။ ; ajātaṃ=လည်းကောင်း။ ; ajaraṃ=လည်းကောင်း။ ; abyādhi=လည်းကောင်း။ ; amataṃ=လည်းကေင်း။ ; asokaṃ=လည်းကောင်း။ ; aparidevaṃ=လည်းကောင်း။ ; anapāyāsaṃ=လည်းကောင်း။ ; asaṃkiliṭṭhaṃ=လည်းကောင်း။ ; itiādini=ဤသို့ အစရှိသည်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3000 | Chunk: 50

Idāni maggena chinnāya nibbānaṃ āgamma appavattippattāyapi ca taṇhāya yesu vatthūsu tassā uppatti dassitā, tattheva abhāvaṃ dassetuṃ sā kho panesātiādimāha.

AI Translation based on Nissaya

Now, in order to show the absence of craving in the very same bases where its arising was shown—craving which, having been cut off by the path, has reached non-occurrence by taking Nibbāna as its object—the Elder, the General of the Dhamma, spoke the passage beginning **'sā kho pan'esā'** (And this craving...).

Vietnamese AI Translation

Bây giờ, để chỉ ra sự vắng mặt của khát ái trong chính những cơ sở nơi mà sự khởi lên của nó đã được chỉ ra—khát ái mà, sau khi đã bị cắt đứt bởi đạo lộ, đã đạt đến sự không tái diễn bằng cách lấy Niết Bàn làm đối tượng của nó—Trưởng lão, Tổng Tư lệnh Pháp, đã nói đoạn văn bắt đầu bằng **'sā kho pan'esā'** (Và khát ái này...).

AI Translation Nissaya

idāni=Now. ; maggena=by the noble path. ; chinnāya=having been cut off. ; nibbānaṃ=to Nibbāna. ; āgamma=by taking as an object and reaching. ; appavattippattāyapi=although it has reached non-occurrence. ; taṇhāya ca=of craving also. ; yesu vatthūsu=in whichever bases. ; tassā=of that craving. ; uppatti=the arising. ; dassitā=was shown. ; tattheva=in those very bases. ; abhāvaṃ=the absence of craving. ; dassetuṃ=in order to show. ; sā kho pan'esā'ti-ādiṃ=the passage beginning 'sā kho pan'esā'. ; thero=the Elder, the General of the Dhamma. ; āha=said. ;

Myanmar Nissaya

idāni=၌။ ; aggena=အရိယာမဂ်သည်။ ; chinnāya=ဖြစ်အပ်သော်။ ; nibbānaṃ=သို့။ ; āgamma=အာရုံပြုသော အားဖြင့် ရောက်၍။ ; appavattippattāyapi=မဖြစ်ခြင်းသို့ ရောက်သည်လည်းဖြစ်သော။ ; taṇhāyaca=၏လည်း။ ; yesuvatthusu=အကြင်တဏှာ၏ အကြောင်းဖြစ်ကုန်သော ပိယရုပ် သာတရုပ်တို့၌။ ; tassā=ထိုတဏှာ၏။ ; uppatti=ဖြစ်ခြင်းကို။ ; dassitā=ပြတော်မူအပ်၏။ ; tattheva=ထိုတဏှာ၏ အကြောင်းဖြစ်သော ပိယရုပ် သာတရုပ်တို့၌သာလျှင်။ ; abhāvaṃ=တဏှာ၏ မရှိခြင်းကို။ ; dassetuṃ=ငှါ။ ; sākho manesātiādiṃ=ကို။ ; thero=ဓမ္မဒေသနာပတိမထေရ်သည်။ ; āha=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3001 | Chunk: 50

Tattha yathā puriso khette jātaṃ tittakālābuvalliṃ disvā aggato paṭṭhāya mūlaṃ pariyesitvā chindeyya, sā anupubbena milāyitvā appaññattiṃ gaccheyya, tato tasmiṃ khette tittakālābu niruddhā pahīnāti vucceyya, evameva khette tittakālābu [M1.149] viya cakkhādīsu taṇhā.

AI Translation based on Nissaya

Therein, it is like a man who, seeing a bitter gourd vine growing in his field [M1.149], would search for its root starting from the tip and cut it. That vine would gradually wither and become unidentifiable. Then it could be said that in that field, the bitter gourd has ceased, has been abandoned. In the same way, craving arises in relation to the eye and other faculties, just like the bitter gourd in the field.

Vietnamese AI Translation

Trong đó, ví như một người đàn ông, thấy một dây khổ qua mọc trong ruộng của mình [M1.149], sẽ tìm rễ của nó bắt đầu từ ngọn và cắt nó. Dây đó sẽ dần dần héo úa và trở nên không thể nhận diện được. Sau đó có thể nói rằng trong ruộng đó, khổ qua đã chấm dứt, đã bị từ bỏ. Cũng theo cách đó, khát ái khởi lên liên quan đến mắt và các căn khác, giống như khổ qua trong ruộng.

AI Translation Nissaya

tattha=In that passage beginning with 'sā kho pan'esā'. ; puriso=a farmer. ; khette=in a field. ; jātaṃ=that has grown. ; tittakālābu-valliṃ=a bitter gourd vine. ; disvā=having seen. ; aggato=from the tip. ; paṭṭhāya=starting. ; mūlaṃ=the root. ; pariyesitvā=having searched for. ; chindeyya=he should cut. ; sā=That bitter gourd vine. ; anupubbena=gradually. ; milāyitvā=having withered. ; appaññattiṃ=to the state of being unidentifiable. ; vā=or to the state of not being called a bitter gourd vine. ; gaccheyya=it would go. ; tato=After that. ; tasmiṃ khette=in that field. ; tittakālābu=the bitter gourd. ; vā=or. ; niruddhā=has ceased. ; pahīnā=has been abandoned. ; iti=thus. ; vucceyya yathā=it might be said, just so. ; evam eva=in the same way. ; khette=in a field. ; tittakālābu viya=like a bitter gourd. ; cakkhādīsu=in the eye, etc. ; taṇhā=craving. ; uppajjati=arises. ;

Myanmar Nissaya

tattha=ထို သာ ခေါ ပနေသာ အစရှိသော ပါဌ်၌။ ; puriso=ယာလုပ်ယောင်္ကျားသည်။ ; khette=ယာခင်း၌။ ; jātaṃ=ပေါက်ရောက်သော။ ; tittakālābuvalliṃ=ဖူးခါးနွယ်ကို။ ; disvā=၍။ ; aggato=နွယ်ဖျားမှ။ ; paṭṭhāya=၍။ ; mūlaṃ=နွယ်ရင်းကို။ ; paridayasitvā=ရှာ၍။ ; chindeyya=နုတ်ဖြတ်ရာ၏။ ; sā=ထိုဗူးခါးနွယ်သည်။ ; anupubbena=အစဉ်သဖြင့်။ ; milāyitvā=ညှိုးနွမ်း၍။ ; appaññatatiṃ=မထင်သည်၏အဖြစ်သို့။ ; vā=ဗူးခါးနွယ်ဟူ၍ မခေါ်သည်၏ အဖြစ်သို့။ ; gaccheyya=ရာ၏။ ; tato=ထို့နောင်မှ။ ; tasmiṃ khette=ထိုယာခင်း၌။ ; tikkakālābu=သည်။ ; vā=ကို။ ; niruddhā=ချုပ်ပြီ။ ; pahīnā=ပယ်အပ်ပြီ။ ; iti=သို့။ ; vucceyya yathā=သို့။ ; evameva=တူ။ ; khette=၌။ ; tittakālābuviya=ကဲ့သို့။ ; cakkhādīsu=တို့။ ; taṇhā=သည်။ ; uppajjati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3002 | Chunk: 50

Sā ariyamaggena mūlacchinnā nibbānaṃ āgamma appavattiṃ gacchati.

AI Translation based on Nissaya

That craving, when cut off by the noble path, reaches non-occurrence by taking Nibbāna as its object.

Vietnamese AI Translation

Khát ái đó, khi bị cắt đứt bởi Thánh đạo, đạt đến sự không tái diễn bằng cách lấy Niết Bàn làm đối tượng của nó.

AI Translation Nissaya

sā=That craving. ; ariyamaggena=by the noble path. ; chinnā=when cut off. ; nibbānaṃ=Nibbāna. ; āgamma=by taking as an object and reaching. ; appavattiṃ=to non-occurrence. ; gacchati=it goes. ;

Myanmar Nissaya

sā=ထိုတဏှာကို။ ; ariyamaggena=သည်။ ; chinnā=ဖြတ်ပြီးသည်ရှိသော်။ ; nibbānaṃ=သို့။ ; āgamma=အာရုံပြုသော အားဖြင့် ရောက်၍။ ; appavattiṃ=မဖြစ်ခြင်းသို့။ ; gacchati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3003 | Chunk: 50

Evaṃ gatā pana tesu vatthūsu khette tittakālābu viya na paññāyati.

AI Translation based on Nissaya

And once it has gone to non-occurrence in this way, it is no longer perceived in those bases, just like the bitter gourd is no longer perceived in the field.

Vietnamese AI Translation

Và một khi nó đã đi đến sự không tái diễn theo cách này, nó không còn được nhận thức trong những cơ sở đó, giống như khổ qua không còn được nhận thức trong ruộng.

AI Translation Nissaya

pana=Furthermore, to show its non-recurrence. ; evaṃ=thus. ; gatā=craving that has gone to non-occurrence. ; tesu vatthūsu=in those bases of craving, the dear and agreeable forms. ; khette=in the field. ; tittakālābu viya=like the bitter gourd. ; na paññāyati=is not perceived. ;

Myanmar Nissaya

pana=တဖန်မဖြစ်သည်ကိုပြအံ့။ ; evaṃ=သို့။ ; gatā=မဖြစ်ခြင်းသို့ ရောက်သော တဏှာသည်။ ; tesu vatthūsu=ထိုတဏှာ၏ အကြောင်းဖြစ်ကုန်သော ပိယရုပ်သာတရုပ်တို့၌။ ; khette=၌။ ; tittakālābuviya=ကဲ့သို့။ ; napaññāyati=မထင်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3004 | Chunk: 50

Yathā ca aṭavito core ānetvā nagarassa dakkhiṇadvāre ghāteyyuṃ, tato aṭaviyaṃ corā matāti vā māritāti vā vucceyyuṃ, evameva aṭaviyaṃ corā viya yā cakkhādīsu taṇhā, sā dakkhiṇadvāre corā viya nibbānaṃ āgamma niruddhattā nibbāne niruddhā.

AI Translation based on Nissaya

Or, just as if thieves were brought from a forest and executed at the southern gate of a city, after which it would be said that the thieves in the forest are dead or have been killed, in the same way, craving arises in relation to the eye and other faculties like the thieves in the forest. Because that craving has ceased by taking Nibbāna as its object—like the thieves executed at the southern gate—it is said to have ceased in those places (the eye, etc.), just as the thieves are said to be gone from the forest.

Vietnamese AI Translation

Hoặc, cũng như nếu những tên trộm bị đưa từ rừng về và hành quyết tại cổng phía nam của một thành phố, sau đó người ta sẽ nói rằng những tên trộm trong rừng đã chết hoặc đã bị giết, cũng theo cách đó, khát ái khởi lên liên quan đến mắt và các căn khác giống như những tên trộm trong rừng. Bởi vì khát ái đó đã chấm dứt bằng cách lấy Niết Bàn làm đối tượng của nó—giống như những tên trộm bị hành quyết tại cổng phía nam—người ta nói rằng nó đã chấm dứt ở những nơi đó (mắt, v.v.), giống như những tên trộm được cho là đã biến mất khỏi rừng.

AI Translation Nissaya

ca=Also. ; aṭavito=from the forest. ; core=thieves. ; ānetvā=having brought. ; nagarassa=of the city. ; dakkhiṇadvāre=at the southern gate. ; ghāteyyuṃ=they might be executed. ; tato=After that. ; aṭaviyaṃ=in the forest. ; corā=the thieves. ; vā=or. ; matā=are dead. ; iti vā=thus, or. ; māritā=have been killed. ; iti vā=thus, or. ; vucceyyuṃ yathā=it might be said, just so. ; evam eva=in the same way. ; aṭaviyaṃ=in the forest. ; corā viya=like the thieves. ; cakkhādīsu=in the eye, etc. ; taṇhā=craving. ; uppajjati=arises. ; sā=That craving. ; dakkhiṇadvāre=at the southern gate. ; coro viya=like the executed thief. ; nibbānaṃ=Nibbāna. ; āgamma=by taking as object. ; niruddhattā=because it has ceased. ; nibbāne=in Nibbāna. ; corā viya=like the thieves. ; na paññāyati=it is not perceived. ;

Myanmar Nissaya

ca=ပါး။ ; aṭavito=တောကြီးမှ။ ; core=တို့ကို။ ; ānetvā=ဖမ်းဆောင်၍. ; nagarassa=မြို့၏။ ; daṇkhiṇadvāre=၌။ ; ghāteyyuṃ=သတ်ကုန်ရာ၏။ ; tato=ထို့နောင်။ ; aṭaviyaṃ=၌။ ; corā=တို့သည်။ ; vā=တို့ကို။ ; matā=ကုန်ပြီ။ ; itivā=ဤသို့လည်းကောင်း။ ; māritā=အပ်ကုန်ပြီ။ ; itivā=သို့လည်းကောင်း။ ; vucceyyuṃ yathā=ကုန်သကဲ့သို့။ ; e‌vameva=အတူ။ ; aṭaviyaṃ=၌။ ; corāviya=ကဲ့သို့။ ; cakkhādīsu=တို့၌။ ; taṇhā=သည်။ ; uppajjati=၏။ ; sā=သည်။ ; daṇkhiṇadvāre=၌။ ; coroviya=သတ်အပ်သော ခိုးသူကဲ့သို့။ ; nibbānaṃ=ကို။ ; āgamma=ကို။ ; niruddhattā=ကြောင့်။ ; nibbāne=၌။ ; corāviya=ကဲ့သို့။ ; napaññāyati=မထင်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3005 | Chunk: 50

Tenassā tattheva nirodhaṃ dassento ‘‘cakkhu loke piyarūpaṃ sātarūpaṃ, etthesā taṇhā pahīyamānā pahīyatī’’ tiādimāha.

AI Translation based on Nissaya

For that reason, showing the cessation of that craving in those very same places, the Elder said, **'The eye in the world is a dear form, an agreeable form; when this craving is being abandoned, it is abandoned here,'** and so on.

Vietnamese AI Translation

Vì lý do đó, chỉ ra sự chấm dứt của khát ái đó ở chính những nơi đó, Trưởng lão đã nói: **'Con mắt trong thế gian là hình thái đáng yêu, hình thái dễ chịu; khi khát ái này đang bị từ bỏ, nó bị từ bỏ ở đây,'** v.v.

AI Translation Nissaya

tena=For that reason. ; assā=of that craving. ; tattheva=in that very dear and agreeable form. ; nirodhaṃ=the cessation. ; dassento=the Elder, showing. ; cakkhu loke... pahīyatī'ti ādiṃ=the passage beginning 'the eye in the world... is abandoned'. ; āha=said. ;

Myanmar Nissaya

tena=ထို့ကြောင့်။ ; assā=ထိုတဏှာ၏။ ; tattheva=ထိုပိယရုပ် သာတရုပ်၌သာလျှင်။ ; nirodhaṃ=ချုပ်ခြင်းကို။ ; dassento=မထေရ်သည်။ ; cakkhu loke.la. pahīyatītiādiṃ=ကို။ ; āha=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3006 | Chunk: 50

Atha vā taṇhuppādavatthussa pariññātattā pariññātavatthusmiṃ puna na uppajjanato anuppādanirodhavasena taṇhuppādavatthusmiṃyeva nirujjhatīti vuccati.

AI Translation based on Nissaya

Alternatively, because the basis for the arising of craving is fully understood, and because craving does not arise again in a basis that has been fully understood, it is said that craving ceases in the very same basis where it arose, by way of the cessation that is non-arising.

Vietnamese AI Translation

Hoặc cách khác, bởi vì cơ sở cho sự khởi lên của khát ái được tuệ tri hoàn toàn, và bởi vì khát ái không khởi lên lại trong một cơ sở đã được tuệ tri hoàn toàn, người ta nói rằng khát ái chấm dứt ở chính cơ sở nơi nó đã khởi lên, thông qua sự chấm dứt là sự không khởi lên.

AI Translation Nissaya

athavā=Alternatively. ; taṇhuppāda-vatthussa=of the basis for the arising of craving, the dear and agreeable form. ; vā=or. ; pariññātattā=because of being fully understood. ; pariññāta-vatthusmiṃ=in the basis that has been fully understood. ; puna=again. ; na uppajjanato=because of not arising. ; anuppāda-nirodha-vasena=by way of the cessation that is non-arising. ; taṇhuppāda-vatthusmiṃ yeva=in the very basis of the arising of craving, the dear and agreeable form. ; nirujjhatī'ti=it ceases. ; vuccati=it is said. ;

Myanmar Nissaya

athavā=ကား။ ; taṇhuppādavatthussa=တဏှာဖြစ်ခြင်း၏ အကြောင်းဖြစ်သော ပိယရုပ်သာတရုပ်၌။ ; vā=ကို။ ; pariññātattā=ပိုင်းခြား၍ သိအပ်သည်၏ အဖြစ်ကြောင့်။ ; pariññātavatthusmiṃ=သော တဏှာ၏ အကြောင်းဖြစ်သော ပိယရုပ်သာတရုပ်၌။ ; puna=နောက်ပြီးတဖန်။ ; nauppajjanato=ဖြစ်မလာခြင်းကြောင့်။ ; anuppādanirodhavasena=တဖန်မဖြစ်ခြင်းဟု ဆိုအပ်သော ချုပ်ခြင်း၏ အစွမ်းဖြင့်။ ; taṇhuppādavatthusmiṃyeva=ဖြစ်သော ပိယရုပ် သာတရုပ်၌သာလျှင်။ ; nirujjhatīti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3007 | Chunk: 50

Ettha ca uppajjanapaṭipakkhavasena pahīyatīti vuttaṃ, nivisanapaṭipakkhavasena nirujjhatīti.

AI Translation based on Nissaya

And here, 'is abandoned' is stated as the opposite of 'arising,' and 'ceases' is stated as the opposite of 'becoming established.'

Vietnamese AI Translation

Và ở đây, 'bị từ bỏ' được nêu ra là ngược lại với 'khởi lên,' và 'chấm dứt' được nêu ra là ngược lại với 'trở nên an trú.'

AI Translation Nissaya

ca=And. ; ettha=in this passage 'Whatever in the world is a dear form...'. ; uppajjana-paṭipakkha-vasena=by way of being the opposite of arising. ; pahīyatī'ti='is abandoned'. ; vuttaṃ=is said. ; nivisana-paṭipakkha-vasena=by way of being the opposite of becoming established. ; nirujjhatī'ti='ceases'. ; vuttaṃ=is said. ;

Myanmar Nissaya

ca=ဆက်။ ; ettha=ဤယံ လောကေ ပိယရူပံ အရှိသော ပါဌ်၌။ ; uppajjanapaṭipakkhavasena=ဖြစ်ခြင်း၏ ဆန့်ကျင်ဘက်၏ အစွမ်းဖြင့်။ ; pahīyatīti=ဟူ၍။ ; vuttaṃ=၏။ ; nivisanapaṭipakkhavasena=တည်ခြင်း၏ဆန့်ကျင်ဘက်၏ အစွမ်းဖြင့်။ ; nirujjatīti=ဟူ၍။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3008 | Chunk: 50

Nirodhasaccaniddesavaṇṇanā niṭṭhitā.

AI Translation based on Nissaya

The commentary on the exposition of the Truth of Cessation is finished.

Vietnamese AI Translation

Phần chú giải về Diệt Đế đã hoàn tất.

AI Translation Nissaya

nirodhasacca-niddesa-vaṇṇanā=The commentary on the exposition of the truth of cessation. ; niṭṭhitā=is finished. ;

Myanmar Nissaya

nirodhasaccaniddesavaṇṇanā=သည်။ ; niṭṭhitā=ပြီ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3009 | Chunk: 50

Maggasaccaniddese [V1.137 P1.162] ayamevāti aññamaggapaṭikkhepanatthaṃ niyamanaṃ ( vibha. aṭṭha. 205).

AI Translation based on Nissaya

In the exposition of the Truth of the Path [V1.137 P1.162], the word **'this very'** is a term of specification, for the purpose of rejecting any other path (vibha. aṭṭha. 205).

Vietnamese AI Translation

Trong phần giải thích về Đạo Đế [V1.137 P1.162], từ **'chính này'** là một thuật ngữ chỉ định, với mục đích bác bỏ bất kỳ đạo lộ nào khác (vibha. aṭṭha. 205).

AI Translation Nissaya

maggasacca-niddese=In the exposition of the truth of the path. ; ayam evā'ti=The word 'ayam eva' (this very). ; añña-magga-paṭikkhepanatthaṃ=for the purpose of rejecting any other path. ; niyamanaṃ=is a determining word. ;

Myanmar Nissaya

maggasaccaniddese=ပ။ ; ayamevāti=ဟူသော စကားသည်။ ; aññamaggapaṭikkhepanatthaṃ=တပါးသော မဂ်၏ ဆန့်ကျင်ဘက်ကို မှတ်တတ်သော သဒ္ဒါတည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3010 | Chunk: 50

Ariyoti taṃtaṃmaggavajjhakilesehi ārakattā, ariyabhāvakarattā, ariyaphalapaṭilābhakarattā ca ariyo.

AI Translation based on Nissaya

It is **noble** because it is far from the defilements to be destroyed by each respective path, because it produces the state of nobility, and because it brings about the attainment of noble fruition.

Vietnamese AI Translation

Nó là **Thánh** bởi vì nó cách xa các phiền não cần được đoạn trừ bởi mỗi đạo lộ tương ứng, bởi vì nó tạo ra trạng thái cao quý, và bởi vì nó mang lại sự chứng đắc Thánh quả.

AI Translation Nissaya

ariyo'ti=The word 'ariya' (noble). ; taṃ taṃ magga-vajjha-kilesehi=from the defilements to be destroyed by each respective path. ; ārakattā=because of being far from. ; ariyabhāva-karattā=because it produces the state of being a noble one. ; ariyaphala-paṭilābhakarattā ca=and because it brings about the attainment of noble fruition. ; ariyo=it is called 'noble'. ;

Myanmar Nissaya

ariyoti=ကား။ ; taṃ taṃ maggavajjhakilesehi=ထိုထိုမဂ်သည် သတ်အပ်သော ကိလေသာတို့မှ။ ; ārakattā=ဝေးသည်၏ အဖြစ်ကြောင့် လည်းကောင်း။ ; ariyabhāvakarattā=အရိယာ၏ အဖြစ်ကို ပြုတတ်သော ကြောင့် လည်းကောင်း။ ; ariyaphalapaṭilābhakarattāca=အရိယာဖိုလ်ကို ရခြင်းကို ပြုတတ်သောကြောင့်လည်းကောင်း။ ; ariyo=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3011 | Chunk: 50

Aṭṭha aṅgāni assāti aṭṭhaṅgiko.

AI Translation based on Nissaya

Because it has eight factors, it is called **eightfold.**

Vietnamese AI Translation

Bởi vì nó có tám yếu tố, nó được gọi là **tám chi.**

AI Translation Nissaya

assa=To this path. ; aṭṭha=eight. ; aṅgāni=factors. ; santi=there are. ; iti tasmā=therefore. ; aṭṭhaṅgiko=it is called 'eightfold'. ;

Myanmar Nissaya

assa=ထိုမဂ်အား။ ; aṭṭha=ကုန်သော။ ; aṅgāni=အစိတ်တို့သည်။ ; santi=ကုန်၏။ ; ititasmā=ကြောင့်။ ; aṭṭhaṅgiko=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3012 | Chunk: 50

Svāyaṃ caturaṅgikā viya senā, pañcaṅgikaṃ viya tūriyaṃ aṅgamattameva hoti, aṅgavinimutto natthi.

AI Translation based on Nissaya

This path is merely the collection of its factors, just like an army with its four divisions or an orchestra with its five instruments; there is no 'eightfold path' that exists apart from its factors.

Vietnamese AI Translation

Đạo lộ này đơn thuần là sự tập hợp của các yếu tố của nó, giống như một quân đội với bốn sư đoàn hoặc một dàn nhạc với năm nhạc cụ; không có 'Bát Chánh Đạo' nào tồn tại ngoài các yếu tố của nó.

AI Translation Nissaya

svāyaṃ so ayaṃ aṭṭhaṅgiko=That eightfold path. ; caturaṅgikā=that has four limbs. ; senā viya=like an army, and. ; pañcaṅgikaṃ=that has five parts. ; tūriyaṃ viya=like an orchestra. ; aṅgamattam eva=is merely the collection of factors. ; hoti=it is. ; aṅga-vinimutto=apart from the factors, an 'eightfold' thing. ; natthi=does not exist. ;

Myanmar Nissaya

svāyaṃ soayaṃ aṭṭhaṅgiko=ထိုအဋ္ဌင်္ဂိကမဂ်သည်။ ; caturaṅgikā=ရှိသော။ ; senāviya=စစ်သည်ကဲ့သို့လည်းကောင်း။ ; pañcaṅgikaṃ=ရှိသော။ ; tūriyaṃviya=တူရိယာကဲ့သို့လည်းကောင်း။ ; aṅgamattameva=အစိတ်မျှသည်သာလျှင်။ ; hoti=၏။ ; aṅgavinimutto=အစိတ်အင်္ဂါမှ လွတ်သော အဋ္ဌင်္ဂိကမည်သည်။ ; natthi=မရှိ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3013 | Chunk: 50

Idāni aṅgamattameva maggo aṅgavinimutto natthīti dassento sammādiṭṭhi … pe … sammāsamādhītiādimāha.

AI Translation based on Nissaya

Now, to show that the path is merely the collection of its factors and that there is no path apart from these factors, the Elder spoke the passage beginning **'Right View … pe … Right Concentration.'**

Vietnamese AI Translation

Bây giờ, để chỉ ra rằng đạo lộ đơn thuần là sự tập hợp của các yếu tố của nó và không có đạo lộ nào tồn tại ngoài các yếu tố này, Trưởng lão đã nói đoạn văn bắt đầu bằng **'Chánh Kiến … pe … Chánh Định.'**

AI Translation Nissaya

idāni=Now. ; aṅgamattam eva=is merely the collection of factors. ; maggo=the path. ; aṅga-vinimutto=apart from the factors, a path. ; natthi=does not exist. ; iti imaṃ atthaṃ=this meaning. ; dassento=the Elder, showing. ; sammādiṭṭhi...pe...sammāsamādhī'ti ādiṃ=the passage beginning 'Right View... Right Concentration'. ; āha=said. ;

Myanmar Nissaya

idāni=၌။ ; aṅgamattameva=သာလျှင်။ ; maggo=မည်၏။ ; aṅgavinimutto=မဂ်သည်။ ; natthi=မရှိ။ ; iti imaṃ atthaṃ=ကို ; dassento=မထေရ်သည်။ ; sammādiṭṭhi.la. samāsamādhītiādiṃ=ကို။ ; āha=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3014 | Chunk: 50

Tattha sammā dassanalakkhaṇā sammādiṭṭhi .

AI Translation based on Nissaya

Therein, **Right View** has the characteristic of seeing rightly.

Vietnamese AI Translation

Trong đó, **Chánh Kiến** có đặc tính là thấy đúng.

AI Translation Nissaya

tattha=Therein, in the passage beginning with 'Right View'. ; sammā=rightly. ; dassana-lakkhaṇā=the state which has the characteristic of seeing. ; sammādiṭṭhi=is Right View. ;

Myanmar Nissaya

tattha=ထိုသမ္မာဒိဋ္ဌိ အစရှိသော ပါဌ်၌။ ; sammā=ကောင်းစွာ။ ; dassanalakkhaṇā=မြင်ခြင်းလက္ခဏာရှိသော တရားသည်။ ; sammādiṭṭhi=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3015 | Chunk: 50

Sammā abhiniropanalakkhaṇo sammāsaṅkappo.

AI Translation based on Nissaya

**Right Thought** has the characteristic of directing rightly.

Vietnamese AI Translation

**Chánh Tư Duy** có đặc tính là hướng tâm đúng.

AI Translation Nissaya

sammā=rightly. ; abhiniropana-lakkhaṇo=the state which has the characteristic of directing the co-nascent states towards the object. ; sammāsaṅkappo=is Right Thought. ;

Myanmar Nissaya

sammā=စွာ။ ; abhiniropanalakkhaṇo=အာရုံသို့ သမ္ပယုတ်တရားတို့ကို ရှေ့ရှုတင်ခြင်း လက္ခဏာရှိသော တရားသည်။ ; sammāsaṅkappo=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3016 | Chunk: 50

Sammā pariggahalakkhaṇā sammāvācā.

AI Translation based on Nissaya

**Right Speech** has the characteristic of embracing rightly.

Vietnamese AI Translation

**Chánh Ngữ** có đặc tính là bao trùm đúng.

AI Translation Nissaya

sammā=rightly. ; pariggaha-lakkhaṇā=the state which has the characteristic of embracing. ; vā=or the state which has the characteristic of embracing the co-nascent states. ; sammāvācā=is Right Speech. ;

Myanmar Nissaya

sammā=စွာ။ ; pariggahalakkhaṇā=များစွာသော လူတို့ကို သိမ်းဆည်းခြင်း လက္ခဏာရှိသော တရားသည်။ ; vā=သမ္ပယုတ်တရားတို့ကို သိမ်းဆည်းခြင်း လက္ခဏာရှိသော တရားသည်။ ; sammāvācā=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3017 | Chunk: 50

Sammā samuṭṭhāpanalakkhaṇo sammākammanto.

AI Translation based on Nissaya

**Right Action** has the characteristic of originating rightly.

Vietnamese AI Translation

Chánh Nghiệp có đặc tính khởi lên đúng đắn.

AI Translation Nissaya

sammā=rightly. ; samuṭṭhāpana-lakkhaṇo=the state which has the characteristic of originating faultless action. ; vā=or the state which has the characteristic of originating the co-nascent states. ; sammākammanto=is Right Action. ;

Myanmar Nissaya

sammā=စွာ။ ; samuṭṭhāpanalakkhaṇo=အပြစ်မရှိသောအမှုကို ဖြစ်နေခြင်းလက္ခဏာရှိသော တရားသည်။ ; vā=သမ္ပယုတ်တရား တို့ကို ဖြစ်စေခြင်း လက္ခဏာရှိသော တရားသည်။ ; sammākammanto=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3018 | Chunk: 50

Sammā vodāpanalakkhaṇo sammāājīvo.

AI Translation based on Nissaya

**Right Livelihood** has the characteristic of purifying rightly.

Vietnamese AI Translation

Chánh Mạng có đặc tính thanh tịnh đúng đắn.

AI Translation Nissaya

sammā=rightly. ; vodāpana-lakkhaṇo=the state which has the characteristic of cleansing the body and speech. ; vā=or the state which has the characteristic of cleansing the mental continuum. ; sammāājīvo=is Right Livelihood. ;

Myanmar Nissaya

sammā=စွာ။ ; vodāpanalakkhaṇo=ကိုယ်နှုတ်တို့ကို ဖြူ‌စင်စေခြင်း လက္ခဏာရှိသော တရားသည်။ ; vā=စိတ်အစဉ်ကို ဖြူစင်စေခြင်း လက္ခဏာရှိသော တရားသည်။ ; sammāājīvo=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3019 | Chunk: 50

Sammā paggahalakkhaṇo sammāvāyāmo.

AI Translation based on Nissaya

**Right Effort** has the characteristic of exerting rightly.

Vietnamese AI Translation

Chánh Tinh Tấn có đặc tính tinh tấn đúng đắn.

AI Translation Nissaya

sammā=rightly. ; paggaha-lakkhaṇo=the state which has the characteristic of exerting. ; sammāvāyāmo=is Right Effort. ;

Myanmar Nissaya

sammā=စွာ။ ; paggahalakkhaṇo=ချီးမြှောက်ခြင်း လက္ခဏာရှိသော တရားသည်။ ; sammavāyāmo=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3020 | Chunk: 50

Sammā upaṭṭhānalakkhaṇā sammāsati.

AI Translation based on Nissaya

**Right Mindfulness** has the characteristic of establishing rightly.

Vietnamese AI Translation

Chánh Niệm có đặc tính an trú đúng đắn.

AI Translation Nissaya

sammā=rightly. ; upaṭṭhāna-lakkhaṇā=the state which has the characteristic of establishing. ; sammāsati=is Right Mindfulness. ;

Myanmar Nissaya

sammā=စွာ။ ; upaṭṭhānalakkhaṇā=ထင်ခြင်းလက္ခဏာရှိသော တရားသည်။ ; sammāsati=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3021 | Chunk: 50

Sammā samādhānalakkhaṇo sammāsamādhi.

AI Translation based on Nissaya

**Right Concentration** has the characteristic of placing rightly.

Vietnamese AI Translation

Chánh Định có đặc tính đặt để đúng đắn.

AI Translation Nissaya

sammā=rightly. ; samādhāna-lakkhaṇo=the state which has the characteristic of placing evenly on the object. ; sammāsamādhi=is Right Concentration. ;

Myanmar Nissaya

sammā=စွာ။ ; samādhānalakkhaṇo=အာရုံ၌ အညီအညွတ်ထားရှိခြင်းလက္ခဏာ ရှိသော တရားသည်။ ; sammāsamādhi=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3022 | Chunk: 50

Tesu ekekassa tīṇi tīṇi kiccāni honti.

AI Translation based on Nissaya

Each of these has three functions.

Vietnamese AI Translation

Mỗi pháp này có ba phận sự.

AI Translation Nissaya

tesu=Among those eight factors. ; ekekassa=for each one. ; tīṇi tīṇi kiccāni=three functions each. ; honti=there are. ;

Myanmar Nissaya

tesu=ထိုရှစ်ပါးသော တရားတို့တွင်။ ; ekekassa=တပါးတပါးသော တရားအား။ ; tīṇitīṇikiccāni=သုံးပါး သုံးပါးသော ကိစ္စတပ်ကုန်သည်။ ; honti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3023 | Chunk: 50

Seyyathidaṃ – sammādiṭṭhi [M1.150] tāva aññehipi attano paccanīkakilesehi saddhiṃ micchādiṭṭhiṃ pajahati, nirodhañca ārammaṇaṃ karoti, sampayuttadhamme ca passati tappaṭicchādakamohavidhamanavasena asammohato.

AI Translation based on Nissaya

What are they? **Right View,** [M1.150] for instance, abandons Wrong View along with the other defilements that oppose it; it takes cessation (Nibbāna) as its object; and through non-delusion, by way of dispelling the delusion that conceals Nibbāna, it sees the associated states.

Vietnamese AI Translation

Đó là gì? Chẳng hạn, Chánh Kiến [M1.150] đoạn trừ Tà Kiến cùng với các phiền não đối nghịch nó; lấy sự đoạn diệt (Nibbāna) làm cảnh; và nhờ không si mê, bằng cách xua tan sự si mê che khuất Nibbāna, nó thấy các pháp đồng sanh.

AI Translation Nissaya

idaṃ imāni kiccāni=These functions. ; seyyathā katamāni=are as follows. ; sammādiṭṭhi=Right View. ; tāva=firstly. ; aññehipi=with other. ; attano=of itself, i.e., Right View. ; paccanīka-kilesehi=opposing defilements. ; saddhiṃ=together. ; micchādiṭṭhiṃ=Wrong View. ; vā=or delusion and so on, which are co-nascent with it. ; pajahati=it abandons. ; nirodhañca=and cessation. ; ārammaṇaṃ=as object. ; karoti=it makes. ; tappaṭicchādaka-moha-vidhamana-vasena=by way of dispelling the delusion that conceals it (cessation). ; asammohato=through non-delusion. ; sampayutta-dhamme ca=the associated states also. ; passati=it sees. ;

Myanmar Nissaya

idaṃ imāni kiccāni=ဟူသည်။ ; seyyathā katamāni=မူကား။ ; sammādiṭṭhi=မဂ္ဂင်သည်။ ; tāva=လက်မွန်။ ; aññehipi=တပါးလည်းဖြစ်ကုန်သော။ ; attato=မိမိဟု ဆိုအပ်သော သမ္မာဒိဋ္ဌိ၏။ ; paccanīkakilesehi=တို့နှင့်။ ; saddhiṃ=တကွ။ ; micchādiṭṭhiṃ=ကို။ ; vā=နှင့် သဟဇေကဋ္ဌအားဖြင့် တူသော မောဟအစရှိသည်တို့ကို။ ; pajahati=ပယ်၏။ ; nirodhañca=နိဗ္ဗာန်ကိုလည်း။ ; ārammaṇaṃ=ကို။ ; karoti=၏။ ; tappaṭicchādakamohavidhamanavasena=ထိုနိဗ္ဗာန်ကို ဖုံလွှမ်းတတ်သော မောဟကို ပယ်လွှင့်သည်၏ အစွမ်းဖြင့်။ ; asammohato=မတွေဝေခြင်းကြောင့်။ ; sampayuttadhammeca=တို့ကိုလည်း။ ; passati=ပြတတ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3024 | Chunk: 50

Sammāsaṅkappādayopi tatheva micchāsaṅkappādīni ca pajahanti, nibbānañca ārammaṇaṃ karonti.

AI Translation based on Nissaya

In the same way, Right Thought and the other path factors abandon Wrong Thought and the other opposing states, and they take Nibbāna as their object.

Vietnamese AI Translation

Cũng vậy, Chánh Tư Duy và các chi đạo khác đoạn trừ Tà Tư Duy và các pháp đối nghịch khác, và chúng lấy Nibbāna làm cảnh.

AI Translation Nissaya

sammāsaṅkappādayo'pi=Right Thought and the others also. ; tath'eva=in the same way. ; micchāsaṅkappādīni ca=Wrong Thought and so on. ; pajahanti=they abandon. ; nibbānañca=and Nibbāna. ; ārammaṇaṃ=as object. ; karonti=they make. ;

Myanmar Nissaya

sammāsaṅkappādayopi=တို့သည်လည်း။ ; tatheva=လျှင်။ ; micchāsaṅkappādīnica=တို့ကိုလည်း။ ; pajahanti=ကုန်၏။ ; nibbānañca=ကိုလည်း။ ; ārammaṇaṃ=ကို။ ; karonti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3025 | Chunk: 50

Visesato panettha sammāsaṅkappo sahajātadhamme sammā abhiniropeti, sammāvācā sammā pariggaṇhāti, sammākammanto sammā samuṭṭhāpeti, sammāājīvo sammā vodāpeti, sammāvāyāmo sammā paggaṇhāti, sammāsati sammā upaṭṭhāpeti, sammāsamādhi sammā samādahati.

AI Translation based on Nissaya

Specifically, in this context, Right Intention rightly directs the co-arisen states; Right Speech rightly comprehends them; Right Action rightly makes them arise; Right Livelihood rightly purifies them; Right Effort rightly exerts them; Right Mindfulness rightly establishes them; and Right Concentration rightly concentrates them.

Vietnamese AI Translation

Riêng trong trường hợp này, Chánh Tư Duy hướng tâm đúng đắn các pháp đồng sanh; Chánh Ngữ hiểu rõ đúng đắn chúng; Chánh Nghiệp làm chúng khởi lên đúng đắn; Chánh Mạng thanh tịnh đúng đắn chúng; Chánh Tinh Tấn tinh tấn đúng đắn chúng; Chánh Niệm an trú đúng đắn chúng; và Chánh Định định tâm đúng đắn chúng.

AI Translation Nissaya

pana=Especially. ; ettha=in these (factors) beginning with Right Intention. ; visesato=Specifically. ; sammāsaṅkappo=Right Intention. ; sahajātadhamme=co-arisen states. ; sammā=rightly. ; abhiniropeti=directs towards. ; sammāvācā=Right Speech. ; sammā=rightly. ; pariggaṇhāti=comprehends. ; sammākammanto=Right Action. ; sammā=rightly. ; samuṭṭhāpeti=causes to arise. ; sammāājīvo=Right Livelihood. ; sammā=rightly. ; vo‌dāpeti=purifies. ; sammāvāyāmo=Right Effort. ; sammā=rightly. ; paggaṇhāti=exerts. ; sammāsati=Right Mindfulness. ; sammā=rightly. ; upaṭṭhāpeti=establishes. ; sammāsamādhi=Right Concentration. ; sammā=rightly. ; samādahati=concentrates. ;

Myanmar Nissaya

pana=အထူးကား။ ; ettha=ဤသမ္မာသင်္ကပ္ပ အစရှိသည်တို့၌။ ; visesato=အထူးအားဖြင့်။ ; sammāsaṅkappo=သည်။ ; sahajātadhamme=တို့ကို။ ; sammā=စွာ။ ; abhiniropeti=ရှေ့ရှုတင်တတ်၏။ ; sammāvācā=သည်။ ; sammā=စွာ။ ; pariggaṇhāti=သိမ်းဆည်းတတ်၏။ ; sammākammanto=သည်။ ; sammā=စွာ။ ; samuṭṭhāpeti=ဖြစ်စေတတ်၏။ ; sammāājīvo=သည်။ ; sammā=စွာ။ ; vo‌dāpeti=ဖြူစင်စေတတ်၏။ ; sammāvāyāmo=သည်။ ; sammā=စွာ။ ; paggaṇhāti=တတ်၏။ ; sammāsati=သည်။ ; sammā=စွာ။ ; upaṭṭhāpeti=ကပ်၍ တည်တတ်၏။ ; sammāsamādhi=သည်။ ; sammā=စွာ။ ; samādahati=ထားတတ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3026 | Chunk: 51

Apicesā sammādiṭṭhi nāma pubbabhāge nānākkhaṇā nānārammaṇā hoti, maggakāle ekakkhaṇā ekārammaṇā.

AI Translation based on Nissaya

Furthermore, that which is called Right View, in the preliminary stage, has different moments and different objects, but at the time of the path, it has a single moment and a single object.

Vietnamese AI Translation

Hơn nữa, cái được gọi là Chánh Kiến, trong giai đoạn sơ khởi, có những sát-na khác nhau và những đối tượng khác nhau, nhưng vào thời điểm đạo, nó có một sát-na duy nhất và một đối tượng duy nhất.

AI Translation Nissaya

apica=Furthermore. ; casā sammādiṭṭhināma=that which is called Right View. ; pu‌bbabhāge=in the preliminary stage. ; nānākkhaṇā=has different moments. ; nānārammaṇā=has different objects. ; hoti=it is. ; maggakāle=at the moment of the path. ; ekakkhaṇā=it has a single moment. ; ekārammaṇā=it has a single object, which is Nibbāna. ; hoti=it is. ;

Myanmar Nissaya

apica=တနည်းလည်း။ ; casā sammādiṭṭhināma=မည်သည်ကား။ ; pu‌bbabhāge=မဂ်၏ ရှေ့အဖို့၌။ ; nānākkhaṇā=အထူးထူးသော ခဏရှိသည်။ ; nānārammaṇā=အထူးထူးသော အာရုံရှိသည်။ ; hoti=၏။ ; maggakāle=မဂ် ဥပါဒ်သော ခဏ၌။ ; ekakkhaṇā=တစ်ခုသော ခဏရှိသည်။ ; ekārammaṇā=နိဗ္ဗာန်တည်းဟူသော တစ်ခုတည်းသော အာရုံရှိသည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3027 | Chunk: 51

Kiccato pana ‘‘dukkhe ñāṇan’’ tiādīni cattāri nāmāni labhati [P1.163].

AI Translation based on Nissaya

Functionally, however, it obtains four names, such as 'knowledge in suffering' and so on [P1.163].

Vietnamese AI Translation

Tuy nhiên, về mặt phận sự, nó có bốn tên gọi, chẳng hạn như 'tri kiến về Khổ' v.v... [P1.163].

AI Translation Nissaya

pana=However, regarding its function. ; kiccato=by way of function, that of indicating the truth of suffering, etc. ; dukkhe=in suffering. ; ñāṇaṃ=knowledge. ; iti ādīni=etc. ; cattāri=four. ; nāmāni=names. ; labhati=it obtains. ;

Myanmar Nissaya

pana=ကိစ္စကို ဆိုအံ့။ ; kiccato=ဒုက္ခသစ္စာ အစရှိသည်ကို ပြခြင်း ကိစ္စအားဖြင့်။ ; dukkhe=ဒုက္ခသစ္စာ၌။ ; ñāṇaṃ=ဖြစ်စေသော ဉာဏ်။ ; iti ādīni=ကုန်သော။ ; cattāri=ကုန်သော။ ; nāmāni=တို့ကို။ ; labhati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3028 | Chunk: 51

Sammāsaṅkappādayopi pubbabhāge nānākkhaṇā nānārammaṇā honti, maggakāle ekakkhaṇā ekārammaṇā.

AI Translation based on Nissaya

The factors beginning with Right Intention also, in the preliminary stage, have different moments and different objects; but at the time of the path, they have a single moment and a single object.

Vietnamese AI Translation

Các chi bắt đầu với Chánh Tư Duy cũng vậy, trong giai đoạn sơ khởi, có những sát-na khác nhau và những đối tượng khác nhau; nhưng vào thời điểm đạo, chúng có một sát-na duy nhất và một đối tượng duy nhất.

AI Translation Nissaya

sammasaṅkappādayopi=the seven path factors beginning with Right Intention also. ; pubbabhāge=in the preliminary stage. ; nānākkhaṇā=have different moments. ; nānārammaṇā=have different objects. ; honti=they are. ; maggakāle=at the moment of the path. ; ekakkhaṇā=they have a single moment. ; ekārammaṇā=they have a single object. ; honti=they are. ;

Myanmar Nissaya

sammasaṅkappādayopi=ကုန်သော ခုနစ်ပါးသော မဂ္ဂင်တို့သည်လည်း။ ; pubbabhāge=မဂ်၏ ရှေ့အဖို့၌။ ; nānākkhaṇā=သောခဏရှိကုန်သည်။ ; nānārammaṇā=အာရုံရှိသည်ကုန်သည်။ ; honti=ကုန်၏။ ; maggakāle=မဂ်ဥပါဒ်သော ခဏ၌။ ; ekakkhaṇā=သော ခဏရှိကုန်သည်။ ; ekārammaṇā=သော အာရုံရှိကုန်သည်။ ; honti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3029 | Chunk: 51

Tesu sammāsaṅkappo kiccato nekkhammasaṅkappotiādīni tīṇi nāmāni labhati.

AI Translation based on Nissaya

Among these, the path factor of Right Intention, by way of function, obtains three names, such as 'intention of renunciation'.

Vietnamese AI Translation

Trong số này, chi đạo Chánh Tư Duy, về mặt phận sự, có ba tên gọi, chẳng hạn như 'tư duy xuất ly'.

AI Translation Nissaya

tesu=Among those beginning with Right Intention. ; sammāsaṅkappo=the path factor of Right Intention. ; kiccato=by way of function, that of abandoning sensual intention, etc. ; nekkhammasaṅkappoti ādīni=such as 'intention of renunciation'. ; tīṇīnāmāni=three names. ; labhati=it obtains. ;

Myanmar Nissaya

tesu=ထိုသမ္မာသင်္ကပ္ပ အစရှိသည်တို့တွင်။ ; sammāsaṅkappo=မဂ္ဂင်သည်။ ; kiccato=ကာမသင်္ကပ္ပ အစရှိသည်တို့ကို ပယ်ခြင်းကိစ္စ အားဖြင့်။ ; nekkhammasaṅkappoti ādīni=နေက္ခမ္မသင်္ကပ္ပ ဤသို့ အစရှိကုန်သော။ ; tīṇīnāmāni=တို့ကို။ ; labhati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3030 | Chunk: 51

Sammāvācādayo tayo pubbabhāge viratiyopi honti cetanāyopi, maggakkhaṇe pana viratiyoyeva.

AI Translation based on Nissaya

The three path factors beginning with Right Speech, in the preliminary stage, are sometimes abstinences and sometimes volitions; but at the moment of the path, they are only abstinences.

Vietnamese AI Translation

Ba chi đạo bắt đầu với Chánh Ngữ, trong giai đoạn sơ khởi, đôi khi là những sự từ bỏ và đôi khi là những tác ý; nhưng vào sát-na đạo, chúng chỉ là những sự từ bỏ.

AI Translation Nissaya

sammāvācādayo=the factors beginning with Right Speech. ; tayo=the three path factors. ; pubbabhāge=in the preliminary stage, at the time of abstaining from false speech etc. ; viratiyopi=are also abstinences. ; honti=they are. ; cetanāyopi=and also volitions at the time of speaking well-spoken speech etc. ; honti=they are. ; pana=however, as for the path moment. ; maggakkhaṇe=at the moment of the path. ; viratiyoyeva=they are only abstinences. ; honti=they are. ;

Myanmar Nissaya

sammāvācādayo=ကုန်သော။ ; tayo=ကုန်သော မဂ္ဂင်တို့သည်။ ; pubbabhāge=မဂ်၏ ရှေ့အဖို့၌ မုသာဝါဒ အစရှိသည်တို့မှ ကြဉ်သော အခါ၌။ ; viratiyopi=တို့သည်လည်း။ ; honti=ကုန်၏။ ; cetanāyopi=သုဘာသိတဝါစာ အစရှိသည်ကို ဆိုသော ကာလ၌ စေတနာတို့သည်လည်း။ ; honti=ကုန်၏။ ; pana=မဂ်ခဏဆိုအံ့။ ; maggakkhaṇe=၌။ ; viratiyoyeva=တို့သည်သာလျှင်။ ; honti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3031 | Chunk: 51

Sammāvāyāmo sammāsatīti idampi dvayaṃ kiccato sammappadhānasatipaṭṭhānavasena cattāri nāmāni labhati.

AI Translation based on Nissaya

This pair, Right Effort and Right Mindfulness, also obtains four names functionally, by way of the Right Exertions and the Foundations of Mindfulness.

Vietnamese AI Translation

Cặp này, Chánh Tinh Tấn và Chánh Niệm, cũng có bốn tên gọi về mặt phận sự, bằng cách Tứ Chánh Cần và Tứ Niệm Xứ.

AI Translation Nissaya

sammāvāyāmo=the path factor of Right Effort and. ; sammāsati=Right Mindfulness. ; iti idampi dvayaṃ=this pair also. ; kiccato=by way of function. ; sammappadhāna satipaṭṭhānavasena=by way of the Right Exertions and the Foundations of Mindfulness. ; cattāri=four. ; nāmāni=names. ; labhati=obtains. ;

Myanmar Nissaya

sammāvāyāmo=မဂ္ဂင်သည်လည်းကောင်း။ ; sammāsati=လည်းကောင်း။ ; iti idampi dvayaṃ=သည်လည်း။ ; kiccato=အားဖြင့်။ ; sammappadhāna satipaṭṭhānavasena=တို့၏အစွမ်းဖြင့်။ ; cattāri=ကုန်သော။ ; nāmāni=တို့ကို။ ; labhati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3032 | Chunk: 51

Sammāsamādhi pana pubbabhāgepi maggakkhaṇepi sammāsamādhiyeva.

AI Translation based on Nissaya

Moreover, the path factor of Right Concentration is just Right Concentration, both in the preliminary stage and at the moment of the path.

Vietnamese AI Translation

Hơn nữa, chi đạo Chánh Định chỉ là Chánh Định, cả trong giai đoạn sơ khởi và vào sát-na đạo.

AI Translation Nissaya

pana=Moreover. ; sammāsamādhi=the path factor of Right Concentration. ; pubbabhāgepi=in the preliminary stage and also. ; maggakkhaṇepi=at the moment of the path. ; sammāsamādhiyeva=is just the path factor of Right Concentration. ;

Myanmar Nissaya

pana=ပါး။ ; sammāsamādhi=မဂ္ဂင်သည်။ ; pubbabhāgepi=မဂ်၏ ရှေ့အဖို့၌ လည်းကောင်း။ ; maggakkhaṇepi=မဂ်ခဏ၌လည်းကောင်း။ ; sammāsamādhiyeva=မဂ္ဂင်သည် သာလျှင်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3033 | Chunk: 51

Iti imesu aṭṭhasu dhammesu bhagavatā nibbānādhigamāya paṭipannassa yogino bahūpakārattā paṭhamaṃ [V1.138] sammādiṭṭhi desitā.

AI Translation based on Nissaya

Thus, among these eight factors, Right View [V1.138] was taught first by the Blessed One because it is of great assistance to the yogī who is practicing for the attainment of Nibbāna.

Vietnamese AI Translation

Như vậy, trong số tám chi này, Chánh Kiến [V1.138] được Đức Thế Tôn thuyết giảng trước tiên vì nó là sự trợ giúp lớn lao cho hành giả đang tu tập để chứng đạt Nibbāna.

AI Translation Nissaya

iti=Thus. ; aṭṭhasu=in these eight. ; imesu dhammesu=among these path-factor states. ; bhagavatā=by the Blessed One. ; nibbānādhigamāya=for the attainment of Nibbāna. ; paṭipannassa=of the one who is practicing. ; yogino=for the yogī. ; bahupakārattā=because it is of great assistance. ; paṭhamaṃ=firstly. ; sammādiṭṭhi=Right View. ; desitā=was taught. ;

Myanmar Nissaya

iti=သို့။ ; aṭṭhasu=ကုန်သော။ ; imesu dhammesu=ဤမဂ္ဂင်တရားတို့တွင်။ ; bhagavatā=သည်။ ; nibbānādhigamāya=ခြင်းငှါ။ ; paṭipannassa=ကျင့်သော။ ; yogino=အား။ ; bahupakārattā=ကြောင့်။ ; paṭhamaṃ=လက်မွန်။ ; sammādiṭṭhi=မဂ္ဂင်ကို။ ; desitā=အပ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3034 | Chunk: 51

Ayañhi ‘‘paññāpajjoto paññāsatthan’’ ti ( dha. sa. 16,20,29) ca vuttā.

AI Translation based on Nissaya

Truly, it has been spoken of as 'the light of wisdom' and 'the sword of wisdom' (Dhs. 16, 20, 29).

Vietnamese AI Translation

Thật vậy, nó đã được nói đến như 'ánh sáng của trí tuệ' và 'thanh kiếm của trí tuệ' (Dhs. 16, 20, 29).

AI Translation Nissaya

hisaccaṃ=Truly. ; ayaṃ=this path factor of Right View. ; paññāpajjoto=and as the 'sword of wisdom'. ; vuttā=was spoken of by the Buddha. ; paññāpajjoto=the light of wisdom. ; paññāsattaṃ=the weapon of wisdom. ;

Myanmar Nissaya

hisaccaṃ=၏။ ; ayaṃ=ဤသမ္မာဒိဋ္ဌိမဂ္ဂင်ကို။ ; paññāpajjoto=ပညာသတ္တန္တိစ ဟူ၍လည်း။ ; vuttā=ဟောတော်မူအပ်၏။ ; paññāpajjoto=ပညာတည်းဟူသောအရောင်။ ; paññāsattaṃ=တည်းဟူသော လက်နက်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3035 | Chunk: 51

Tasmā etāya pubbabhāge vipassanāñāṇasaṅkhātāya sammādiṭṭhiyā avijjandhakāraṃ vidhamitvā kilesacore ghātento khemena yogāvacaro nibbānaṃ pāpuṇāti.

AI Translation based on Nissaya

Therefore, by means of this Right View, which is designated as insight-knowledge in the preliminary stage, having dispelled the darkness of ignorance and while destroying the thieves of the defilements, the practitioner safely attains Nibbāna.

Vietnamese AI Translation

Do đó, nhờ Chánh Kiến này, cái được gọi là Tuệ Quán trong giai đoạn sơ khởi, sau khi xua tan bóng tối của vô minh và trong khi tiêu diệt những tên trộm phiền não, hành giả an toàn chứng đạt Nibbāna.

AI Translation Nissaya

tasmā=Therefore. ; pubbabhāge=in the preliminary stage. ; vipassanāñāṇasaṅkhātāya=which is designated as insight-knowledge. ; etāya sammādiṭṭhiyā=by means of this path factor of Right View. ; avijjandhakāraṃ=the darkness of ignorance. ; vidhamitvā=having dispelled. ; kilesacore=the thieves of defilements. ; ghatento=while destroying. ; vā=or. ; hutvā=having been. ; khemena=safely. ; yogāvacaro=the practitioner. ; nibbānaṃ=to Nibbāna. ; pāpuṇāti=attains. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; pubbabhāge=မဂ်၏ ရှေ့အဖို့၌။ ; vipassanāñāṇasaṅkhātāya=ဆိုအပ်သော။ ; etāya sammādiṭṭhiyā=မဂ္ဂင်ဖြင့်။ ; avijjandhakāraṃ=ကို။ ; vidhamitvā=ပယ်လွှင့်၍။ ; kilesacore=တို့ကို။ ; ghatento=လျက်။ ; vā=သည်။ ; hutvā=၍။ ; khemena=ဘေးမရှိသော အားဖြင့်။ ; yogāvacaro=ပုဂ္ဂိုလ်သည်။ ; nibbānaṃ=သို့။ ; pāpuṇāti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3036 | Chunk: 51

Tasmā paṭhamaṃ sammādiṭṭhi desitā.

AI Translation based on Nissaya

Therefore, the path factor of Right View was taught first.

Vietnamese AI Translation

Do đó, chi đạo Chánh Kiến được thuyết giảng trước tiên.

AI Translation Nissaya

tasmā=Therefore. ; paṭhamaṃ=first. ; sammādiṭṭhi=the path factor of Right View. ; desitā=was taught. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; paṭhamaṃ=မဆွစွာ။ ; sammādiṭṭhi=မဂ္ဂင်ကို။ ; desitā=ဟောတော်မူအပ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3037 | Chunk: 51

Sammāsaṅkappo pana tassā bahūpakāro.

AI Translation based on Nissaya

Moreover, the path factor of Right Intention is of great assistance to that Right View.

Vietnamese AI Translation

Hơn nữa, chi đạo Chánh Tư Duy là sự trợ giúp lớn lao cho Chánh Kiến đó.

AI Translation Nissaya

pana=Moreover. ; sammāsaṅkappo=the path factor of Right Intention. ; vā=or. ; tassā=for that Right View. ; bahūpakāro=is of great assistance. ;

Myanmar Nissaya

pana=ပါး။ ; sammāsaṅkappo=မဂ္ဂင်သည်။ ; vā=ကို။ ; tassā=ထိုသမ္မာဒိဋ္ဌိအား။ ; bahūpakāro=ရှိ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3038 | Chunk: 51

Tasmā tadanantaraṃ vutto.

AI Translation based on Nissaya

Therefore, it was spoken of immediately after it.

Vietnamese AI Translation

Do đó, nó được nói đến ngay sau đó.

AI Translation Nissaya

tasmā=Therefore. ; tadanantaraṃ=immediately after that Right View. ; vutto=it was spoken. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; tadanantaraṃ=ထိုသမ္မာဒိဋ္ဌိ၏ အခြားမဲ့၌။ ; vutto=အပ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3039 | Chunk: 51

Yathā hi heraññiko hatthena parivattetvā parivattetvā cakkhunā kahāpaṇaṃ olokento ‘‘ayaṃ kūṭo ayaṃ cheko’’ ti jānāti, evaṃ yogāvacaropi pubbabhāge vitakkena vitakketvā vitakketvā vipassanāpaññāya olokayamāno ‘‘ime dhammā kāmāvacarā, ime rūpāvacarādayo’’ ti jānāti.

AI Translation based on Nissaya

For, just as a money-changer, turning a coin over and over again with his hand and examining it with his eye, knows, 'This is counterfeit, this is genuine,' so too, in the preliminary stage, the practitioner, thinking and thinking again with thought and examining with insight-wisdom, knows, 'These states are of the sense sphere, these are of the fine-material sphere, and so on.'

Vietnamese AI Translation

Vì, cũng như một người đổi tiền, lật đi lật lại đồng tiền bằng tay và xem xét bằng mắt, biết rằng: 'Cái này giả, cái này thật', cũng vậy, trong giai đoạn sơ khởi, hành giả, tư duy đi tư duy lại bằng tư tưởng và xem xét bằng tuệ quán, biết rằng: 'Các pháp này thuộc dục giới, các pháp này thuộc sắc giới, v.v...'

AI Translation Nissaya

hi taṃ pākaṭaṃkaromi=For, I will make it clear. ; heraññiko=a money-changer. ; hatthena=with his hand. ; parivattetvā parivattetvā=turning it over and over again. ; cakkhunā=with his eye. ; kahāpaṇaṃ=a coin. ; olokento=while examining. ; ayaṃ=this one. ; kūṭo=is counterfeit. ; ayaṃ=this one. ; cheko=is genuine. ; vā=or good. ; iti=thus. ; jānātiyathā=just as he knows. ; evaṃtathā=similarly. ; yogāvacaropi=the yogī also. ; pubbabhāge=in the preliminary stage. ; vitakkena=with thought. ; vitakketvā vitakketvā=thinking and thinking again. ; vipassanāpaññāya=with insight-wisdom. ; olokayamāno=while examining. ; imedhammā=these states are of the sense-sphere. ; rūpāvacarādayo=and these are of the fine-material sphere, etc. ; iti=thus. ; jānāti=knows. ;

Myanmar Nissaya

hi taṃ pākaṭaṃkaromi=အံ။ ; heraññiko=ပွဲစားသည်။ ; hatthena=ဖြင့်။ ; parivattetvā parivattetvā=ပြန်လှန်၍ ပြန်လှန်၍။ ; gakkhunā=ဖြင့်။ ; kahāpaṇaṃ=အသပြာကို။ ; olokento=သော်။ ; ayaṃ=သည်။ ; kūṭo=ကြမ်း၏။ ; ayaṃ=သည်။ ; cheko=လိမ္မာ၏။ ; vā=ကောင်း၏။ ; iti=သို့။ ; jānātiyathā=သို့။ ; evaṃtathā=တူ။ ; yogāvacaropi=သည်လည်း။ ; pubbabhāge=၌။ ; vitakkena=ဖြင့်။ ; vitakketvā vitakketvā=ကြံ၍ ကြံ၍။ ; vipassanāpaññāya=ပညာဖြင့်။ ; olokayamāno=ကြည့်အပ်သည်ရှိသော်။ ; imedhammā=ဤတရားတို့သည်။ ; rūpāvacarādayo=အစရှိသည်တို့တည်း။ ; iti=သို့။ ; jānāti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3040 | Chunk: 51

Yathā vā pana purisena koṭiyaṃ gahetvā parivattetvā parivattetvā dinnaṃ mahārukkhaṃ tacchako vāsiyā tacchetvā kamme [M1.151] upaneti, evaṃ vitakkena vitakketvā vitakketvā dinnadhamme yogāvacaro paññāya ‘‘ime dhammā kāmāvacarā, ime rūpāvacarā’’ tiādinā nayena paricchinditvā kamme upaneti.

AI Translation based on Nissaya

Or else, just as a carpenter, when a man has taken hold of a great log by the end, turned it over and over again, and given it to him, planes it with an adze and applies it to the work [M1.151], so too, the practitioner, having discerned with wisdom the states presented by thinking and thinking again with thought, by the method beginning 'these states are of the sense-sphere, these are of the fine-material sphere,' applies them to the work of insight.

Vietnamese AI Translation

Hoặc nữa, cũng như một người thợ mộc, khi một người đã cầm một khúc gỗ lớn ở một đầu, lật đi lật lại, và đưa nó cho ông ấy, ông ấy bào nó bằng cái bào và áp dụng vào công việc [M1.151], cũng vậy, hành giả, sau khi đã nhận biết bằng trí tuệ các pháp được thể hiện bằng cách tư duy đi tư duy lại bằng tư tưởng, bằng phương pháp bắt đầu 'các pháp này thuộc dục giới, các pháp này thuộc sắc giới,' áp dụng chúng vào công việc của tuệ quán.

AI Translation Nissaya

vā pana=Or else. ; purisena=by a man. ; koṭiyaṃ=at the end of the log. ; gahetvā=having taken hold. ; parivettetvā parivettetvā=turning over and over again. ; dinnaṃ=given. ; mahārukkhaṃ=a great log. ; tacchako=a carpenter. ; vāsiyā=with an adze. ; tacchetvā=having planed. ; kamme=to the work. ; upanetiyathā=just as he brings it. ; evaṃtathā=similarly. ; vitakkena=with thought. ; vitakketvā vitakketvā=thinking and thinking again. ; dinnadhamme=the states presented. ; yogāvacaro=the practitioner. ; paññāya=with wisdom. ; ime dhammā=these states. ; kāmāvacarā=are of the sense-sphere. ; ime=these states. ; rūpāvacarā=are of the fine-material sphere. ; iti ādinā=by the method beginning with. ; nayena=by the method. ; paricchinditvā=having discerned. ; kamme=to the work of insight. ; upaneti=he applies. ;

Myanmar Nissaya

vā pana=ပါး။ ; purisena=သည်။ ; koṭiyaṃ=သစ်တုံးစွန်း၌။ ; gahetvā=ကိုင်၍။ ; parivettetvā parivettetvā=ပြန်လှန်၍ ပြန်လှန်၍။ ; dinnaṃ=အပ်သော။ ; mahārukkhaṃ=ကြီးစွာသော သစ်တုံးကို။ ; tacchako=ရွေ့သော ယောင်္ကျားသည်။ ; vāsiyā=ပဲခွပ်ဖြင့်။ ; tacchetvā=ရွေ၍။ ; kamme=၌။ ; upanetiyathā=ကပ်ဆောင်သကဲ့သို့။ ; evaṃtathā=တူ။ ; vitakkena=ဖြင့်။ ; vitakketvā vitakketvā=ကြံ၍ ကြံ၍။ ; dinnadhamme=တို့ကို။ ; yogāvacaro=သည်။ ; paññāya=ဖြင့်။ ; ime dhammā=တို့သည်။ ; kāmāvacarā=တို့တည်း။ ; ime=တို့သည်။ ; rūpāvacarā=တို့တည်း။ ; iti ādinā=ရှိသော။ ; nayena=ဖြင့်။ ; paricchinditvā=၍။ ; kamme=ဝိပဿနာအမှု၌။ ; upaneti=ကပ်ဆောင်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3041 | Chunk: 51

Tasmā sammāsaṅkappo sammādiṭṭhānantaraṃ vutto.

AI Translation based on Nissaya

Therefore, the path factor of Right Intention was spoken of immediately after Right View.

Vietnamese AI Translation

Do đó, chi đạo Chánh Tư Duy được nói đến ngay sau Chánh Kiến.

AI Translation Nissaya

tasmā=Therefore. ; sammāsaṅkappo=the path factor of Right Intention. ; sammādiṭṭhānantaraṃ=immediately after Right View. ; vutto=was spoken. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; sammāsaṅkappo=မဂ္ဂင်ကို။ ; sammādiṭṭhānantaraṃ=၏ အခြားမဲ့၌။ ; vutto=အပ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3042 | Chunk: 51

Svāyaṃ yathā sammādiṭṭhiyā, evaṃ sammāvācāyapi upakārako.

AI Translation based on Nissaya

Just as this Right Intention is helpful to Right View, so too is it helpful to Right Speech.

Vietnamese AI Translation

Cũng như Chánh Tư Duy này hữu ích cho Chánh Kiến, thì nó cũng hữu ích cho Chánh Ngữ.

AI Translation Nissaya

svāyaṃ so ayaṃ sammāsaṅkappo=This Right Intention. ; sammādiṭṭhiyā=to Right View. ; upakārakoyathā=just as it is helpful. ; evaṃ tathā=similarly. ; sammāvācāyapi=to Right Speech also. ; upakārako=it is helpful. ;

Myanmar Nissaya

svāyaṃ so ayaṃ sammāsaṅkappo=သည်။ ; sammādiṭṭhiyā=အား။ ; upakārakoyathā=သကဲ့သို့။ ; evaṃ tathā=တူ။ ; sammāvācāyapi=အားလည်း။ ; upakārako=တတ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3043 | Chunk: 51

Yathāha –

AI Translation based on Nissaya

As it is said:

Vietnamese AI Translation

Như đã nói:

AI Translation Nissaya

yathāha=As it is said. ;

Myanmar Nissaya

yathāha=ဟူမူကား။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3044 | Chunk: 51

‘‘pubbe kho, gahapati, vitakketvā vicāretvā pacchā vācaṃ bhindatī’’ ti ( ma. ni. 1.463).

AI Translation based on Nissaya

'First, O householder, having thought and reflected, one afterwards utters speech' (M.i.463).

Vietnamese AI Translation

'Trước tiên, này gia chủ, sau khi đã tư duy và suy xét, người ta sau đó mới nói ra lời nói' (M.i.463).

AI Translation Nissaya

pubbekhā.la. bhindatīti=thus. ; āha=it is said. ; gahapati=O householder. ; kho=indeed. ; pubbe=first. ; vitakketvā=having thought. ; vicāretvā=having reflected. ; pacchā=afterwards. ; vācaṃ=speech. ; bhindati=one utters. ;

Myanmar Nissaya

pubbekhā.la. bhindatīti=ဟူ၍။ ; āha=၏။ ; gahapati=ဒါယကာ ရွာသူကြီ။ ; kho=စင်စစ်။ ; pubbe=၌။ ; vitakketvā=ကြံ၍။ ; vicāretvā=ဆင်ခြင်း၍။ ; pacchā=မှ။ ; vācaṃ=စကားကို။ ; bhindati=မြွက်ဆို၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3045 | Chunk: 51

Tasmā tadanantaraṃ sammāvācā vuttā.

AI Translation based on Nissaya

Therefore, Right Speech was spoken of immediately after it.

Vietnamese AI Translation

Do đó, Chánh Ngữ được nói đến ngay sau nó.

AI Translation Nissaya

tasmā=Therefore. ; hadanantaraṃ=immediately after that Right Intention. ; sammāvācā=the path factor of Right Speech. ; vuttā=was spoken. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; hadanantaraṃ=ထိုသမ္မာသင်္ကပ္ပ၏ အခြားမဲ့၌။ ; sammāvācā=မဂ္ဂင်ကို။ ; vuttā=အပ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3046 | Chunk: 51

Yasmā pana ‘‘idañcidañca karissāmā’’ ti paṭhamaṃ vācāya saṃvidahitvā loke kammante payojenti, tasmā vācā kāyakammassa upakārikāti sammāvācāya anantaraṃ sammākammanto vutto.

AI Translation based on Nissaya

Moreover, because people in the world first arrange with speech, saying 'We will do this and that task,' and then undertake actions, speech is helpful for bodily action. Therefore, Right Action was spoken of immediately after Right Speech.

Vietnamese AI Translation

Hơn nữa, vì người đời trước tiên sắp đặt bằng lời nói, rằng 'Chúng ta sẽ làm việc này việc nọ,' và sau đó mới thực hiện hành động, nên lời nói hữu ích cho hành động thân. Do đó, Chánh Nghiệp được nói đến ngay sau Chánh Ngữ.

AI Translation Nissaya

pana=Moreover. ; yasmā=because. ; idañcidañca=this and that task. ; karissāma=we will do. ; iti=thus. ; paṭhamaṃ=firstly. ; vācāya=with speech. ; saṃvidahitvā=having arranged. ; ‌loke=in the world. ; kammante=actions. ; gayojenti=they undertake. ; tasmā=therefore. ; vācā=speech. ; kāyakammassa=for bodily action. ; upakārikā=is helpful. ; iti tasmā=therefore. ; sammāvācāya=of the path factor of Right Speech. ; anantaraṃ=immediately after. ; sammākammanto=the path factor of Right Action. ; vutto=was spoken. ;

Myanmar Nissaya

pana=ပါး။ ; yasmā=ကြောင့်။ ; idañcidañca=ဤမည်သော အမှုကိုလည်း။ ; karissāma=ကုန်အံ့။ ; iti=သို့။ ; paṭhamaṃ=လက်မွန်။ ; vācāya=ဖြင့်။ ; saṃvidahitvā=စီရင်၍။ ; ‌loke=၌။ ; kammante=အမှုတို့ကို။ ; gayojenti=ပြုလုပ်ကြကုန်၏။ ; tasmā=ကြောင့်။ ; vācā=သည်။ ; kāyakammassa=အား။ ; upakārikā=တတ်၏။ ; iti tasmā=ကြောင့်။ ; sammāvācāya=မဂ္ဂင်၏။ ; anantaraṃ=အခြားမဲ့၌။ ; sammākammanto=မဂ္ဂင်ကို။ ; vutto=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3047 | Chunk: 51

Catubbidhaṃ pana vacīduccaritaṃ, tividhaṃ kāyaduccaritaṃ pahāya ubhayaṃ sucaritaṃ pūrentasseva yasmā ājīvaṭṭhamakasīlaṃ pūrati, na itarassa [P1.164], tasmā tadubhayānantaraṃ sammāājīvo vutto.

AI Translation based on Nissaya

Furthermore, because the virtue with livelihood as the eighth factor is fulfilled only for the person who, having abandoned the fourfold misconduct in speech and the threefold misconduct in body, fulfills both kinds of good conduct, and not for anyone else [P1.164], Right Livelihood was therefore spoken of immediately after that pair.

Vietnamese AI Translation

Hơn nữa, vì giới với mạng sống là chi thứ tám chỉ được thành tựu cho người đã từ bỏ bốn ác hạnh về lời nói và ba ác hạnh về thân, thực hiện cả hai loại thiện hạnh, chứ không phải cho bất cứ ai khác [P1.164], do đó Chánh Mạng được nói đến ngay sau cặp đó.

AI Translation Nissaya

pana=Furthermore. ; catubbidhaṃ=the fourfold. ; vacīduccaritaṃ=misconduct in speech and. ; tividhaṃ=the threefold. ; kāyaduccaritaṃ=misconduct in body. ; pahāya=having abandoned. ; ubhabhaṃ=both kinds of. ; sucaritaṃ=good conduct of speech and body. ; pūrentasseva=only for the person who fulfills. ; yasmā=because. ; ājīvaṭṭhamakasīlaṃ=the virtue with livelihood as the eighth factor. ; pūrati=is fulfilled. ; itarassa=for another person. ; napūrati=it is not fulfilled. ; tasmā=therefore. ; tadubhayānantaraṃ=immediately after that pair, Right Speech and Right Action. ; sammāājīvo=the path factor of Right Livelihood. ; vutto=was spoken. ;

Myanmar Nissaya

pana=ပါး။ ; catubbidhaṃ=သော။ ; vacīduccaritaṃ=ကိုလည်းကောင်း။ ; tividhaṃ=သော။ ; kāyaduccaritaṃ=ကိုလည်းကောင်း။ ; pahāya=၍။ ; ubhabhaṃ=‌ သော။ ; sucaritaṃ=ဝစီသုစရိုက်, ကာယသုစရိုက်ကို။ ; pūrentasseva=ဖြည့်ကျင့်သော ပုဂ္ဂိုလ်အားသာလျှင်။ ; yasmā=ကြောင့်။ ; ājīvaṭṭhamakasīlaṃ=အာဇီဝလျှင် ရှစ်ခုမြောက်ရှိသော သီလသည်။ ; pūrati=ပြည့်၏။ ; itarassa=ဤမှတပါးသော ပုဂ္ဂိုလ်အား။ ; napūrati=မပြည့်။ ; tasmā=ကြောင့်။ ; tadubhayānantaraṃ=ဆိုနှစ်ပါးစုံသော သမ္မာဝါစာ ၊သမ္မာကမ္မန္တ၏ အခြားမဲ့၌။ ; sammāājīvo=မဂ္ဂင်ကို။ ; vutto=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3048 | Chunk: 51

Evaṃ visuddhājīvena pana ‘‘parisuddho me ājīvo’’ ti ettāvatā paritosaṃ katvā suttappamattena viharituṃ na yuttaṃ, atha kho sabbairiyāpathesu idaṃ vīriyamārabhitabbanti dassetuṃ tadanantaraṃ sammāvāyāmo vutto.

AI Translation based on Nissaya

However, it is not proper for a person with purified livelihood to dwell with sleep and negligence, feeling satisfied with just the thought, 'My livelihood is purified.' Rather, to show that this effort should be initiated in all postures, Right Effort was spoken of immediately after it.

Vietnamese AI Translation

Tuy nhiên, không phải lẽ cho người có mạng sống thanh tịnh an trú với sự ngủ nghỉ và phóng dật, cảm thấy hài lòng chỉ với ý nghĩ, 'Mạng sống của tôi đã thanh tịnh.' Thay vào đó, để chỉ ra rằng nỗ lực này nên được bắt đầu trong tất cả các oai nghi, Chánh Tinh Tấn được nói đến ngay sau nó.

AI Translation Nissaya

pana=However. ; evaṃ=in the way thus described. ; visuddhājīvena=by the person with purified livelihood. ; me=my. ; ājīvo=livelihood. ; parisuddho=is purified. ; iti=thus. ; ettāvatā=by just this much thought. ; paritosaṃ=satisfaction. ; katvā=having made. ; suttappamattena=with sleep and negligence. ; viharituṃ=to dwell. ; nayuttaṃ=is not proper. ; athakho=but rather. ; sabbairiyāpathesu=in all postures. ; idaṃ vīriyaṃ=this fourfold Right Effort. ; ārabhitabbaṃ=should be initiated. ; iti imassa atthassa=this meaning. ; dassetuṃ=in order to show. ; tadanantaraṃ=immediately after that path factor of Right Livelihood. ; sammāvāyāmo=Right Effort. ; vutto=was spoken. ;

Myanmar Nissaya

pana=ပါး။ ; evaṃ=ဤဆိုအပ်ခဲ့ပြီးသော နည်းဖြင့်။ ; visuddhājīvena=စင်ကြယ်သော အသက်မွေးခြင်း ရှိသော ပုဂ္ဂိုလ်သည်။ ; me=၏။ ; ājīvo=ခြင်းသည်။ ; parisuddho=၏။ ; iti=သို့။ ; ettāvatā=ဤသို့ အောက်မေ့ကာမျှဖြင့်။ ; paritosaṃ=နှစ်သက်ခြင်းကို။ ; katvā=၍။ ; suttappamattena=အိပ်ခြင်းမေ့လျော့ခြင်းဖြင့်။ ; viharituṃ=ငှါ။ ; nayuttaṃ=မသင့်။ ; athakho=သော်ကား။ ; sabbairiyāpathesu=တို့၌။ ; idaṃ vīriyaṃ=ဤလေးပါးသော သမ္မပ္ပဓာနဝီရိယ ကို။ ; ārabhitabbaṃ=အပ်သတည်း။ ; iti imassa atthassa=ကို။ ; dassetuṃ=ငှါ။ ; tadanantaraṃ=ထိုသမ္မာအာဇီဝမဂ္ဂင်၏ အခြားမဲ့၌။ ; sammāvāyāmo=ကို။ ; vutto=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3049 | Chunk: 51

Tato [V1.139] āraddhavīriyenāpi kāyādīsu catūsu vatthūsu sati sūpaṭṭhitā kātabbāti dassetuṃ tadanantaraṃ sammāsati vuttā.

AI Translation based on Nissaya

Then [V1.139], to show that even a person who has initiated effort should make mindfulness well-established in the four bases beginning with the body, Right Mindfulness was spoken of immediately after it.

Vietnamese AI Translation

Sau đó [V1.139], để chỉ ra rằng ngay cả người đã bắt đầu nỗ lực cũng nên làm cho niệm được an trú vững chắc trong bốn căn cứ bắt đầu với thân, Chánh Niệm được nói đến ngay sau nó.

AI Translation Nissaya

tato=Thereafter. ; āraddhavīriyenāpi=even by a person who has initiated effort. ; kāyādīsu=beginning with the body. ; catūsu=in the four. ; vatthūsu=bases, namely body, feelings, mind, and dhammas. ; sūpaṭṭhitā=well-established. ; kātabbā=should be made. ; iti imassa atthassa=this meaning. ; dassetuṃ=in order to show. ; tadanantaraṃ=immediately after that path factor of Right Effort. ; sammāsati=Right Mindfulness. ; vuttā=was spoken. ;

Myanmar Nissaya

tato=မှ။ ; āraddhavīriyenāpi=ရှိသော ပုဂ္ဂိုလ်သည်လည်း။ ; kāyādīsu=ကာယ အစရှိကုန်သော။ ; catūsu=ကုန်သော။ ; vatthūsu=ကာယ စေတနာ စိတ္တ ဓမ္မ တည်းဟူသော ဝတ္ထုတို့၌။ ; sūpaṭṭhitā=သည်ကို။ ; kātabbā=သတည်း။ ; iti imassa atthassa=ကို။ ; dassetuṃ=ငှါ။ ; tadanantaraṃ=ထိုသမ္မာဝါယာ မ မဂ္ဂင်၏ အခြားမဲ့၌။ ; sammāsati=ကို။ ; vuttā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3050 | Chunk: 51

Yasmā pana evaṃ sūpaṭṭhitāya satiyā samādhissa upakārānupakārānaṃ dhammānaṃ gatiyo samanvesitvā pahoti ekattārammaṇe cittaṃ samādhātuṃ, tasmā sammāsatianantaraṃ sammāsamādhi vuttoti veditabboti.

AI Translation based on Nissaya

Furthermore, because when mindfulness is thus well-established, one is able, after investigating the nature of states that are helpful and unhelpful to concentration, to properly concentrate the co-arisen mind on a single object. Therefore, it should be understood that Right Concentration was spoken of immediately after Right Mindfulness. (This concludes the discussion on the sequence of the eight path factors.)

Vietnamese AI Translation

Hơn nữa, vì khi niệm đã được an trú vững chắc như vậy, người ta có thể, sau khi điều tra bản chất của các pháp hữu ích và không hữu ích cho định, để tập trung đúng đắn tâm đồng sanh vào một đối tượng duy nhất. Do đó, cần phải hiểu rằng Chánh Định được nói đến ngay sau Chánh Niệm. (Điều này kết thúc phần thảo luận về trình tự của tám chi đạo.)

AI Translation Nissaya

pana=Furthermore. ; yasmā=because. ; evaṃ=in such a way. ; satiyā=mindfulness. ; sūpaṭṭhitāya=when it is well-established. ; tanaññaḥ=. ; sūpaṭṭhitāya=well-established. ; satiyā=by mindfulness. ; samādhissa=for concentration. ; upakārānupakārānaṃ=of the helpful and unhelpful. ; dhammānaṃ=of states, such as restraint and non-restraint of the faculties. ; gatiyo=the nature of their function. ; vā=or the nature of their function. ; samanvesitvā=having well sought out. ; vā=or investigated. ; ekattarammaṇe=on a single object. ; citta=the co-arisen mind. ; samādhātuṃ=to concentrate well. ; pahoti=one is able. ; tasmā=therefore. ; sammāsatinantaraṃ=immediately after the path factor of Right Mindfulness. ; samāsamādhi=Right Concentration. ; vutto=was spoken. ; iti=thus. ; veditabbo=it should be understood. ; iti=This is the statement that speaks of the sequence of the eight path factors. ;

Myanmar Nissaya

pana=ပါး။ ; yasmā=ကြောင့်။ ; evaṃ=သောနည်းဖြင့်။ ; satiyā=သည်။ ; sūpaṭṭhitāya=ပြီးသည်ရှိသော်။ ; tanaññaḥ= ; sūpaṭṭhitāya=ပြီးသော။ ; satiyā=ဖြင့်။ ; samādhissa=အား။ ; upakārānupakārānaṃ=ကျေးဇူးပြုတတ် ကျေးဇူးမပြုတတ်ကုန်သော။ ; dhammānaṃ=ဣန္ဒြေကို ဆုံးမခြင်း ဣန္ဒြေကို မဆုံးမခြင်း အစရှိ သော တရားတို့၏။ ; gatiyo=ပြီးခြင်းတို့ကို။ ; vā=ကိစ္စသဘောတို့ကို။ ; samanvesitvā=ကောင်းစွာ ရှာမှီး၍။ ; vā=စုံစမ်း၍။ ; ekattarammaṇe=တစ်ခုတည်း၏ အဖြစ်တည်းဟူသော အာရုံ၌။ ; citta=သဟဇာတ ဖြစ်သော စိတ်ကို။ ; samādhātuṃ=ကောင်းစွာ ထားခြင်းငှါ။ ; pahoti=စွမ်းနိုင်၏။ ; tasmā=ကြောင့်။ ; sammāsatinantaraṃ=သမ္မာသတိမဂ္ဂင်၏ အခြားမဲ့၌။ ; samāsamādhi=ကို။ ; vutto=၏။ ; iti=သို့။ ; veditabbo=၏။ ; iti=ဤသည်လျှင် မဂ္ဂင်ရှစ်ပါး အစဉ်ကို ဆိုလိုသော စကားတည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3051 | Chunk: 51

Sammādiṭṭhiniddese ‘‘dukkhe ñāṇan’’ tiādinā catusaccakammaṭṭhānaṃ dassitaṃ.

AI Translation based on Nissaya

In the exposition of Right View, the meditation subject of the Four Truths was shown by the phrase beginning 'knowledge in suffering'.

Vietnamese AI Translation

Trong phần giải thích về Chánh Kiến, đề mục thiền Tứ Thánh Đế được chỉ ra bằng cụm từ bắt đầu 'tri kiến về Khổ'.

AI Translation Nissaya

sammādiṭṭhiniddese=In the exposition of Right View. ; dukkhe ñāṇanti ādinā=by the phrase beginning 'knowledge in suffering'. ; catusaccakammaṭṭhānaṃ=the meditation subject that leads to the penetration of the Four Truths. ; vā=or the meditation subject that arises in relation to them. ; dassitaṃ=was shown. ;

Myanmar Nissaya

sammādiṭṭhiniddese=၌။ ; dukkhe ñāṇanti ādinā=သော စကားဖြင့်။ ; catusaccakammaṭṭhānaṃ=သစ္စာလေးပါးကို ထိုးထွင်း၍ သိခြင်းကို ဆောင်တတ်သော ကမ္မဋ္ဌာန်းကို။ ; vā=ကို ရည်မှတ်၍ ဖြစ်သော ကမ္မဋ္ဌာန်းကို။ ; dassitaṃ=အပ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3052 | Chunk: 51

Tattha purimāni dve saccāni vaṭṭaṃ, pacchimāni dve vivaṭṭaṃ.

AI Translation based on Nissaya

Among these, the first two truths are the round of existence; the latter two truths are that which is free from the round.

Vietnamese AI Translation

Trong số này, hai chân lý đầu tiên là vòng luân hồi; hai chân lý sau là cái giải thoát khỏi vòng luân hồi.

AI Translation Nissaya

tattha=Among those four truths. ; purimāni=the first. ; dvesaccāni=two truths. ; vaṭṭaṃ=are the round of existence. ; pacchimāni=the latter. ; dve=two truths. ; vivaṭṭaṃ=are that which is free from the round. ;

Myanmar Nissaya

tattha=ထိုလေးပါးသော သစ္စာတို့တွင်။ ; purimāni=ကုန်သော။ ; dvesaccāni=တို့သည်။ ; vaṭṭaṃ=ဝဋ်တရားတည်း။ ; pacchimāni=ကုန်သော။ ; dve=တို့သည်။ ; vivaṭṭaṃ=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3053 | Chunk: 51

Tesu bhikkhuno vaṭṭe kammaṭṭhānābhiniveso hoti, vivaṭṭe natthi abhiniveso.

AI Translation based on Nissaya

Of these two, for a monk, there is application of mind by way of a meditation subject in the two truths of the round; in the two truths free from the round, there is no such application of mind.

Vietnamese AI Translation

Trong hai điều này, đối với một tỳ khưu, có sự hướng tâm bằng đề mục thiền trong hai chân lý của vòng luân hồi; trong hai chân lý thoát khỏi vòng luân hồi, không có sự hướng tâm như vậy.

AI Translation Nissaya

tesu=Between those two. ; bhikkhuno=for a monk. ; vaṭṭe=in the two truths of the round. ; kammaṭṭhānābhiniveso=there is application of mind by way of a meditation subject. ; hoti=there is. ; vivaṭṭe=in the two truths free from the round. ; abhiniveso=application of mind by way of a meditation subject. ; natthi=there is not. ;

Myanmar Nissaya

tesu=ထိုနှစ်ပါးတွင်။ ; bhikkhuno=အား။ ; vaṭṭe=ဝဋ္ဋသစ္စာနှစ်ပါး၌။ ; kammaṭṭhānābhiniveso=ကမ္မဋ္ဌာန်းအားဖြင့် နှလုံးသွင်းခြင်းသည်။ ; hoti=၏။ ; vivaṭṭe=ဝိဝဋ္ဋသစ္စာ နှစ်ပါး၌။ ; abhiniveso=ကမ္မဋ္ဌာန်းအားဖြင့် နှလုံးသွင်းခြင်းသ်ည။ ; natthi=မရှိ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3054 | Chunk: 51

Purimāni hi dve saccāni ‘‘pañcakkhandhā dukkhaṃ, taṇhā samudayo’’ ti evaṃ saṅkhepena ca, ‘‘katame [M1.152] pañcakkhandhā ?

AI Translation based on Nissaya

Indeed, regarding the first two truths, 'the five aggregates are suffering, craving is the origin.'

Vietnamese AI Translation

Thật vậy, liên quan đến hai chân lý đầu tiên, 'năm uẩn là khổ, ái là nguồn gốc.'

AI Translation Nissaya

hi saccaṃ=Truly. ; purimāni=The first. ; dvesaccāni=two truths. ; dukkhaṃ=the truth of suffering. ; pañcakkhandhā=are indeed the five aggregates. ; samudayo=the truth of the origin. ; taṇhā=is indeed craving. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; purimāni=ကုန်သော။ ; dvesaccāni=တို့ကို။ ; dukkhaṃ=ဒုက္ခသစ္စာသည်။ ; pañcakkhandhā=တို့ပင်တည်း။ ; samudayo=သမုဒယ သစ္စာသည်။ ; taṇhā=ပင်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3055 | Chunk: 51

Rūpakkhandho’’ tiādinā nayena vitthārena ca ācariyasantike uggaṇhitvā vācāya punappunaṃ parivattento yogāvacaro kammaṃ karoti.

AI Translation based on Nissaya

The practitioner is able to do the work of meditation by learning these truths from a teacher both in brief, as stated, and in detail, by the method beginning, 'What are the five aggregates? The aggregate of form,' and then reciting and repeating them again and again with his speech.

Vietnamese AI Translation

Hành giả có thể thực hiện công việc thiền tập bằng cách học những chân lý này từ một vị thầy cả tóm tắt, như đã nêu, và chi tiết, bằng phương pháp bắt đầu, 'Năm uẩn là gì? Sắc uẩn,' và sau đó đọc và lặp lại chúng hết lần này đến lần khác bằng lời nói của mình.

AI Translation Nissaya

itievaṃ=in this way. ; saṅkhepenaca=in brief and also. ; katame pañcakkhandhā rūpakkhandhoti ādinā=by the method. ; nayena=beginning with 'What are the five aggregates? The aggregate of form'. ; vitthārenaca=in detail and also. ; ācariyasantike=from a teacher. ; uggaṇhitvā=having learned. ; vācāya=with speech. ; punappunaṃ=again and again. ; parivattento=reciting and repeating. ; yo‌gavacaro=the practitioner. ; kammaṃ=the work of practicing meditation. ; karoti=is able to do. ;

Myanmar Nissaya

itievaṃ=သို့။ ; saṅkhepenaca=ဖြင့်လည်းကောင်း။ ; katame pañcakkhandhā rūpakkhandhoti ādinā=သော။ ; nayena=ဖြင့်။ ; vitthārenaca=လည်းကောင်း။ ; ācariyasantike=၌။ ; uggaṇhitvā=သင်ယူ၍။ ; vācāya=ဖြင့်။ ; punappunaṃ=လဲလဲ။ ; parivattento=ပြန်လှန်သရဇ္ဈာယ်သော။ ; yo‌gavacaro=သည်။ ; kammaṃ=က မ္မဋ္ဌာန်းစီးဖြန်းခြင်း အမှုကို။ ; karoti=ပြုနိုင်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3056 | Chunk: 51

Itaresu pana dvīsu saccesu ‘‘nirodhasaccaṃ iṭṭhaṃ kantaṃ manāpaṃ, maggasaccaṃ iṭṭhaṃ kantaṃ manāpan’’ ti evaṃ savaneneva kammaṃ karoti.

AI Translation based on Nissaya

Moreover, concerning the other two truths, he is able to do the work of penetration simply by hearing thus: 'The truth of cessation is desirable, pleasing, and agreeable; the truth of the path is desirable, pleasing, and agreeable.'

Vietnamese AI Translation

Hơn nữa, liên quan đến hai chân lý còn lại, ông ấy có thể thực hiện công việc thể nhập chỉ bằng cách nghe như vậy: 'Chân lý Diệt là đáng mong ước, dễ chịu, và hài lòng; chân lý Đạo là đáng mong ước, dễ chịu, và hài lòng.'

AI Translation Nissaya

pana=Moreover. ; itaresu=among the other. ; dvīsu=two. ; saccesu=truths. ; ni‌‌rodhasaccaṃ=the truth of cessation. ; iṭṭhaṃ=is desirable. ; kantaṃ=is pleasing. ; manāpaṃ=is agreeable to the mind. ; maggasaccaṃ=The truth of the path. ; iṭṭhaṃ=is desirable. ; kantaṃ=is pleasing. ; manāpaṃ=is agreeable. ; iti evaṃ=in this way. ; savaneneva=just by hearing the benefits of the path, its fruit, and Nibbāna. ; kammaṃ=the work of penetration. ; vā=or the work of inclining towards that Nibbāna. ; karoti=is able to do. ;

Myanmar Nissaya

pana=ပါး။ ; itaresu=ကုန်သော။ ; dvīsu=ကုန်သော။ ; saccesu=တို့တွင်။ ; ni‌‌rodhasaccaṃ=သည်။ ; iṭṭhaṃ=အလိုရှိအပ်၏။ ; kantaṃ=နှစ်သက်အပ်၏။ ; manāpaṃ=နှလုံးကို ပွားတတ်၏။ ; maggasaccaṃ=သည်။ ; iṭṭhaṃ=၏။ ; kantaṃ=၏။ ; manāpaṃ=၏။ ; iti evaṃ=သို့။ ; savaneneva=မဂ်ဖိုလ်နိဗ္ဗာန်၏ ကျေးဇူးကို ကြားနာခြင်း ဖြင့်သာလျှင်။ ; kammaṃ=ထိုးထွင်း၍ သိခြင်းအမှုကို။ ; vā=ထိုနိဗ္ဗာန်သို့ ညွတ်ခြင်းအမှုကို။ ; karoti=ပြုနိုင်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3057 | Chunk: 51

So evaṃ kammaṃ karonto cattāri saccāni ekapaṭivedhena paṭivijjhati, ekābhisamayena abhisameti.

AI Translation based on Nissaya

The person who thus does this work penetrates the four truths with a single penetration; he fully understands them with a single realization.

Vietnamese AI Translation

Người mà làm công việc này như vậy sẽ thể nhập bốn chân lý bằng một sự thể nhập duy nhất; ông ấy hoàn toàn thấu hiểu chúng bằng một sự chứng ngộ duy nhất.

AI Translation Nissaya

evaṃ=Thus. ; kammaṃ=the work of practicing meditation and inclining towards Nibbāna. ; karonto=the person who does. ; cattāri=the four. ; saccāni=truths. ; ekapaṭivedhena=with a single penetration. ; vā=or by penetrating them all together. ; paṭivijjhati=penetrates and sees. ; ekābhisamayena=by realizing them simultaneously. ; abhisameti=he fully understands. ;

Myanmar Nissaya

evaṃ=သို့။ ; kammaṃ=ကမ္မဋ္ဌာန်းစီးဖြန်းခြင်းအမှု နိဗ္ဗာန်သို့ ညွတ်ခြင်းအမှုကို။ ; karonto=ပုဂ္ဂိုလ်သည်။ ; cattāri=ကုန်သော။ ; saccāni=တို့ကို။ ; ekapaṭivedhena=တစ်ခုသော ပဋိဝေဓဉာဏ်ဖြင့်။ ; vā=တပေါင်းတည်း ထိုးထွင်း၍ သိသဖြင့်။ ; paṭivijjhati=၍ သိမြင်၏။ ; ekābhisamayena=တပြိုင်နက် သိသောအားဖြင့်။ ; abhisameti=လွန်စွာ သိ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3058 | Chunk: 51

Dukkhaṃ pariññāpaṭivedhena paṭivijjhati, samudayaṃ pahānapaṭivedhena paṭivijjhati.

AI Translation based on Nissaya

He penetrates suffering by the penetration of full understanding; he penetrates the origin by the penetration of abandoning.

Vietnamese AI Translation

Ông ấy thể nhập Khổ bằng sự thể nhập của sự hoàn toàn thấu hiểu; ông ấy thể nhập Tập bằng sự thể nhập của sự từ bỏ.

AI Translation Nissaya

dukkhaṃ=the truth of suffering. ; pariññāpaṭivedhena=by the penetration of full understanding. ; paṭivijjhati=he penetrates. ; samudasaccaṃ=the truth of the origin. ; pahānapaṭivedhena=by the penetration of abandoning. ; paṭivijjhati=he penetrates. ;

Myanmar Nissaya

dukkhaṃ=ဒုက္ခသစ္စာကို။ ; pariññāpaṭivedhena=ပရိညာပဋိဝေဓဉာဏ်ဖြင့်။ ; paṭivijjhati=၏။ ; samudasaccaṃ=ကို။ ; pahānapaṭivedhena=ဖြင့်။ ; paṭivijjhati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3059 | Chunk: 51

Nirodhaṃ sacchikiriyāpaṭivedhena paṭivijjhati, maggaṃ bhāvanāpaṭivedhena paṭivijjhati.

AI Translation based on Nissaya

He penetrates cessation by the penetration of realization; he penetrates the path by the penetration of cultivation.

Vietnamese AI Translation

Ông ấy thể nhập Diệt bằng sự thể nhập của sự chứng ngộ; ông ấy thể nhập Đạo bằng sự thể nhập của sự tu tập.

AI Translation Nissaya

nirodhaṃ=cessation. ; sacchikiriyā paṭivedhena=by the penetration of realization. ; paṭivijjhati=he penetrates. ; maggaṃ=the path. ; bhāvanā paṭivedhena=by the penetration of cultivation. ; paṭivijjhati=he penetrates. ;

Myanmar Nissaya

nirodhaṃ=ကို။ ; sacchikiriyā paṭivedhena=ဉာဏ်ဖြင့်။ ; paṭivijjhati=၏။ ; maggaṃ=ကို။ ; bhāvanā paṭivedhena=ဉာဏ်ဖြင့်။ ; paṭivijjhati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3060 | Chunk: 51

Dukkhaṃ pariññābhisamayena … pe … maggaṃ bhāvanābhisamayena abhisameti.

AI Translation based on Nissaya

He fully understands suffering by the realization of full understanding... he fully understands the path by the realization of cultivation.

Vietnamese AI Translation

Ông ấy hoàn toàn thấu hiểu Khổ bằng sự chứng ngộ của sự hoàn toàn thấu hiểu... ông ấy hoàn toàn thấu hiểu Đạo bằng sự chứng ngộ của sự tu tập.

AI Translation Nissaya

dukkhaṃ=the truth of suffering. ; pariññābhisamayena=by the realization of full understanding. ; pa=... ; maggaṃ=the truth of the path. ; bhāvanābhisamayena=by the realization of cultivation. ; abhisameti=he fully understands. ;

Myanmar Nissaya

dukkhaṃ=သစ္စာကို။ ; pariññābhisamayena=ဖြင့်။ ; pa= ; maggaṃ=သစ္စာကို။ ; bhāvanābhisamayena=ဉာဏ်ဖြင့်။ ; abhisameti=လွန်စွာ သိ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3061 | Chunk: 51

Evamassa pubbabhāge dvīsu saccesu uggahaparipucchāsavanadhāraṇasammasanapaṭivedho hoti, dvīsu savanapaṭivedhoyeva.

AI Translation based on Nissaya

Thus, for that practitioner, in the preliminary stage, regarding the two truths of suffering and its origin, there is penetration through learning, questioning, hearing, retaining, and examining. Regarding the two truths of cessation and the path, there is only penetration through hearing.

Vietnamese AI Translation

Như vậy, đối với hành giả đó, trong giai đoạn sơ khởi, liên quan đến hai chân lý Khổ và Tập, có sự thể nhập thông qua việc học, hỏi, nghe, ghi nhớ, và xem xét. Liên quan đến hai chân lý Diệt và Đạo, chỉ có sự thể nhập thông qua việc nghe.

AI Translation Nissaya

evaṃ=Thus. ; assa=for that practitioner. ; pubbabhāge=in the preliminary stage. ; dvisu=in two. ; saccesu=truths, suffering and its origin. ; uggahaparipucchāsavanadhāraṇasammasanapaṭivedho=there is penetration through learning, questioning, hearing, retaining, and examining. ; hoti=there is. ; dvīsu=in two. ; saccesu=truths, cessation and path. ; savanapaṭivedhoyeva=there is only penetration through hearing. ; hoti=there is. ;

Myanmar Nissaya

evaṃ=ဖြင့်။ ; assa=ထိုယောဂါဝစရပုဂ္ဂိုလ်အား။ ; pubbabhāge=၌။ ; dvisu=ကုန်သော။ ; saccesu=ဒုက္ခသမုဒယသစ္စာတို့၌။ ; uggahaparipucchāsavanadhāraṇasammasanapaṭivedho=သင်၍ သိခြင်းဆွေးနွေးမေးမြန်း၍ သိခြင်းကြားနာ၍ သိခြင်း ဆောင်ရွက်၍ သုံသပ်၍ သိခြင်းသည်။ ; hoti=၏။ ; dvīsu=ကုန်သော။ ; saccesu=နိရောဓ သစ္စာ မဂ္ဂသစ္စာတို့၌။ ; savanapaṭivedhoyeva=ကြားနာ၍ သိခြင်းသည်သာလျှင်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3062 | Chunk: 51

Aparabhāge tīsu kiccato paṭivedho hoti nirodhe ārammaṇapaṭivedho.

AI Translation based on Nissaya

In the later stage, there is penetration by way of function in three truths (suffering, origin, and path), and in the truth of cessation, there is penetration by way of taking it as an object.

Vietnamese AI Translation

Trong giai đoạn sau, có sự thể nhập bằng phận sự trong ba chân lý (Khổ, Tập, và Đạo), và trong chân lý Diệt, có sự thể nhập bằng cách lấy nó làm cảnh.

AI Translation Nissaya

aparabhāge=in the later stage of the path's arising. ; tīsu=in three truths, suffering, origin, and path. ; kiccato=by way of function—fully understanding, abandoning, and cultivating. ; paṭivedho=penetration. ; hoti=occurs. ; nirodhe=in the truth of cessation. ; ārammaṇaparivedho=penetration by way of taking as an object. ; hoti=occurs. ;

Myanmar Nissaya

aparabhāge=နောက်ဖြစ်သော မဂ်ဥပါဒ်သောအဖို့၌။ ; tīsu=ကုန်သော ဒုက္ခသမုဒယသစ္စာတို့၌။ ; kiccato=ပိုင်းခြာသိ၍ ပယ်ခြင်း ပွားခြင်း ကိစ္စအားဖြင့်။ ; paṭivedho=ခြင်းသည်။ ; hoti=၏။ ; nirodhe=သစ္စာ၌။ ; ārammaṇaparivedho=အာရုံပြုသော အားဖြင့်ထိုးထွင်း၍ သိခြင်းသည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3063 | Chunk: 51

Tattha sabbampi paṭivedhañāṇaṃ lokuttaraṃ, savanadhāraṇasammasanañāṇaṃ lokiyaṃ kāmāvacaraṃ.

AI Translation based on Nissaya

Therein, all knowledge of penetration is supramundane, while the knowledge of hearing, retaining, and examining is mundane, belonging to the sense-sphere.

Vietnamese AI Translation

Trong đó, tất cả tri kiến của sự thể nhập là siêu thế, trong khi tri kiến của việc nghe, ghi nhớ, và xem xét là thế gian, thuộc dục giới.

AI Translation Nissaya

tattha=In that later stage of the path's arising. ; sabbampi=all. ; paṭivedhañāṇaṃ=knowledge of penetration. ; lokuttaraṃ=is supramundane. ; savanadhāraṇasammasanañāṇaṃ=the knowledge of hearing, the knowledge of retaining, and the knowledge of examining. ; lokiyaṃ=are mundane. ; kāmāvacaraṃ=of the sense-sphere. ;

Myanmar Nissaya

tattha=ထိုနောက်ဖြစ်သော မဂ်ဥပါဒ်သောအဖို့၌။ ; sabbampi=သော။ ; paṭivedhañāṇaṃ=သည်။ ; lokuttaraṃ=သာတည်း။ ; savanadhāraṇasammasanañāṇaṃ=ကြားနာ၍ သိသောဉာဏ် ဆောင်ရွက်မှတ်ထား၍ သိသောဉာဏ်သုံးသပ်ဆင်ခြင်၍ သိသောဉာဏ်သည်။ ; lokiyaṃ=သာတည်း။ ; kāmāvacaraṃ=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3064 | Chunk: 51

Paccavekkhaṇā pana pattasaccassa hoti, ayañca ādikammiko.

AI Translation based on Nissaya

Now, the knowledge of reviewing occurs for the noble person who has attained the truths, but this practitioner is a beginner.

Vietnamese AI Translation

Bây giờ, tri kiến quán xét phát sinh cho bậc Thánh đã chứng đạt các chân lý, nhưng hành giả này là một người sơ học.

AI Translation Nissaya

pana=Now, to speak of a further point. ; paccavekkhaṇā=the knowledge of reviewing. ; pattasaccassa=for the noble person who has attained the four truths through the path. ; hoti=occurs. ; ayañca=And this aforementioned practitioner. ; ādikammiko=is a beginner. ;

Myanmar Nissaya

pana=ဆိုဖွယ်အထူးကို ဆိုဦးအံ့။ ; paccavekkhaṇā=ဉာဏ်သည်။ ; pattasaccassa=မဂ်ဖြင့် ရောက်ပြီးသော သစ္စာလေးပါး တရားရှိသော အရိယာ ပုဂ္ဂိုလ်အား။ ; hoti=၏။ ; ayañca=ဤသို့ ဆိုအပ်ခဲ့ပြီးသော ယောဂါဝစရပုဂ္ဂိုလ်သည်လည်း။ ; ādikammiko=ပုဂ္ဂိုလ်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3065 | Chunk: 51

Tasmā sā idha na vuttā.

AI Translation based on Nissaya

Therefore, it is not mentioned here.

Vietnamese AI Translation

Do đó, nó không được đề cập ở đây.

AI Translation Nissaya

tasmā=Therefore. ; sā=that knowledge of reviewing. ; idha=here. ; navuttā=is not mentioned. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; sā=ထို ပစ္စဝေက္ခဏာဉာဏ်ကို။ ; idha=ဤအရာ၌။ ; navuttā=မဆိုအပ်သတည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3066 | Chunk: 51

Imassa ca [P1.165] bhikkhuno pubbe pariggahato ‘‘dukkhaṃ parijānāmi, samudayaṃ pajahāmi, nirodhaṃ sacchikaromi, maggaṃ bhāvemī’’ ti ābhogasamannāhāramanasikārapaccavekkhaṇā natthi, pariggahato paṭṭhāya hoti.

AI Translation based on Nissaya

And for this beginner monk [P1.165], before grasping the truths, there is no attention, proper application of mind, keeping in mind, or reviewing in the manner of, 'I fully understand suffering, I abandon the origin, I realize cessation, I cultivate the path.' It is only from the time of grasping them that this occurs.

Vietnamese AI Translation

Và đối với tỳ khưu sơ học này [P1.165], trước khi nắm bắt các chân lý, không có sự chú ý, sự hướng tâm đúng đắn, sự ghi nhớ, hay sự quán xét theo cách, 'Tôi hoàn toàn thấu hiểu Khổ, tôi từ bỏ Tập, tôi chứng ngộ Diệt, tôi tu tập Đạo.' Chỉ từ khi nắm bắt chúng mà điều này mới xảy ra.

AI Translation Nissaya

imassa ca bhikkhuno=And for this beginner monk. ; pariggahato=from grasping the four truths without confusion. ; vā=or from grasping them as a meditation subject. ; pu‌bbe=before that. ; dukkhaṃ=suffering. ; parijānāmi=I fully understand. ; samudayaṃ=the origin. ; pajahāmi=I abandon. ; nirodhaṃ=cessation. ; sacchikaromi=I realize. ; maggaṃ=the path. ; bhāvemi=I cultivate. ; iti=thus. ; ābhogasamannāhāramanasikārapaccavekkhaṇā=the review consisting of attention, proper application of mind, and keeping in mind. ; natthi=does not exist. ; pariggahato=from grasping the four truths without confusion. ; paṭṭhāya=starting. ; ābhoga.la. paccavekkhaṇā=attention... review. ; hoti=exists. ;

Myanmar Nissaya

imassa ca bhikkhuno=ဤအာဒိကမ္မိက ရဟန်းအားလည်း။ ; pariggahato=အသမ္မောဟအားဖြင့် သစ္စာလေးပါးကို သိသည်မှ။ ; vā=ကမ္မဋ္ဌာန်းအားဖြင့် သိမ်းဆည်းသည် မှ။ ; pu‌bbe=၌။ ; dukkhaṃ=ကို။ ; parijānāmi=ပိုင်းခြား၍ သိ၏။ ; samudayaṃ=ကို။ ; pajahāmi=၏။ ; nirodhaṃ=ကို။ ; sacchikaromi=၏။ ; maggaṃ=ကို။ ; bhāvemi=ပွားစေ၏။ ; iti=သို့။ ; ābhogasamannāhāramanasikārapaccavekkhaṇā=နှလုံးသွင်းခြင်း စိတ်ကို ကောင်းစွာဆောင်ခြင်းစိတ်၌ထားသည်ကို ပြခြင်း ဆင်ခြင်ခြင်းသည်။ ; natthi=မရှိ။ ; pariggahato=အသမ္မောဟအားဖြင့် သစ္စာလေးပါးကို သိမ်းဆည်းသည်မှ။ ; paṭṭhāya=၍။ ; ābhoga.la. paccavekkhaṇā=နှလုံးသွင်းခြင်း။လ။ ဆင်ခြင်ခြင်းသည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3067 | Chunk: 51

Aparabhāge pana dukkhaṃ pariññātameva hoti … pe … maggo bhāvitova hoti.

AI Translation based on Nissaya

However, in the later stage, suffering is indeed already fully understood... the path is indeed already cultivated.

Vietnamese AI Translation

Tuy nhiên, trong giai đoạn sau, Khổ quả thật đã hoàn toàn thấu hiểu... Đạo quả thật đã tu tập.

AI Translation Nissaya

pana=Now, to speak of a further point. ; aparabhāge=in the later stage of the fruit's arising. ; vā=or in the stage of the path's arising. ; dukkhaṃ=suffering. ; pariññātameva=is indeed already fully understood. ; hoti=it is. ; la=... ; maggo=the path. ; bhāvitova=is indeed already cultivated. ; hoti=it is. ;

Myanmar Nissaya

pana=အထူးကိုဆိုအံ့။ ; aparabhāge=နောက်ဖြစ်သော ဖိုလ်ဥပါဒ်သော အဖို့၌။ ; vā=မဂ်ဥပါဒ်သော အဖို့၌။ ; dukkhaṃ=ကို။ ; pariññātameva=ပိုင်းခြား၍ သိပြီးသည်သာလျှင်။ ; hoti=၏။ ; la= ; maggo=ကို။ ; bhāvitova=ပြီးသည်သာလျှင်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3068 | Chunk: 51

Tattha dve saccāni duddasattā gambhīrāni, dve gambhīrattā duddasāni.

AI Translation based on Nissaya

Among these, two truths (suffering and origin) are profound because they are difficult to see, while two truths (cessation and path) are difficult to see because they are profound.

Vietnamese AI Translation

Trong số này, hai chân lý (Khổ và Tập) là sâu xa vì chúng khó thấy, trong khi hai chân lý (Diệt và Đạo) là khó thấy vì chúng sâu xa.

AI Translation Nissaya

tattha=Among those four truths. ; dve=two. ; saccāni=truths, suffering and origin. ; duddasattā=because of being difficult to see. ; vā=or because of being difficult to penetrate. ; gambhīrāni=are profound. ; dve=two. ; saccāni=truths, cessation and path. ; gambhīrattā=because of being profound. ; duddasāni=are difficult to see. ;

Myanmar Nissaya

tattha=ထိုလေးပါးသော သစ္စာတို့တွင်။ ; dve=ကုန်သော။ ; saccāni=ဒုက္ခသမုဒယသစ္စာ တို့သည်။ ; duddasattā=မြင်နိုင်ခဲသည်၏ အဖြစ်ကြောင့်။ ; vā=ထိုးထွင်း၍ သိနိုင်ခဲသည်၏ အဖြစ်ကြောင့်။ ; gambhīrāni=ကုန်၏။ ; dve=ကုန်သော။ ; saccāni=နိရောဓ မဂ္ဂသစ္စာတို့သည်။ ; gambhīrattā=နက်နဲသည်၏ အဖြစ်ကြောင့်။ ; duddasāni=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3069 | Chunk: 51

Dukkhasaccañhi uppattito pākaṭaṃ, khāṇukaṇṭakappahārādīsu ‘‘aho dukkhan’’ ti vattabbatampi āpajjati.

AI Translation based on Nissaya

Indeed, the truth of suffering is manifest in terms of its arising; in cases of stumbling over a stump, being pricked by a thorn, and so on, it even reaches the point of being spoken of as, 'Alas, how painful!'

Vietnamese AI Translation

Thật vậy, chân lý Khổ biểu hiện rõ ràng về mặt sự sanh khởi của nó; trong những trường hợp vấp phải gốc cây, bị gai đâm, v.v., nó thậm chí đạt đến mức độ được nói đến như, 'Ôi, đau quá!'

AI Translation Nissaya

hi saccaṃ=Indeed. ; dukkhasaccaṃ=the truth of suffering. ; uppattito=in terms of its arising. ; pākaṭaṃ=is manifest. ; khānukaṇṭakappahārādīsu=in instances of stumbling over a stump, being pricked by a thorn, etc. ; vata=indeed. ; ahodukkhaṃ=alas, how painful! ; iti=thus. ; vattabbatampi=even the state of being spoken of. ; āpajjati=it reaches. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; dukkhasaccaṃ=သည်။ ; uppattito=ဖြစ်သော အားဖြင့်။ ; pākaṭaṃ=ထင်ရှား၏။ ; khānukaṇṭakappahārādīsu=ခလုတ်တိုက်မိခြင်း ဆူးစူးခြင်း အစရှိသည်တို့၌။ ; vata=စင်စစ်။ ; ahodukkhaṃ=အောက် ဆင်းရဲစွာ။ ; iti=သို့။ ; vattabbatampi=ဆိုအပ်သည်၏ အဖြစ်သို့လည်း။ ; āpajjati=ရောက်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3070 | Chunk: 51

Samudayasaccaṃ khāditukāmatābhuñjitukāmatādivasena uppattito pākaṭaṃ.

AI Translation based on Nissaya

The truth of the origin is manifest in terms of its arising, by way of the desire to chew, the desire to eat, and so on.

Vietnamese AI Translation

Chân lý Tập biểu hiện rõ ràng về mặt sự sanh khởi của nó, bằng cách sự ham muốn nhai, sự ham muốn ăn, v.v.

AI Translation Nissaya

samudayasaccaṃ=The truth of the origin. ; khāditukamatā bhuñjitukāmatādivasena=by way of the desire to chew, the desire to eat, and so on. ; uppattito=in terms of its arising. ; pākaṭaṃ=is manifest. ;

Myanmar Nissaya

samudayasaccaṃ=သည်။ ; khāditukamatā bhuñjitukāmatādivasena=ခဲခြင်းငှါ အလိူရှိသည်၏ အဖြစ် စားခြင်းငှါ အလိုရှိသည်၏ အဖြစ် အစရှိသည်တို့၏ အစွမ်းဖြင့်။ ; uppattito=ဖြစ်သော အားဖြင့်။ ; pākaṭaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3071 | Chunk: 51

Lakkhaṇapaṭivedhato pana ubhayampi [V1.140] gambhīraṃ.

AI Translation based on Nissaya

But in terms of penetrating their characteristics, both are profound [V1.140].

Vietnamese AI Translation

Nhưng về mặt thể nhập các đặc tính của chúng, cả hai đều sâu xa [V1.140].

AI Translation Nissaya

pana=However, to speak of their profound nature. ; lakkhaṇapaṭivedhato=in terms of penetrating their characteristics. ; ubhayampi=both truths of suffering and origin. ; gambhīraṃ=are profound. ;

Myanmar Nissaya

pana=ဂမ္ဘီရသဘောကို ဆိုဦးအံ့။ ; lakkhaṇapaṭivedhato=လက္ခဏာကို ထိုးထွင်း၍ သိသောအားဖြင့်။ ; ubhayampi=နှစ်ပါးစုံသော ဒုက္ခသမုဒယ သစ္စာသည်လည်း။ ; gambhīraṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3072 | Chunk: 51

Iti tāni duddasattā gambhīrāni.

AI Translation based on Nissaya

Thus, they are profound because they are difficult to see.

Vietnamese AI Translation

Như vậy, chúng sâu xa vì chúng khó thấy.

AI Translation Nissaya

iti=Thus. ; tāni=those truths of suffering and origin. ; duddasattā=because of being difficult to see. ; vā=or because of being difficult to penetrate. ; gambhīrāni=are profound. ;

Myanmar Nissaya

iti=သို့။ ; tāni=ထိုဒုက္ခသမုဒယ သစ္စာတို့သည်။ ; duddasattā=မြင်နိုင်ခဲသည်၏ အဖြစ်ကြောင့်။ ; vā=ထိုးထွင်း၍ သိနိုင်ခဲသည်၏ အဖြစ်ကြောင့်။ ; gambhīrāni=နက်နဲကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3073 | Chunk: 51

Itaresaṃ pana dvinnaṃ dassanatthāya payogo bhavaggaggahaṇatthaṃ hatthapasāraṇaṃ viya, avīciphusanatthaṃ pādapasāraṇaṃ viya, satadhā bhinnassa vālassa koṭiyā koṭipaṭipādanaṃ viya ca hoti.

AI Translation based on Nissaya

As for the other two, the effort to see them is like stretching out one's hand to grasp the peak of existence, like stretching out one's foot to touch the Avīci hell, or like trying to touch the tip of one horsehair with the tip of another that has been split a hundred times.

Vietnamese AI Translation

Đối với hai cái còn lại, sự nỗ lực để thấy chúng giống như vươn tay ra để nắm đỉnh hữu, giống như vươn chân ra để chạm địa ngục Avīci, hoặc giống như cố gắng chạm đầu một sợi lông ngựa bằng đầu sợi khác đã được chẻ ra một trăm lần.

AI Translation Nissaya

pana=Furthermore. ; itaresaṃ=of the other. ; dvinnaṃ=two truths, cessation and path. ; dassanatthāya=for the purpose of seeing. ; payogo=the effort. ; vā=or the exertion. ; bhavaggaggahaṇatthaṃ=for the purpose of grasping the peak of existence. ; hatthapasāraṇaṃviya=is like stretching out the hand. ; avīciphusa natthaṃ=for the purpose of touching the Avīci hell. ; vādapasāraṇaṃviya=is like stretching out the foot. ; satadhā=into a hundred strands. ; bhinnassa=of what is split. ; vālassa=of a horsehair. ; koṭiyā=with the tip. ; koṭi paṭipādanaṃviya=is like making it touch another tip. ; hoti=it is. ;

Myanmar Nissaya

pana=ထိုမှ တပါး။ ; itaresaṃ=ဤသစ္စာနှစ်ပါးမှ တပါးကုန်သော။ ; dvinnaṃ=ကုန်သော နိရောဓ မဂ္ဂသစ္စာတို့ကို။ ; dassanatthāya=ငှါ။ ; payogo=အားထုတ်ခြင်းသည်။ ; vā=အားထုတ်ခြင်းအမှု လုံ့လပြုခြင်းသည်။ ; bhavaggaggahaṇatthaṃ=ဘဝဂ်ကို လှမ်းယူခြင်းငှါ။ ; hatthapasāraṇaṃviya=လက်ကိုဆန့်ခြင်းကဲ့သို့ လည်းကောင်း။ ; avīciphusa natthaṃ=အဝီစိကို ထိခြင်းငှါ။ ; vādapasāraṇaṃviya=ကဲ့သို့။ ; satadhā=အရာသော အစိပ်ဖြင့်။ ; bhinnassa=ခွဲစိပ်အပ်သော။ ; vālassa=သားမြီးဖျား၏။ ; koṭiyā=အစွန်းဖြင့်။ ; koṭi paṭipādanaṃviya=အစွန်းကို ထိစေခြင်းကဲ့သို့လည်းကောင်း။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3074 | Chunk: 51

Iti tāni gambhīrattā duddasāni.

AI Translation based on Nissaya

Thus, they are difficult to see because they are profound.

Vietnamese AI Translation

Như vậy, chúng khó thấy vì chúng sâu xa.

AI Translation Nissaya

iti=Thus. ; tāni=those two truths of cessation and path. ; gambhīrattā=because of being profound. ; duddasāni=are difficult to see. ; vā=or difficult to penetrate. ;

Myanmar Nissaya

iti=သို့။ ; tāni=ထိုနိရောဓ မဂ္ဂသစ္စာ နှစ်ပါးတို့သည်။ ; gambhīrattā=နက်နဲသည်၏ အဖြစ်ကြောင့်။ ; duddasāni=ကုန်၏။ ; vā=ထိုးထွင်း၍ သိနိုင်ခဲကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3075 | Chunk: 51

Evaṃ duddasattā gambhīresu gambhīrattā ca duddasesu catūsu saccesu uggahādivasena pubbabhāgañāṇuppattiṃ sandhāya idaṃ ‘‘dukkhe ñāṇan’’ tiādi vuttaṃ.

AI Translation based on Nissaya

Thus, with reference to the arising of knowledge in the preliminary stage by way of learning, etc., regarding the four truths—which are profound because they are difficult to see, and difficult to see because they are profound—this was said, beginning with 'knowledge in suffering'.

Vietnamese AI Translation

Như vậy, liên quan đến sự sanh khởi của tri kiến trong giai đoạn sơ khởi bằng cách học hỏi, v.v., liên quan đến bốn chân lý—sâu xa vì chúng khó thấy, và khó thấy vì chúng sâu xa—điều này đã được nói, bắt đầu với 'tri kiến về Khổ'.

AI Translation Nissaya

evaṃ=in this way just described. ; duddasattā=because they are difficult to see. ; gambhīresu=which are profound. ; gambhīrattāca=and because they are profound. ; duddasesu=which are difficult to see. ; catūsu=in the four. ; saccesu=truths. ; uggahādivasena=by way of learning, etc. ; pubbabhāgañāṇuppattiṃ=the arising of knowledge in the preliminary stage. ; sandhāya=with reference to. ; dukkheñāṇantiādi=this phrase beginning 'knowledge in suffering'. ; idaṃvacanaṃ=this statement. ; vuttaṃ=was spoken. ;

Myanmar Nissaya

evaṃ=ဤသို့ ဆိုအပ်ခဲ့ပြီးသော နည်းဖြင့်။ ; duddasattā=ကြောင့်။ ; gambhīresu=ကုန်သော။ ; gambhīrattāca=ကြောင့်လည်ကောင်း။ ; duddasesu=ခဲကုန်သော။ ; catūsu=ကုန်သော။ ; saccesu=တို့၌။ ; uggahādivasena=သင်ခြင်းအစရှိသည်တို့၏ အစွမ်းဖြင့်။ ; pubbabhāgañāṇuppattiṃ=မဂ်၏ ရှေ့အဖို့၌ ဉာဏ်၏ ဖြစ်ခြင်းကို။ ; sandhāya=ရည်၍။ ; dukkheñāṇantiādi=ဤသို့ အစရှိသော။ ; idaṃvacanaṃ=ကို။ ; vuttaṃ=အပ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3076 | Chunk: 51

Paṭivedhakkhaṇe pana ekameva taṃ ñāṇaṃ hoti.

AI Translation based on Nissaya

At the moment of penetration, however, that knowledge is one and the same.

Vietnamese AI Translation

Tuy nhiên, vào sát-na thể nhập, tri kiến đó là một và đồng nhất.

AI Translation Nissaya

pana=However, as for the moment of the path. ; paṭivedhakkhaṇe=at the moment of penetrating the four truths. ; taṃ ñāṇaṃ=that knowledge which knows the four truths. ; ekameva=is just the single path-knowledge. ; hoti=it is. ;

Myanmar Nissaya

pana=မဂ်ခဏ၌ သညိသည်ကိုဆိုအံ့။ ; paṭivedhakkhaṇe=သစ္စာလေးပါးကို ထိုးထွင်း၍ သိသော ခဏ၌။ ; taṃ ñāṇaṃ=ထိုသစ္စာလေးပါးကိုသိသောဉာဏ်သည်။ ; ekameva=မဂ်ဉာဏ်တပါးတည်းသာလျှင်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3077 | Chunk: 51

Apare [M1.153] panāhu – catubbidhaṃ saccesu ñāṇaṃ sutamayañāṇaṃ vavatthānañāṇaṃ sammasanañāṇaṃ abhisamayañāṇanti.

AI Translation based on Nissaya

But others [M1.153] say that knowledge of the truths is fourfold: knowledge based on hearing, knowledge based on analysis, knowledge based on comprehension, and knowledge based on realization.

Vietnamese AI Translation

Nhưng những người khác [M1.153] nói rằng tri kiến về các chân lý có bốn loại: tri kiến từ việc nghe, tri kiến từ việc phân tích, tri kiến từ việc thấu hiểu, và tri kiến từ việc chứng ngộ.

AI Translation Nissaya

pana=Now, to state a different view from the Theravāda school. ; apare=Other teachers. ; āhu=say. ; kiṃāhu=What do they say?. ; catubbidhaṃ saccesu.la. idaṃ abhisamayañāṇanti=. ; āhu=they say. ; saccesu=in the truths. ; ñāṇaṃ=knowledge. ; sutamayañāṇaṃ=is knowledge based on hearing. ; vavatthānañāṇaṃ=knowledge based on analysis. ; sammasanañāṇaṃ=knowledge based on comprehension. ; abhisamayañāṇaṃ=and knowledge based on realization. ; iti=thus. ; catubbidhaṃ=it is fourfold. ;

Myanmar Nissaya

pana=သကဝါဒမှ တပါး ပရဝါဒကိုဆိုအံ့။ ; apare=တပါးသော တရားတို့သည်။ ; āhu=ကုန်၏။ ; kiṃāhu=‌ကား။ ; catubbidhaṃ saccesu.la. idaṃ abhisamayañāṇanti=ဟူ၍။ ; āhu=ဆိုကုန်၏။ ; saccesu=တို့၌။ ; ñāṇaṃ=သိသောဉာဏ်သည်။ ; sutamayañāṇaṃ=လည်းကောင်း။ ; vavatthānañāṇaṃ=လည်းကောင်း။ ; sammasanañāṇaṃ=လည်းကောင်း။ ; abhisamayañāṇaṃ=လည်းကောင်း။ ; iti=သို့။ ; catubbidhaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3078 | Chunk: 51

Tattha katamaṃ sutamayañāṇaṃ ?

AI Translation based on Nissaya

Among these, what is knowledge based on hearing?

Vietnamese AI Translation

Trong số này, tri kiến từ việc nghe là gì?

AI Translation Nissaya

tattha=Among these four. ; sutamayañāṇaṃ=knowledge based on hearing. ; katamaṃ=what is it?. ;

Myanmar Nissaya

tattha=ထိုလေးပါးတို့တွင်။ ; sutamayañāṇaṃ=ဟူသည်။ ; katamaṃ=နည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3079 | Chunk: 51

Saṃkhittena vā vitthārena vā cattāri saccāni sutvā jānāti ‘‘idaṃ dukkhaṃ, ayaṃ samudayo, ayaṃ nirodho, ayaṃ maggo’’ ti.

AI Translation based on Nissaya

Having heard the four truths, whether in brief or in detail, one knows: 'This is suffering, this is the origin, this is cessation, this is the path.'

Vietnamese AI Translation

Sau khi nghe bốn chân lý, dù tóm tắt hay chi tiết, người ta biết: 'Đây là Khổ, đây là Tập, đây là Diệt, đây là Đạo.'

AI Translation Nissaya

saṅkhittenavā=in brief or. ; vittārenavā=in detail. ; cattāri=the four. ; saccāni=truths. ; sutvā=having heard. ; idaṃ=this. ; dukkhaṃ=is suffering. ; ayaṃ=this. ; samudayo=is the origin. ; ayaṃ=this. ; nirodho=is cessation. ; ayaṃ=this. ; maggo=is the path. ; iti=thus. ; jānāti=one knows. ;

Myanmar Nissaya

saṅkhittenavā=လည်းကောင်း။ ; vittārenavā=လည်းကောင်း။ ; cattāri=ကုန်သော။ ; saccāni=တို့ကို။ ; sutvā=၍။ ; idaṃ=သည်ကား။ ; dukkhaṃ=တည်း။ ; ayaṃ=သည်ကား။ ; samudayo=တည်း။ ; ayaṃ=ကား။ ; nirodho=တည်း။ ; ayaṃ=သည်ကား။ ; maggo=တည်း။ ; iti=သို့။ ; jānāti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3080 | Chunk: 51

Idaṃ sutamayañāṇaṃ.

AI Translation based on Nissaya

This is knowledge based on hearing.

Vietnamese AI Translation

Đây là **tri kiến từ việc nghe**.

AI Translation Nissaya

idaṃ=This knowledge. ; sutamayañāṇaṃ=is called knowledge based on hearing. ; vavatthānañāṇaṃ=Knowledge based on analysis. ;

Myanmar Nissaya

idaṃ=ဤသို့သိခြင်းသည်။ ; sutamayañāṇaṃ=ဉာဏ်မည်၏။ ; vavatthānañāṇaṃ=ဟူသည်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3081 | Chunk: 51

Katamaṃ vavatthānañāṇaṃ ?

AI Translation based on Nissaya

What is knowledge based on analysis?

Vietnamese AI Translation

Tri kiến từ việc phân tích là gì?

AI Translation Nissaya

katamaṃ=what is it?. ;

Myanmar Nissaya

katamaṃ=နည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3082 | Chunk: 51

So sutānaṃ atthaṃ upaparikkhati dhammato ca lakkhaṇato ca, ‘‘ime dhammā imasmiṃ sacce pariyāpannā, imassa saccassa idaṃ lakkhaṇan’’ ti sanniṭṭhānaṃ karoti.

AI Translation based on Nissaya

He investigates the meaning of what he has heard, both in terms of its nature and its characteristics, and makes the conclusion: 'These phenomena are included in this truth; this is the characteristic of this truth.'

Vietnamese AI Translation

Ông ấy điều tra ý nghĩa của những gì ông ấy đã nghe, cả về bản chất và đặc tính của nó, và đưa ra kết luận: 'Các pháp này được bao gồm trong chân lý này; đây là đặc tính của chân lý này.'

AI Translation Nissaya

so=That person who knows by hearing. ; sutānaṃ=of the truths that have been heard. ; atthaṃ=the meaning. ; upaparikkhati=investigates. ; dhammatoca=by way of their nature and. ; lakkhaṇatoca=by way of the characteristics of the truths. ; ime dhammā=these states. ; imasmiṃ sacce=in this truth. ; pariyāpannā=are included. ; imassa saccassa=of this particular truth. ; idaṃ=this. ; lakkhaṇaṃ=is the characteristic. ; iti=thus. ; sinniṭṭhānaṃ=a conclusion. ; karoti=he makes. ;

Myanmar Nissaya

so=ထိုကြားနာ၍ သိသော ပုဂ္ဂိုလ်သည်။ ; sutānaṃ=ကြားနာအပ်ပြီးသော သစ္စာတို့၏။ ; atthaṃ=အနက်ကို။ ; upaparikkhati=စူးစမ်းဆင်ခြင်၏။ ; dhammatoca=သဘောအားဖြင့် လည်းကောင်း။ ; lakkhaṇatoca=သစ္စာ၏ လက္ခဏာအားဖြင့် လည်းကောင်း။ ; ime dhammā=ဤတရားတို့သည်။ ; imasmiṃ sacce=၌။ ; pariyāpannā=ကုန်၏။ ; imassa saccassa=ဤမည်သော သစ္စာ၏။ ; idaṃ=ဤသည်ကား။ ; lakkhaṇaṃ=တည်း။ ; iti=သို့။ ; sinniṭṭhānaṃ=ခြင်းကို။ ; karoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3083 | Chunk: 51

Idaṃ vavatthānañāṇaṃ.

AI Translation based on Nissaya

This is knowledge based on analysis.

Vietnamese AI Translation

Đây là **tri kiến từ việc phân tích**.

AI Translation Nissaya

idaṃ=This knowledge which makes such a conclusion. ; vavatthānañāṇaṃ=is called knowledge based on analysis. ;

Myanmar Nissaya

idaṃ=ဤသို့ဆုံးဖြတ်ခြင်းကို ပြုသော ဉာဏ်သည်။ ; vavatthānañāṇaṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3084 | Chunk: 51

Katamaṃ sammasanañāṇaṃ ?

AI Translation based on Nissaya

What is knowledge based on comprehension?

Vietnamese AI Translation

Tri kiến từ việc thấu hiểu là gì?

AI Translation Nissaya

sammasanañāṇaṃ=Knowledge based on comprehension. ; katamaṃ=what is it?. ;

Myanmar Nissaya

sammasanañāṇaṃ=ဟူသည်။ ; katamaṃ=နည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3085 | Chunk: 51

So evaṃ yathānupubbaṃ cattāri saccāni vavatthapetvā atha dukkhameva gahetvā yāva gotrabhuñāṇaṃ aniccato dukkhato anattato sammasati.

AI Translation based on Nissaya

Having thus determined the four truths in due order, he then takes up just suffering and comprehends it as impermanent, as suffering, and as non-self, up to the change-of-lineage knowledge.

Vietnamese AI Translation

Sau khi đã xác định bốn chân lý theo thứ tự đúng đắn như vậy, ông ấy sau đó chỉ lấy Khổ và thấu hiểu nó là vô thường, là khổ, và là vô ngã, cho đến tri kiến chuyển tánh.

AI Translation Nissaya

so=That person who reflects on the meaning. ; vā=or that person who makes a conclusion. ; evaṃ=thus. ; yathānupubbaṃ=in due order. ; cattāri=the four. ; saccāni=truths. ; vavatthapetvā=having determined. ; atha pacchā=then afterwards. ; dukkhameva=only the truth of suffering. ; gahetvā=having taken up. ; yāva gotrabhuñāṇaṃ=up to the change-of-lineage knowledge. ; aniccato=as impermanent. ; dukkhato=as suffering. ; anattato=as non-self. ; sammasati=he comprehends. ;

Myanmar Nissaya

so=ထိုအနက်ကို ဆင်ခြင်သော ပုဂ္ဂိုလ်သည်။ ; vā=ဆုံးဖြတ်ခြင်းကို ပြုသော ပုဂ္ဂိုလ်သည်။ ; evaṃ=သို့။ ; yathānupubbaṃ=အစဉ်အတိုင်း။ ; cattāri=ကုန်သော။ ; saccāni=တို့ကို။ ; vavatthapetvā=ပိုင်းခြား၍။ ; atha pacchā=ထို့နောင်မှ။ ; dukkhameva=ဒုက္ခသစ္စာကိုသာလျှင်။ ; gahetvā=ယူ၍။ ; yāva gotrabhuñāṇaṃ=တိုင်အောင်။ ; aniccato=အာဖြင့်။ ; dukkhato=အားဖြင့်။ ; anattato=အာဖြင့်။ ; sammasati=သုံးသပ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3086 | Chunk: 51

Idaṃ sammasanañāṇaṃ.

AI Translation based on Nissaya

This is knowledge based on comprehension.

Vietnamese AI Translation

Đây là **tri kiến từ việc thấu hiểu**.

AI Translation Nissaya

idaṃ=This knowledge that comprehends in terms of impermanence, etc. ; sammasanañāṇaṃ=is called knowledge based on comprehension. ;

Myanmar Nissaya

idaṃ=ဤသို့ အနိစ္စ အစရှိသောအားဖြင့် သုံးသပ်တတ်သော ဉာဏ်သည်။ ; sammasanañāṇaṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3087 | Chunk: 51

Katamaṃ abhisamayañāṇaṃ ?

AI Translation based on Nissaya

What is knowledge based on realization?

Vietnamese AI Translation

Tri kiến từ việc chứng ngộ là gì?

AI Translation Nissaya

abhisamayañāṇaṃ=Knowledge based on realization. ; katamaṃ=what is it?. ;

Myanmar Nissaya

abhisamayañāṇaṃ=သည်။ ; katamaṃ=နည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3088 | Chunk: 51

Lokuttaramaggakkhaṇe ekena ñāṇena cattāri saccāni apubbaṃ acarimaṃ abhisameti ‘‘dukkhaṃ pariññābhisamayena, samudayaṃ pahānābhisamayena, nirodhaṃ sacchikiriyābhisamayena [P1.166] maggaṃ bhāvanābhisamayena abhisametī’’ ti.

AI Translation based on Nissaya

At the moment of the supramundane path, with a single knowledge, he realizes the four truths simultaneously: 'he realizes suffering by the realization of full understanding, he realizes the origin by the realization of abandoning, he realizes cessation by the realization of making it manifest [P1.166], and he realizes the path by the realization of cultivation.'

Vietnamese AI Translation

Vào sát-na đạo siêu thế, với một tri kiến duy nhất, ông ấy chứng ngộ bốn chân lý đồng thời: 'ông ấy chứng ngộ Khổ bằng sự chứng ngộ của sự hoàn toàn thấu hiểu, ông ấy chứng ngộ Tập bằng sự chứng ngộ của sự từ bỏ, ông ấy chứng ngộ Diệt bằng sự chứng ngộ của sự hiển bày nó [P1.166], và ông ấy chứng ngộ Đạo bằng sự chứng ngộ của sự tu tập.'

AI Translation Nissaya

‌lokuttaramaggakkhaṇe=At the moment of the supramundane path. ; ekenañāṇena=with a single knowledge. ; cattāri=the four. ; saccāni=truths. ; apubbaṃ acarimaṃ=neither before nor after (simultaneously). ; abhisameti=he penetrates and knows. ; kiṃ abhisameti=What does he realize?. ; dukkhaṃ=suffering. ; pariññābhisamayena=by the realization called full understanding. ; abhisameti=he realizes. ; samudayaṃ=the origin. ; pahānābhisamayena=by the realization called abandoning. ; abhisameti=he realizes. ; nirodhaṃ=cessation. ; sacchikiriyābhisamayena=by the realization called making manifest. ; abhisameti=he realizes. ; maggaṃ=the path. ; bhāvanābhisamayena=by the realization called cultivation. ; abhisameti=he realizes. ; iti=thus. ; abhisameti=he realizes. ;

Myanmar Nissaya

‌lokuttaramaggakkhaṇe=ယောကုတ္တရာ မဂ်ခဏ၌။ ; ekenañāṇena=တစ်ခုတည်းသော ဉာဏ်ဖြင့်။ ; cattāri=ကုန်သော။ ; saccāni=တို့ကို။ ; apubbaṃ acarimaṃ=မရှေးမနှောင်း။ ; abhisameti=ထိုးထွင်း၍ သိ၏။ ; kiṃ abhisameti=ကား။ ; dukkhaṃ=ကို။ ; pariññābhisamayena=ပိုင်းခြား၍ သိခြင်းဟုဆိုအပ်သော အဘိသမယဖြင့်။ ; abhisameti=၏။ ; samudayaṃ=ကို။ ; pahānābhisamayena=ပယ်ခြင်းတည်းဟူသော အဘိသမယဖြင့်။ ; abhisameti=၏။ ; nirodhaṃ=ကို။ ; sacchikiriyābhisamayena=မျက်မှောက်ပြုခြင်းတည်းဟူသော အဘိသမယဖြင့်။ ; abhisameti=၏။ ; maggaṃ=ကို။ ; bhāvanābhisamayena=ပွားခြင်းတည်းဟူသော အဘိသမယဖြင့်။ ; abhisameti=၏။ ; iti=သို့။ ; abhisameti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3089 | Chunk: 51

Idaṃ abhisamayañāṇan ti.

AI Translation based on Nissaya

This is called the knowledge of realization.

Vietnamese AI Translation

Đây được gọi là tri kiến chứng ngộ.

AI Translation Nissaya

idaṃ=This knowledge that knows by means of penetration. ; abhisamayañāṇaṃ=is called. ;

Myanmar Nissaya

idaṃ=ဤသို့ ထိုးထွင်း၍ သိသော ဉာဏ်သည်။ ; abhisamayañāṇaṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3090 | Chunk: 52

Sammāsaṅkappaniddese kāmato nissaṭoti nekkhammasaṅkappo.

AI Translation based on Nissaya

In the exposition of right thought: because it is freed from sensual pleasures, it is the thought of renunciation.

Vietnamese AI Translation

Trong phần giải thích về Chánh Tư Duy: vì nó được giải thoát khỏi dục lạc, nên nó là tư duy xuất ly.

AI Translation Nissaya

sammāsaṅkappaniddese=In the exposition of right thought. ; (attho=the meaning. ; evaṃ=thus. ; veditabbo=should be understood). ; kāmato=from the two kinds of sensual pleasure: objective sensual pleasure and defilement-based sensual pleasure. ; nissaṭo=is freed. ; iti tasmā=because of that. ; nekkhammasaṅkappo=it is called the thought of renunciation. ;

Myanmar Nissaya

sammāsaṅkappaniddese=၌။ ; (attho=ကို။ ; evaṃ=သို့။ ; veditabbo=၏)။ ; kāmato=ဝတ္ထုကာမ ကိလေသာကာမ နှစ်ပါးမှ။ ; nissaṭo=လွတ်သည်တည်း။ ; iti tasmā=ကြောင့်။ ; nekkhammasaṅkappo=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3091 | Chunk: 52

Byāpādato nissaṭoti abyāpādasaṅkappo.

AI Translation based on Nissaya

Because it is freed from ill will, it is the thought of non-ill will.

Vietnamese AI Translation

Vì nó được giải thoát khỏi sân hận, nên nó là tư duy vô sân.

AI Translation Nissaya

byāpādato=From ill will. ; nissaṭo=is freed. ; iti tasmā=because of that. ; abyāpādasaṅkappo=it is called the thought of non-ill will. ;

Myanmar Nissaya

byāpādato=ဒေါသမှ။ ; nissaṭo=တည်း။ ; iti tasmā=ကြောင့်။ ; abyāpādasaṅkappo=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3092 | Chunk: 52

Vihiṃsāya nissaṭoti avihiṃsāsaṅkappo.

AI Translation based on Nissaya

Because it is freed from cruelty, it is the thought of non-cruelty.

Vietnamese AI Translation

Vì nó được giải thoát khỏi sự tàn ác, nên nó là tư duy vô hại.

AI Translation Nissaya

vihiṃsāya=from cruelty. ; vā=or from the anger that is the cause of cruelty. ; nissaṭo=is freed. ; ititasmā=because of that. ; avihiṃsāsaṅkappo=it is called the thought of non-cruelty. ;

Myanmar Nissaya

vihiṃsāya=ညှင်းဆဲခြင်းမှ။ ; vā=ညှင်းဆဲကြောင်းဖြစ်သော ဒေါသမှ။ ; nissaṭo=တနည်း။ ; ititasmā=ကြောင့်။ ; avihiṃsāsaṅkappo=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3093 | Chunk: 52

Tattha nekkhammavitakko kāmavitakkassa padaghātaṃ padacchedaṃ karonto uppajjati, abyāpādavitakko byāpādavitakkassa, avihiṃsāvitakko vihiṃsāvitakkassa.

AI Translation based on Nissaya

Therein, the thought of renunciation arises while destroying and cutting off the cause of sensual thought; the thought of non-ill will arises while destroying and cutting off the cause of the thought of ill will; and the thought of non-cruelty arises while destroying and cutting off the cause of the thought of cruelty.

Vietnamese AI Translation

Trong đó, tư duy xuất ly sanh khởi trong khi tiêu diệt và cắt đứt nguyên nhân của tư duy dục; tư duy vô sân sanh khởi trong khi tiêu diệt và cắt đứt nguyên nhân của tư duy sân; và tư duy vô hại sanh khởi trong khi tiêu diệt và cắt đứt nguyên nhân của tư duy hại.

AI Translation Nissaya

tattha=Among those three thoughts. ; nekkhampavitakko=the thought of renunciation. ; kāmavitakkassa=of the thought of sensuality. ; padaghātaṃ=the destruction of the cause. ; padacchedaṃ=the cutting off of the cause. ; karonto=performing. ; hutvā=having been. ; uppajjati=arises. ; abyāpādavitakko=the thought of non-ill will. ; byāpādavitakkassa=of the thought of ill will. ; padaghātaṃ=the destruction of the cause. ; padacchedaṃ=the cutting off of the cause. ; karonto=performing. ; hutvā=having been. ; uppajjati=arises. ; avihiṃsāvitakko=the thought of non-cruelty. ; vihiṃsāvitakkassa=of the thought of cruelty. ; padaghātaṃ=the destruction of the cause. ; padacchedaṃ=the cutting off of the cause. ; karonto=performing. ; hutvā=having been. ; uppajjati=arises. ;

Myanmar Nissaya

tattha=ထိုသုံးပါးသော သင်္ကပ္ပတို့တွင်။ ; nekkhampavitakko=သည်။ ; kāmavitakkassa=၏။ ; padaghātaṃ=အကြောင်းကို သတ်ခြင်းကို။ ; padacchedaṃ=အကြောင်းကို ဖြတ်ခြင်းကို။ ; karonto=ပြုသည်။ ; hutvā=၍။ ; uppajjati=၏။ ; abyāpādavitakko=သည်။ ; byāpādavitakkassa=၏။ ; padaghātaṃ=ကို။ ; padacchedaṃ=ကို။ ; karonto=သည်။ ; hutvā=၍။ ; uppajjati=၏။ ; avihiṃsāvitakko=သည်။ ; vihiṃsāvitakkassa=၏။ ; padaghātaṃ=ကို။ ; padacchedaṃ=ကို။ ; karonto=သည်။ ; hutvā=၍။ ; uppajjati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3094 | Chunk: 52

Tathā nekkhammaabyāpādaavihiṃsāvitakkā kāmabyāpādavihiṃsāvitakkānaṃ paccanīkā hutvā uppajjanti.

AI Translation based on Nissaya

Thus, the thoughts of renunciation, non-ill will, and non-cruelty arise as opposites to the thoughts of sensuality, ill will, and cruelty.

Vietnamese AI Translation

Như vậy, các tư duy xuất ly, vô sân, và vô hại sanh khởi như những cái đối nghịch với các tư duy dục, sân, và hại.

AI Translation Nissaya

tathā=Thus. ; nekkhammaa‌byāpādaavihiṃsāvitakkā=the thoughts of renunciation, non-ill will, and non-cruelty. ; kāmabyāpāda vihiṃsāvitakkānaṃ=of the thoughts of sensuality, ill will, and cruelty. ; paccanīkā=as opposites. ; hutvā=having become. ; uppajjanti=arise. ;

Myanmar Nissaya

tathā=ပါး။ ; nekkhammaa‌byāpādaavihiṃsāvitakkā=တို့သည်။ ; kāmabyāpāda vihiṃsāvitakkānaṃ=ကာမ ဝိတက် ဗျာပါဒဝိတက် ဝိဟိံသာဝိတက်တို့၏။ ; paccanīkā=ဆန့်ကျင်ဘက်တို့သည်။ ; hutvā=၍။ ; uppajjanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3095 | Chunk: 52

Tattha yogāvacaro kāmavitakkassa padaghātanatthaṃ kāmavitakkaṃ vā sammasati aññaṃ vā pana kiñci saṅkhāraṃ.

AI Translation based on Nissaya

Therein, for the sake of destroying the cause of sensual thought, the practitioner contemplates sensual thought itself or some other conditioned phenomenon by reflecting on its characteristics.

Vietnamese AI Translation

Trong đó, vì mục đích tiêu diệt nguyên nhân của tư duy dục, hành giả quán chiếu chính tư duy dục hoặc một pháp hữu vi khác bằng cách quán chiếu các đặc tính của nó.

AI Translation Nissaya

tattha=In that destruction and cutting off of the cause. ; yogāvacaro=the person practicing meditation. ; kāmavitakkassa=of sensual thought. ; padaghātanatthaṃ=for the sake of destroying the cause. ; kāmavitakkaṃvā=sensual thought itself. ; sammasati=contemplates by bringing it to the characteristics. ; pana=alternatively. ; aññaṃ=another. ; kiñci=some. ; saṅkhāraṃvā=conditioned phenomenon. ; sammasati=contemplates. ;

Myanmar Nissaya

tattha=ထိုအကြောင်းကို သတ်ခြင်း အကြောင်းကို ဖြတ်ခြင်း၌။ ; yogāvacaro=ပုဂ္ဂိုလ်သည်။ ; kāmavitakkassa=၏။ ; padaghātanatthaṃ=အကြောင်းကို သတ်ခြင်းငှါ။ ; kāmavitakkaṃvā=ကိုလည်း။ ; sammasati=လက္ခဏာရေးသို့တင်၍ သုံးသပ်၏။ ; pana=ပါး။ ; aññaṃ=သော။ ; kiñci=ကုန်သော။ ; saṅkhāraṃvā=ကိုလည်း။ ; sammasati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3096 | Chunk: 52

Athassa vipassanākkhaṇe vipassanāsampayutto saṅkappo tadaṅgavasena kāmavitakkassa padaghātaṃ padacchedaṃ karonto uppajjati, vipassanaṃ ussukkāpetvā maggaṃ pāpeti.

AI Translation based on Nissaya

Then, at the moment of insight, the thought associated with insight arises, destroying and cutting off the cause of sensual thought by way of momentary suppression; having intensified insight, one attains the path.

Vietnamese AI Translation

Sau đó, vào sát-na tuệ quán, tư duy đồng sanh với tuệ quán sanh khởi, tiêu diệt và cắt đứt nguyên nhân của tư duy dục bằng cách tạm thời trấn áp; sau khi đã tăng cường tuệ quán, người ta chứng đạt đạo.

Myanmar Nissaya

athassa=Then for him. ; vipassanākkhaṇe=at the moment of insight. ; vipassanāsampayutto=the thought associated with insight. ; saṅkappo=the thought. ; tadaṅgavasena=by means of momentary suppression. ; kāmavitakkassa=of sensual thought. ; padaghātaṃ=the destruction of the cause. ; padacchedaṃ=the cutting off of the cause. ; karonto=while performing. ; uppajjati=arises. ; vipassanaṃ=insight. ; ussukkāpetvā=having intensified. ; maggaṃ=the path. ; pāpeti=one reaches. ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3097 | Chunk: 52

Athassa maggakkhaṇe maggasampayutto saṅkappo samucchedavasena kāmavitakkassa padaghātaṃ padacchedaṃ karonto uppajjati.

AI Translation based on Nissaya

Then, at the moment of the path, the thought associated with the path arises, destroying and cutting off the cause of sensual thought by way of eradication.

Vietnamese AI Translation

Sau đó, vào sát-na đạo, tư duy đồng sanh với đạo sanh khởi, tiêu diệt và cắt đứt nguyên nhân của tư duy dục bằng cách nhổ tận gốc.

AI Translation Nissaya

athassa=Then for that person. ; maggakkhaṇe=at the moment of the path. ; maggasampayutto=the thought associated with the path. ; saṅkappo=thought. ; samucchedavasena=by way of eradication. ; kāmavitakkassa=of sensual thought. ; padaghātaṃ=the destruction of the cause. ; padacchedaṃ=the cutting off of the cause. ; karonto=while performing. ; uppajjati=arises. ;

Myanmar Nissaya

athasmiṃ kāle=၌။ ; assa=ပုဂ္ဂိုလ်အား။ ; vipassanākkhaṇe=ဝိပဿနာခဏ၌။ ; vipassanāsampayutto=နှင့်ယှဉ်သော။ ; saṅkappo=ဝိတက်သည်။ ; vadaṅgavasena=တဒင်္ဂပဟာန်၏ အစွမ်းဖြင့်။ ; kāmavitakkassa=၏။ ; padaghātaṃ=ကို။ ; padacchedaṃ=ကို။ ; karonto=သည်။ ; hutvā=၍။ ; uppajjati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3098 | Chunk: 52

Byāpādavitakkassapi padaghātanatthaṃ byāpādavitakkaṃ vā aññaṃ vā [V1.141] saṅkhāraṃ, vihiṃsāvitakkassa padaghātanatthaṃ vihiṃsāvitakkaṃ vā aññaṃ vā saṅkhāraṃ sammasati.

AI Translation based on Nissaya

For the sake of destroying the cause of the thought of ill will as well, one contemplates the thought of ill will itself or another conditioned phenomenon. For destroying the cause of the thought of cruelty, one contemplates the thought of cruelty itself or another conditioned phenomenon.

Vietnamese AI Translation

Cũng vì mục đích tiêu diệt nguyên nhân của tư duy sân, người ta quán chiếu chính tư duy sân hoặc một pháp hữu vi khác. Để tiêu diệt nguyên nhân của tư duy hại, người ta quán chiếu chính tư duy hại hoặc một pháp hữu vi khác.

AI Translation Nissaya

byāpādavitakkassapi=Of the thought of ill will as well. ; padaghātanatthaṃ=for the sake of destroying the cause. ; byāpādavitakkaṃvā=the thought of ill will itself, or. ; aññaṃ=another. ; saṅkhāraṃvā=conditioned phenomenon. ; sammasati=one contemplates. ; vihiṃsāvitakkassa=Of the thought of cruelty. ; padaghātanatthaṃ=for destroying the cause. ; vihiṃsavitakkaṃvā=the thought of cruelty itself, or. ; aññaṃ=another. ; saṅkhāraṃvā=conditioned phenomenon. ; sammasati=one contemplates. ;

Myanmar Nissaya

byāpādavitakkassapi=၏လည်း။ ; padaghātanatthaṃ=ငှါ။ ; byāpādavitakkaṃvā=ကိုလည်းကောင်း။ ; aññaṃ=သော။ ; saṅkhāraṃvā=ကိုလည်းကောင်း။ ; sammasati=၏။ ; vihiṃsāvitakkassa=၏။ ; padaghātanatthaṃ=ကို။ ; vihiṃsavitakkaṃvā=ကိုလည်းကောင်း။ ; aññaṃ=သော။ ; saṅkhāraṃvā=ကိုလည်းကောင်း။ ; sammasati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3099 | Chunk: 52

Athassa vipassanākkhaṇeti sabbaṃ purimanayeneva yojetabbaṃ.

AI Translation based on Nissaya

Everything from 'Then, at the moment of insight...' should be connected in the same way as the preceding method.

Vietnamese AI Translation

Tất cả từ 'Sau đó, vào sát-na tuệ quán...' nên được liên kết theo cùng một cách như phương pháp trước đó.

AI Translation Nissaya

atha tasmiṃkāle=At that time. ; assa=for him. ; vipassanākkhaṇe=at the moment of insight. ; itiādi=and so on. ; sabbaṃ=all the words. ; purimanayeneva=should be connected with the preceding method. ; yojetabbaṃ=should be connected. ;

Myanmar Nissaya

atha tasmiṃkāle=၌။ ; assa=အား။ ; vipassanākkhaṇe=၌။ ; itiādi=ဤသို့ အစရှိသော။ ; sabbaṃ=အလုံးစုံသော စကားကို။ ; purimanayeneva=သာလျှင်။ ; yojetabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3100 | Chunk: 52

Kāmavitakkādīnaṃ [M1.154] pana tiṇṇampi pāḷiyaṃ vibhattesu aṭṭhatiṃsārammaṇesu ekakammaṭṭhānampi apaccanīkaṃ nāma natthi.

AI Translation based on Nissaya

To speak of the opponents: among the thirty-eight objects enumerated in the Dhammasaṅgaṇī Pāli, there is not a single meditation object that is not an opponent to these three thoughts, beginning with sensual thought.

Vietnamese AI Translation

Nói về các đối trị: trong số ba mươi tám đối tượng được liệt kê trong Tạng Pháp (Dhammasaṅgaṇī Pāli), không có một đề mục thiền nào mà không phải là đối trị với ba tư duy này, bắt đầu với tư duy dục.

AI Translation Nissaya

pana=To speak of the opposite. ; kāmavitakkādīnaṃ=of the three thoughts, beginning with sensual thought. ; tiṇṇampi=of these three thoughts as well. ; pāḷiyaṃ=in the Dhammasaṅgaṇī Pāli. ; vibhattesu=among the divided. ; aṭṭhatiṃ sārammaṇesu=thirty-eight objects, excluding space and light. ; ekakammaṭṭhānampi=even a single meditation object. ; apaccanikaṃnāma=called 'not an opponent'. ; natthi=does not exist. ;

Myanmar Nissaya

pana=ဆန့်ကျင်ဘက် ဖြစ်သည်ကိုဆိုအံ့။ ; kāmavitakkādīnaṃ=အစရှိကုန်သော။ ; tiṇṇampi=သုံးပါးသော ဝိတက်တို့၏လည်း။ ; pāḷiyaṃ=ဓမ္မသင်္ဂဏီပါဠိ၌။ ; vibhattesu=ကုန်သော။ ; aṭṭhatiṃ sārammaṇesu=အာကာသ အာလောကသည် ကြဉ်အပ်ကုန်သော သုံးဆယ့်ရှစ်ပါးသော အာရုံတို့တွင်။ ; ekakammaṭṭhānampi=တစ်ပါးသော ကမ္မဋ္ဌာန်းမျှသည်လည်း။ ; apaccanikaṃnāma=မဆန့်ကျင်သောမည်သည်။ ; natthi=မရှိ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3101 | Chunk: 52

Ekantato pana kāmavitakkassa tāva asubhesu paṭhamajjhānameva paccanīkaṃ, byāpādavitakkassa mettāya tikacatukkajjhānāni, vihiṃsaāvitakkassa karuṇāya tikacatukkajjhānāni.

AI Translation based on Nissaya

To be specific about the opponents: firstly, the first jhana in the meditation on foulness is definitely the opponent of sensual thought. The jhanas of the threefold and fourfold systems in loving-kindness meditation are the opponents of the thought of ill will. The jhanas of the threefold and fourfold systems in compassion meditation are the opponents of the thought of cruelty.

Vietnamese AI Translation

Cụ thể về các đối trị: thứ nhất, thiền chi thứ nhất trong thiền đề mục bất tịnh chắc chắn là đối trị của tư duy dục. Các thiền của hệ thống ba và bốn tầng trong thiền tâm từ là đối trị của tư duy sân. Các thiền của hệ thống ba và bốn tầng trong thiền tâm bi là đối trị của tư duy hại.

AI Translation Nissaya

pana=To speak specifically of the opponent. ; ekantato=definitely. ; tāva=firstly. ; asubhesu=in the meditation on foulness. ; pavattaṃ=that which occurs. ; paṭhamajjhānameva=the first jhana itself. ; kāmavitakkassa=of sensual thought. ; paccanīkaṃ=is the opponent. ; mettāya=in loving-kindness meditation. ; pavattāni=that which occurs. ; tikacatukkajjhānāni=the jhanas of the threefold and fourfold systems. ; byāpādavitakkassa=of the thought of ill will. ; paccanikāni=are the opponents. ; karuṇāya=in compassion meditation. ; pavattāni=that which occurs. ; tika catukkajjhānāni=the jhanas of the threefold and fourfold systems. ; vihiṃsā vitakkassa=of the thought of cruelty. ; paccanīkāni=are the opponents. ;

Myanmar Nissaya

pana=ဝိသေသအားဖြင့် ဆန့်ကျင်သည်ကိုဆိုအံ့။ ; ekantato=အားဖြင့်။ ; tāva=စွာ။ ; asubhesu=အသုဘကမ္မဋ္ဌာန်းတို့၌။ ; pavattaṃ=သော။ ; paṭhamajjhānameva=သည်သာလျှင်။ ; kāmavitakkassa=၏။ ; paccanīkaṃ=ဆန့်ကျင်ဘက်တည်း။ ; mettāya=၌။ ; pavattāni=ကုန်သော။ ; tikacatukkajjhānāni=တိရဈာန် စတုက္ကဈာန်တို့သည်။ ; byāpādavitakkassa=၏။ ; paccanikāni=တို့တည်း။ ; karuṇāya=၌။ ; pavattāni=ကုန်သော။ ; tika catukkajjhānāni=တို့သည်။ ; vihiṃsā vitakkassa=၏။ ; paccanīkāni=တို့တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3102 | Chunk: 52

Tasmā asubhaparikammaṃ katvā jhānaṃ samāpannassa samāpattikkhaṇe jhānasampayutto vitakko vikkhambhanavasena kāmavitakkassa paccanīko hutvā uppajjati, jhānaṃ pādakaṃ katvā vipassanaṃ paṭṭhapentassa vipassanākkhaṇe vipassanāsampayutto saṅkappo tadaṅgavasena kāmavitakkassa paccanīko hutvā uppajjati, vipassanaṃ ussukkāpetvā maggaṃ pāpentassa maggakkhaṇe maggasampayutto saṅkappo samucchedavasena kāmavitakkassa paccanīko hutvā uppajjati.

AI Translation based on Nissaya

Therefore, it should be understood thus: For one who has done the preliminary practice on foulness and attained jhāna, at the moment of attainment the thought associated with jhāna arises as an opponent to sensual thought by way of suppression. For one who makes that jhāna the basis and establishes insight, at the moment of insight the thought associated with insight arises as an opponent to sensual thought by way of momentary suppression. For one who has intensified insight and reaches the path, at the moment of the path the thought associated with the path arises as an opponent to sensual thought by way of eradication.

Vietnamese AI Translation

Do đó, nên hiểu như sau: Đối với người đã thực hành sơ khởi về bất tịnh và chứng đắc thiền, vào sát-na chứng đắc, tư duy đồng sanh với thiền sanh khởi như một đối trị với tư duy dục bằng cách trấn áp. Đối với người lấy thiền đó làm cơ sở và thiết lập tuệ quán, vào sát-na tuệ quán, tư duy đồng sanh với tuệ quán sanh khởi như một đối trị với tư duy dục bằng cách tạm thời trấn áp. Đối với người đã tăng cường tuệ quán và đạt đến đạo, vào sát-na đạo, tư duy đồng sanh với đạo sanh khởi như một đối trị với tư duy dục bằng cách nhổ tận gốc.

AI Translation Nissaya

tasmā=Therefore. ; asubhaparikammaṃ=the preliminary work of contemplating on foulness. ; katvā=having done. ; jhānaṃ=the first jhana that is attained. ; samāpannassa=for one who has attained. ; samāpattikkhaṇe=at the moment of attainment. ; jhānasampayutto=associated with jhana. ; vitakko=thought. ; vikkhambhanavasena=by way of suppression. ; kāmavitakkassa=of sensual thought. ; paccanīko=as an opponent. ; hutvā=having become. ; uppajjati=arises. ; jhānaṃ=the jhana. ; pādakaṃ=the basis. ; katvā=having made. ; vipassanaṃ=insight. ; paṭṭhapentassa=for the person who establishes. ; vipassanakkhaṇe=at the moment of insight. ; vipassanāsampayutto=associated with insight. ; saṅkappo=thought. ; tadaṅgavasena=by way of momentary suppression. ; kāmavitakkassa=of sensual thought. ; paccanīko=as an opponent. ; hutvā=having become. ; uppajjati=arises. ; vipassanaṃ=insight. ; ussukkāpetvā=having intensified. ; maggaṃ=to the path. ; pāpentassa=for the person who attains. ; maggakkhaṇe=at the moment of the path. ; maggasampayutto=associated with the path. ; saṅkappo=thought. ; samucchedavasena=by way of eradication. ; kāmavitakkassa=of sensual thought. ; paccanīko=as an opponent. ; hutvā=having become. ; vuccati=is said to arise. ; iti=thus. ; veditabbo=it should be understood. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; asubhaparikammaṃ=အသုဘကမ္မဋ္ဌာန်း၌ စီးဖြန်းသော ပရိကံကို။ ; katvā=ပြု၍။ ; jhānaṃ=ရသော ပဌမဈာန်ကို။ ; samāpannassa=အား။ ; samāpattikkhaṇe=သမာပတ်ခဏ၌။ ; jhānasampayutto=သော။ ; vitakko=သည်။ ; vikkhambhanavasena=ဖြင့်။ ; kāmavitakkassa=၏။ ; paccanīko=သည်။ ; hutvā=၍။ ; uppajjati=၏။ ; jhānaṃ=ကို။ ; pādakaṃ=အခြေကို။ ; katvā=၍။ ; vipassanaṃ=ကို။ ; paṭṭhapentassa=ပုဂ္ဂိုလ်အား။ ; vipassanakkhaṇe=၌။ ; vipassanāsampayutto=‌သော။ ; saṅkappo=သည်။ ; tadaṅgavasena=ဖြင့်။ ; kāmavitakkassa=၏။ ; paccanīko=သည်။ ; hutvā=၍။ ; uppajjati=၏။ ; vipassanaṃ=ကို။ ; ussukkāpetvā=၍။ ; maggaṃ=သို့။ ; pāpentassa=ပုဂ္ဂိုလ်အား။ ; maggakkhaṇe=၌။ ; maggasampayutto=သော။ ; saṅkappo=သည်။ ; samucchedavasena=ဖြင့်။ ; kāmavitakkassa=၏။ ; paccanīko=သည်။ ; hutvā=၍။ ; vuccati=၏။ ; iti=သို့။ ; veditabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3103 | Chunk: 52

Mettāya [P1.167] pana parikammaṃ katvā, karuṇāya parikammaṃ katvā jhānaṃ samāpannassāti sabbaṃ purimanayeneva yojetabbaṃ.

AI Translation based on Nissaya

To speak of the thoughts of non-ill will and non-cruelty, everything from 'having done the preliminary work in loving-kindness,' and 'having done the preliminary work in compassion and attained jhāna...' should be connected in the same way as the preceding method.

Vietnamese AI Translation

Nói về các tư duy vô sân và vô hại, tất cả từ 'đã thực hiện công việc sơ khởi về tâm từ,' và 'đã thực hiện công việc sơ khởi về tâm bi và chứng đắc thiền...' nên được liên kết theo cùng một cách như phương pháp trước đó.

AI Translation Nissaya

pana=To speak of the thoughts of non-ill will and non-cruelty. ; mettāya=in loving-kindness. ; parikammaṃ=the preliminary work. ; katvā=having done. ; karuṇāya=in compassion. ; parikammaṃ=the preliminary work. ; katvā=having done. ; jhānaṃ=jhāna. ; samāpannassa=for the person who has attained. ; iti=thus. ; sabbaṃ=everything. ; purimanayeneva=should be connected with the preceding method. ; yojetabbaṃ=should be connected. ;

Myanmar Nissaya

pana=အဗျာပါဒဝိဟိံသာသင်္ကပ္ပကိုဆိုအံ့။ ; mettāya=၌။ ; parikammaṃ=ကို။ ; katvā=၍။ ; karuṇāya=၌။ ; parikammaṃ=ကို။ ; katvā=၍။ ; jhānaṃ=ကို။ ; samāpannassa=ပုဂ္ဂိုလ်အား။ ; iti=သို့။ ; sabbaṃ=အလုံးစုံသော စကားကို။ ; purimanayeneva=လျှင်။ ; yojetabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3104 | Chunk: 52

Evaṃ uppanno abyāpādasaṅkappoti vuccati, avihiṃsāsaṅkappoti vuccatīti veditabbo.

AI Translation based on Nissaya

It should be understood that in this way, the arisen thought is called 'the thought of non-ill will' and 'the thought of non-cruelty.'

Vietnamese AI Translation

Nên hiểu rằng theo cách này, tư duy đã sanh khởi được gọi là 'tư duy vô sân' và 'tư duy vô hại.'

AI Translation Nissaya

evaṃ=In the manner thus described. ; uppanno=the arisen thought. ; abyāpādasaṅkappoti=is called the thought of non-ill will. ; vuccati=is said. ; avihiṃsāsaṅkappoti=is called the thought of non-cruelty. ; vuccati=is said. ; iti=thus. ; veditabbo=it should be understood. ;

Myanmar Nissaya

evaṃ=ဤသို့ ဆိုအပ်ပြီးသော နည်းဖြင့်။ ; uppanno=ဖြစ်သော ဝိတက်ကို။ ; abyāpādasaṅkappoti=ဟူ၍။ ; vuccati=၏။ ; avihiṃsāsaṅkappoti=ဟူ၍။ ; vuccati=၏။ ; iti=သို့။ ; veditabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3105 | Chunk: 52

Evamete nekkhammasaṅkappādayo vipassanājhānavasena uppattīnaṃ nānattā pubbabhāge nānā, maggakkhaṇe pana imesu tīsu ṭhānesu uppannassa akusalasaṅkappassa padacchedato anuppattisādhanavasena maggaṅgaṃ pūrayamāno ekova kusalasaṅkappo uppajjati.

AI Translation based on Nissaya

Thus, these thoughts of renunciation and so on, due to the diversity of their arising by the power of insight-jhāna, are various in the preliminary stage. However, at the moment of the path, by cutting off the cause of the unwholesome thought that has arisen in these three instances and ensuring its non-re-arising, only one single wholesome thought arises, fulfilling the path factor.

Vietnamese AI Translation

Như vậy, các tư duy xuất ly v.v. này, do sự đa dạng của sự sanh khởi của chúng nhờ sức mạnh của tuệ quán-thiền, là khác nhau trong giai đoạn sơ khởi. Tuy nhiên, vào sát-na đạo, bằng cách cắt đứt nguyên nhân của tư duy bất thiện đã sanh khởi trong ba trường hợp này và đảm bảo nó không sanh khởi trở lại, chỉ một tư duy thiện duy nhất sanh khởi, hoàn thành chi đạo.

AI Translation Nissaya

evaṃ=In the manner thus described. ; ete nekkhammasaṅkappādayo=these thoughts of renunciation and so on. ; vipassanājhānavasena=by the power of insight-jhana. ; uppattīnaṃ=of their arisings. ; nānattā=due to the diversity. ; pubbabhāge=in the preliminary stage of the path. ; nānā=are various. ; honti=they are. ; pana=however, to speak of their being unified. ; maggakkhaṇe=at the moment of the path. ; tīsiu့=in these three. ; imesuṭhānesu=in these instances called sensuality, ill will, and cruelty. ; uppannassa=of the arisen. ; akusalasaṅkappassa=of the unwholesome thought. ; padacchedato=by cutting off the cause. ; anuppattisādhanavasena=by the power of ensuring non-re-arising. ; maggaṅgaṃ=the path factor. ; pūrayamāno=fulfilling. ; hutvā=having been. ; ekova=one single. ; kusalasaṅkappo=wholesome thought. ; uppajjati=arises. ;

Myanmar Nissaya

evaṃ=ဤသို့ဆိုအပ်ပြီးသောနည်းဖြင့်။ ; ete nekkhammasaṅkappādayo=တို့သည်။ ; vipassanājhānavasena=ဝိပဿနာဈာန်၏ အစွမ်းဖြင့်။ ; uppattīnaṃ=ဖြစ်ခြင်းတို့၏။ ; nānattā=အဖြစ်ကြောင့်။ ; pubbabhāge=မဂ်၏ ရှေ့အဖို့၌။ ; nānā=အသီးသီး။ ; honti=ကုန်၏။ ; pana=တပေါင်းတည်း ဖြစ်သည်ကို ဆိုအံ့။ ; maggakkhaṇe=၌။ ; tīsiu့=ကုန်သော။ ; imesuṭhānesu=ဤကာမဗျာပါဒ ဝိဟိံသာဟု ဆိုအပ် မသာ အရာတို့၌။ ; uppannassa=သော။ ; akusalasaṅkappassa=အကုသလဝိတက်၏။ ; padacchedato=အကြောင်းကို ဖြတ်သောအားဖြင့်။ ; anuppattisādhanavasena=တဖန် မဖြစ်ခြင်းကို ပြီးစေသည်၏ အစွမ်းဖြင့်။ ; maggaṅgaṃ=မဂ်ကို။ ; pūrayamāno=ပြည့်စေသည်။ ; hutvā=၍။ ; ekova=တစ်ခုတည်းသာလျှင် ဖြစ်သော။ ; kusalasaṅkappo=သည်။ ; uppajjati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3106 | Chunk: 52

Ayaṃ sammāsaṅkappo nāma.

AI Translation based on Nissaya

This is called Right Thought.

Vietnamese AI Translation

Đây được gọi là Chánh Tư Duy.

AI Translation Nissaya

ayaṃ=This thought. ; sammāsaṅkapponāma=is called Right Thought. ;

Myanmar Nissaya

ayaṃ=ဤဝိတက်သည်။ ; sammāsaṅkapponāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3107 | Chunk: 52

Sammāvācāniddesepi yasmā aññeneva cittena musāvādā viramati, aññena aññena pisuṇāvācādīhi, tasmā catassopetā veramaṇiyo pubbabhāge nānā, maggakkhaṇe pana micchāvācāsaṅkhātāya catubbidhāya akusaladussīlyacetanāya padacchedato anuppattisādhanavasena maggaṅgaṃ pūrayamānā ekāva sammāvācāsaṅkhātā kusalaveramaṇi uppajjati.

AI Translation based on Nissaya

In the exposition of Right Speech as well: because one abstains from false speech with one mind, and from the other three—slanderous speech and so on—with other minds, these four abstinences are various in the preliminary stage. However, at the moment of the path, by cutting off the cause of the fourfold unwholesome intention called wrong speech and ensuring its non-re-arising, only one single wholesome abstinence, called Right Speech, arises, fulfilling the path factor.

Vietnamese AI Translation

Trong phần giải thích về Chánh Ngữ cũng vậy: vì người ta từ bỏ lời nói dối với một tâm, và từ bỏ ba cái còn lại—lời nói đâm thọc v.v.—với các tâm khác, nên bốn sự từ bỏ này là khác nhau trong giai đoạn sơ khởi. Tuy nhiên, vào sát-na đạo, bằng cách cắt đứt nguyên nhân của tác ý bất thiện tứ chi được gọi là tà ngữ và đảm bảo nó không sanh khởi trở lại, chỉ một sự từ bỏ thiện duy nhất, được gọi là Chánh Ngữ, sanh khởi, hoàn thành chi đạo.

AI Translation Nissaya

sammāvācāniddesepi=In the exposition of Right Speech as well. ; yasmā=because. ; aññeneva=with a different. ; cittena=mind. ; musāvādā=from false speech. ; viramati=one abstains. ; aññena aññena=with different and different. ; cittena=minds. ; pisuṇāvācādīhi=from the three beginning with slanderous speech. ; viramati=one abstains. ; tasmā=therefore. ; catassopi=all four. ; etā veramaṇiyo=these abstinences from the four kinds of verbal misconduct. ; pubbabhāge=in the preliminary stage of the path. ; nānā=are various. ; honti=they are. ; pana=however, to speak of their being unified. ; maggakkhaṇe=at the moment of the path. ; micchāvācāsaṅkhātāya=called wrong speech. ; catubbidhāya=of four kinds. ; akusaladussīlyacetanāya=of the unwholesome intention that is immorality. ; padacchedato=by cutting off the cause. ; anuppattisādhanavasena=by the power of ensuring non-re-arising. ; maggaṅgaṃ=the path factor. ; pūrayamānā=fulfilling. ; hutvā=having been. ; ekāva=one single. ; sammāvācāsaṅkhātā=called right speech. ; kusalaveramaṇi=the wholesome abstinence associated with the supramundane wholesome. ; uppajjati=arises. ;

Myanmar Nissaya

sammāvācāniddesepi=၌လည်း။ ; yasmā=ကြောင့်။ ; aññeneva=တပါးသာလျှင်ဖြစ်သော။ ; cittena=ဖြင့်။ ; musāvādā=မှ။ ; viramati=ကြဉ်၏။ ; aññena aññena=တပါး တပါးသော။ ; cittena=ဖြင့်။ ; pisuṇāvācādīhi=အစရှိသော သုံးပါးတို့မှ။ ; viramati=၏။ ; tasmā=ကြောင့်။ ; catassopi=ကုန်သော။ ; etā veramaṇiyo=ဤဝစီဒုစရိုက်လေးပါးမှ ကြဉ်ခြင်းတို့သည်။ ; pubbabhāge=မဂ်၏ ရှေ့အဖို့၌။ ; nānā=အသီးအသီ။ ; honti=ကုန်၏။ ; pana=တပေါင်းတည်း ဖြစ်သည်ကို ဆိုအံ့။ ; maggakkhaṇe=၌။ ; micchāvācāsaṅkhātāya=ဟုဆိုအပ်သော။ ; catubbidhāya=သော။ ; akusaladussīlya cetanāya=အကုသိုလ်ဟု ဆိုအပ်သော သီလမရှိသော သူ၏ အဖြစ်တည်းဟူသော စေတနာ၏။ ; padacchedato=အကြောင်းကို ဖြတ်သော အားဖြင့်။ ; anuppattisādhanavasena=တဖန်မဖြစ်ခြင်းကို ပြီးစေသည်၏ အစွမ်းဖြင့်။ ; maggaṅgaṃ=ကို။ ; pūrayamānā=ပြည့်စေသည်။ ; hutvā=၍။ ; ekāva=တပါးတည်းသာလျှင်ဖြစ်သော။ ; sammāvācāsaṅkhātā=ဟု ဆိုအပ်သော။ ; kusalaveramaṇi=လောကုတ္တရာကုသိုလ်နှင့် ယှဉ်သော ဝိရတီသည်။ ; uppajjati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3108 | Chunk: 52

Ayaṃ sammāvācā nāma.

AI Translation based on Nissaya

This is called Right Speech.

Vietnamese AI Translation

Đây được gọi là Chánh Ngữ.

AI Translation Nissaya

ayaṃ=This. ; sammāvācā nāma=is called Right Speech. ;

Myanmar Nissaya

ayaṃ=သည်။ ; sammāvācā nāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3109 | Chunk: 52

Sammākammantaniddesepi yasmā aññeneva cittena pāṇātipātā viramati, aññena adinnādānā, aññena micchācārā, tasmā tissopetā veramaṇiyo pubbabhāge nānā, maggakkhaṇe pana micchākammantasaṅkhātāya tividhāya akusaladussīlyacetanāya padacchedato anuppattisādhanavasena maggaṅgaṃ pūrayamānā ekāva sammākammantasaṅkhātā kusalaveramaṇi uppajjati.

AI Translation based on Nissaya

In the exposition of Right Action as well: because one abstains from killing living beings with one mind, from taking what is not given with another, and from sexual misconduct with another, these three abstinences are various in the preliminary stage. However, at the moment of the path, by cutting off the cause of the threefold unwholesome immoral intention called wrong action and ensuring its non-re-arising, only one single wholesome abstinence, called Right Action, arises, fulfilling the path factor.

Vietnamese AI Translation

Trong phần giải thích về Chánh Nghiệp cũng vậy: vì người ta từ bỏ sát sanh với một tâm, từ bỏ trộm cắp với một tâm khác, và từ bỏ tà dâm với một tâm khác, nên ba sự từ bỏ này là khác nhau trong giai đoạn sơ khởi. Tuy nhiên, vào sát-na đạo, bằng cách cắt đứt nguyên nhân của tác ý bất thiện ba chi được gọi là tà nghiệp và đảm bảo nó không sanh khởi trở lại, chỉ một sự từ bỏ thiện duy nhất, được gọi là Chánh Nghiệp, sanh khởi, hoàn thành chi đạo.

AI Translation Nissaya

sammākammantaniddesepi=In the exposition of Right Action as well. ; yasmā=because. ; aññeneva=with a different. ; cittena=mind. ; pāṇātipātā=from killing living beings. ; viramati=one abstains. ; aññena=with another. ; cittena=mind. ; adinnādānā=from taking what is not given. ; viramati=one abstains. ; aññena=with another. ; cittena=mind. ; micchācārā=from sexual misconduct. ; viramati=one abstains. ; tasmā=therefore. ; tissopi=all three. ; etāveramaṇito=these abstinences from the three kinds of bodily misconduct. ; pubbabhāge=in the preliminary stage of the path. ; nānā=are various. ; honti=they are. ; pana=however, to speak of their being unified. ; maggakkhaṇe=at the moment of the path. ; micchākammantasaṅkhātāya=called wrong action. ; tividhāya=of three kinds. ; akusaladussīlyacetanāya=of the unwholesome immoral intention. ; padacchedato=by cutting off the cause. ; anuppattisādhanavasena=by means of ensuring non-re-arising. ; maggaṅgaṃ=the path factor. ; pūrayamānā=fulfilling. ; hutvā=having been. ; ekāva=one single. ; sammākammantasaṅkhātā=called right action. ; kusalaveramaṇi=the wholesome abstinence associated with the supramundane wholesome. ; uppajjati=arises. ;

Myanmar Nissaya

sammākammantaniddesepi=၌လည်း။ ; yasmā=ကြောင့်။ ; aññeneva=တပါးသာလျှင် ဖြစ်သော။ ; cittena=ဖြင့်။ ; pāṇātipātā=မှ။ ; viramati=၏။ ; aññena=သော။ ; cittena=ဖြင့်။ ; adinnādānā=မှ။ ; viramati=၏။ ; aññena=သော။ ; cittena=ဖြင့်။ ; micchācārā=မှ။ ; viramati=၏။ ; tasmā=ကြောင့်။ ; tissopi=ကုန်သော။ ; etāveramaṇito=ဤကာယဒုစရိုက်သုံးပါးမှ ကြဉ်ခြင်းတို့သည်။ ; pubbabhāge=မဂ်၏ ရှေ့။ ; nānā=အသီးအသီ။ ; honti=ကုန်၏။ ; pana=တပေါင်းတည်း ဖြစ်သည်ကို ဆိုအံ့။ ; maggakkhaṇe=၌။ ; micchākammantasaṅkhātāya=သော။ ; tividhāya=သော။ ; akusaladussīlyacetanāya=အကုသိုလ်ဟု ဆိုအပ်သော ဒုဿီလစေတနာ၏။ ; padacchedato=အကြောင်းကို ဖြတ်သောအားဖြင့်။ ; anuppattisādhanavasena=ဖြင့်။ ; maggaṅgaṃ=ကို။ ; pūrayamānā=သည်။ ; hutvā=၍။ ; ekāva=တပါးတည်းသာလျှင်ဖြစ်သော။ ; sammākammantasaṅkhātā=သော။ ; kusalaveramaṇi=လောကုတ္တရာ ကုသိုလ်နှင့် ယှဉ်သော ဝိရန္တီသည်။ ; uppajjati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3110 | Chunk: 52

Ayaṃ sammākammanto nāma.

AI Translation based on Nissaya

This is called Right Action.

Vietnamese AI Translation

Đây được gọi là Chánh Nghiệp.

AI Translation Nissaya

ayaṃ=This. ; sammākammantonāma=is called Right Action. ;

Myanmar Nissaya

ayaṃ=သည်။ ; sammākammantonāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3111 | Chunk: 52

Sammāājīvaniddese [M1.155 V1.142] idhāti imasmiṃ sāsane.

AI Translation based on Nissaya

In the exposition of Right Livelihood [M1.155 V1.142], 'here' means in this teaching.

Vietnamese AI Translation

Trong phần giải thích về Chánh Mạng [M1.155 V1.142], 'ở đây' nghĩa là trong giáo pháp này.

AI Translation Nissaya

sammāājīvaniddese=In the exposition of Right Livelihood. ; idhāti=the word 'idha' means. ; imasmiṃ sāsane=in this teaching. ;

Myanmar Nissaya

sammāājīvaniddese=၌။ ; idhāti=ကား။ ; imasmiṃ sāsane=၌။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3112 | Chunk: 52

Ariyasāvakoti ariyassa buddhassa sāvako.

AI Translation based on Nissaya

'A noble disciple' is a disciple of the Noble Buddha.

Vietnamese AI Translation

'Một đệ tử cao quý' là một đệ tử của Đức Phật Cao Quý.

AI Translation Nissaya

ariyasāvakoti=the term 'noble disciple' means. ; ariyassa=of the Noble. ; buddhassa=Buddha. ; sāvako=a disciple who is a noble person in training or a virtuous worldling. ;

Myanmar Nissaya

ariyasāvakoti=ကား။ ; ariyassa=အရိယဖြစ်တော်မူသော။ ; buddhassa=၏။ ; sāvako=သေက္ခကလျာဏပုထုဇဉ်ဖြစ်သော တပည့်သည်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3113 | Chunk: 52

Micchāājīvaṃ pahāyāti pāpakaṃ ājīvaṃ pajahitvā.

AI Translation based on Nissaya

'Having abandoned wrong livelihood' means having given up an evil livelihood.

Vietnamese AI Translation

'Đã từ bỏ tà mạng' nghĩa là đã từ bỏ một mạng sống xấu xa.

AI Translation Nissaya

micchāājīvaṃ pahāyāti=the phrase 'having abandoned wrong livelihood' means. ; pāpakaṃ=evil. ; ājīvaṃ=livelihood. ; pajahitvā=having abandoned. ;

Myanmar Nissaya

micchāājīvaṃ pahāyāti=ကား။ ; pāpakaṃ=ယုတ်မာစွာသော။ ; ājīvaṃ=အသက်မွေးခြင်းကို။ ; pajahitvā=ပယ်၍။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3114 | Chunk: 52

Sammāājīvenāti buddhappasatthena kusalaājīvena.

AI Translation based on Nissaya

'With right livelihood' means with a blameless livelihood praised by the Buddha.

Vietnamese AI Translation

'Với chánh mạng' nghĩa là với một mạng sống không có lỗi được Đức Phật tán thán.

AI Translation Nissaya

sammāājīvenāti=the phrase 'with right livelihood' means. ; buddhappasatthena=praised by the Buddha. ; kusalaājīvena=with a blameless livelihood. ;

Myanmar Nissaya

sammāājīvenāti=ကား။ ; buddhappasatthena=မြတ်စွာဘုရားသည် ချိီးမွမ်းတော်မူအပ်သော။ ; kusalaājīvena=အပြစ်မရှိသော အသက်မွေးခြင်းဖြင့်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3115 | Chunk: 52

Jīvikaṃ kappetīti jīvitappavattiṃ pavatteti.

AI Translation based on Nissaya

'Maintains one's life' means one keeps the process of life going.

Vietnamese AI Translation

'Duy trì mạng sống của mình' nghĩa là người ta giữ cho tiến trình mạng sống tiếp diễn.

AI Translation Nissaya

jīvitaṃ kappeti=the phrase 'maintains one's life' means. ; jīvitappavattiṃ=the continuity of life. ; pavatteti=causes to proceed. ;

Myanmar Nissaya

jīvitaṃ kappeti=ကား။ ; jīvitappavattiṃ=အသက်၏ အဖြစ်ကို။ ; pavatteti=ဖြစ်စေ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3116 | Chunk: 52

Idhāpi yasmā aññeneva cittena kāyadvāravītikkamā viramati, aññeneva vacīdvāravītikkamā, tasmā pubbabhāge nānākkhaṇesu uppajjati, maggakkhaṇe pana dvīsu dvāresu sattannaṃ kammapathānaṃ vasena uppannāya micchāājīvadussīlyacetanāya padacchedato anuppattisādhanavasena maggaṅgaṃ pūrayamānā ekāva sammāājīvasaṅkhātā kusalaveramaṇi uppajjati.

AI Translation based on Nissaya

Here too, because one abstains from transgression at the body-door with one mind, and from transgression at the speech-door with another, it arises at various moments in the preliminary stage. However, at the moment of the path, by cutting off the cause of the immoral intention called wrong livelihood—which has arisen through the seven courses of action in the two doors—and by ensuring its non-re-arising, only one single wholesome abstinence, called Right Livelihood, arises, fulfilling the path factor.

Vietnamese AI Translation

Ở đây cũng vậy, vì người ta từ bỏ sự vi phạm ở thân môn với một tâm, và từ bỏ sự vi phạm ở ngữ môn với một tâm khác, nên nó sanh khởi vào những sát-na khác nhau trong giai đoạn sơ khởi. Tuy nhiên, vào sát-na đạo, bằng cách cắt đứt nguyên nhân của tác ý bất thiện được gọi là tà mạng—đã sanh khởi thông qua bảy đạo lộ hành động ở hai môn—và bằng cách đảm bảo nó không sanh khởi trở lại, chỉ một sự từ bỏ thiện duy nhất, được gọi là Chánh Mạng, sanh khởi, hoàn thành chi đạo.

AI Translation Nissaya

idhāpi=In this exposition of Right Livelihood as well. ; yasmā=because. ; aññeneva=with a different. ; cittena=mind. ; kāyadvāravītakkamā=from transgression at the body-door. ; viramati=one abstains. ; aññeneva=with a different. ; cittena=mind. ; vacīdvāravitakkamā=from transgression at the speech-door. ; viramati=one abstains. ; tasmā=therefore. ; pubbabhāge=in the preliminary stage. ; nānākkhaṇesu=at various mind-moments. ; uppajjati=it arises. ; pana=however, to speak of their being unified. ; maggakkhaṇe=at the moment of the path. ; dvīsu=in the two. ; dvāresu=doors of body and speech. ; pavattānaṃ=occurring. ; sattannaṃ=of the seven. ; kammapathānaṃ=courses of action, namely three of body and four of speech. ; vasena=by means of. ; uppannāya=arisen. ; micchāājīvadussīlyacetanāya=of the immoral intention called wrong livelihood. ; padacchedato=by cutting off the cause. ; anuppattisādhanavasena=by the power of ensuring non-re-arising. ; maggaṅgaṃ=the path factor. ; pūrayamānā=fulfilling. ; hutvā=having been. ; ekāva=one single. ; sammāājīvasaṅkhātā=called right livelihood. ; kusalaveramaṇi=the wholesome abstinence associated with the supramundane wholesome. ; uppajjati=arises. ;

Myanmar Nissaya

idhāpi=ဤသမ္မာအာဇီဝနိဒ္ဒေသ၌လည်း။ ; yasmā=ကြောင့်။ ; aññeneva=သော။ ; cittena=ဖြင့်။ ; kāyadvāravītakkamā=ကာယဒွါရ၌ ဖြစ်သော လွန်ကျူးခြင်းမှ။ ; viramati=ကြဉ်၏။ ; aññeneva=သော။ ; cittena=ဖြင့်။ ; vacīdvāravitakkamā=မှ။ ; viramati=၏။ ; tasmā=ကြောင့်။ ; pubbabhāge=၌။ ; nānākkhaṇesu=အထူးထူးသော စိတ္တက္ခဏတို့၌။ ; uppajjati=၏။ ; pana=တပေါင်းတည်းဖြစ်သည်ကို ဆိုအံ့။ ; maggakkhaṇe=၌။ ; dvīsu=ကုန်သော။ ; dvāresu=ကာယဒွါရ ဝစီဒွါရတို့၌။ ; pavattānaṃ=ကုန်သော။ ; sattannaṃ=ကုန်သော။ ; kammapathānaṃ=ကာယကံသုံးပါး ဝစီကံလေးပါးတည်း‌ဟူသောကမ္မပထတို့၏။ ; vasena=ဖြင့်။ ; uppannāya=ဖြစ်သော။ ; micchāājīvadussīlyacetanāya=မိစ္ဆာအာဇီဝဟု ဆိုအပ်သော ဒုဿီလစေတနာ၏။ ; padacchedato=အားဖြင့်။ ; anuppattisādhanavasena=အစွမ်းဖြင့်။ ; maggaṅgaṃ=ကို။ ; pūrayamānā=သည်။ ; hutvā=၍။ ; ekāva=သော။ ; sammāājīvasaṅkhātā=သော။ ; kusalaveramaṇi=လောကုတ္တရာကုသိုလ်နှင့် ယှဉ်သော ဝိရန္တီသည်။ ; uppajjati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3117 | Chunk: 52

Ayaṃ sammāājīvo nāma.

AI Translation based on Nissaya

This is called Right Livelihood.

Vietnamese AI Translation

Đây được gọi là Chánh Mạng.

AI Translation Nissaya

ayaṃ=This abstinence. ; sammāājīvonāma=is called Right Livelihood. ;

Myanmar Nissaya

ayaṃ=ဤဝိရတီသည်။ ; sammāājīvonāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3118 | Chunk: 52

Sammāvāyāmaniddese idha bhikkhūti imasmiṃ sāsane paṭipannako [P1.168] bhikkhu.

AI Translation based on Nissaya

In the exposition of Right Effort, 'here, a bhikkhu' means a bhikkhu in this teaching who is practicing or endowed with the practice.

Vietnamese AI Translation

Trong phần giải thích về Chánh Tinh Tấn, 'ở đây, một tỳ khưu' nghĩa là một tỳ khưu trong giáo pháp này đang thực hành hoặc đầy đủ sự thực hành.

AI Translation Nissaya

sammāvāyāmaniddese=In the exposition of Right Effort. ; idha bhikkhūti=the phrase 'here, a bhikkhu' means. ; imasmiṃ sāsane=in this teaching. ; paṭipannako=one who practices. ; vā=or is endowed with the practice. ; bhikkhu=a bhikkhu. ;

Myanmar Nissaya

sammāvāyāmaniddese=၌။ ; idha bhikkhūti=ကား။ ; imasmiṃ sāsane=၌။ ; paṭipannako=ကျင့်တတ်သော။ ; vā=ကျင့်ခြင်းနှင့်ယှဉ်သော။ ; bhikkhu=သည်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3119 | Chunk: 52

Anuppannānan ti anibbattānaṃ.

AI Translation based on Nissaya

'Unarisen' means not yet brought into being.

Vietnamese AI Translation

'Chưa sanh' nghĩa là chưa được đưa vào sự hiện hữu.

AI Translation Nissaya

anuppannānanti=the word 'unarisen' means. ; anibbattānaṃ=not yet arisen. ;

Myanmar Nissaya

anuppannānanti=ကား။ ; anibbattānaṃ=သေးသော။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3120 | Chunk: 52

Pāpakānan ti lāmakānaṃ.

AI Translation based on Nissaya

'Evil' means base.

Vietnamese AI Translation

'Ác' nghĩa là thấp hèn.

AI Translation Nissaya

pāpakānanti=the word 'evil' means. ; lāmakānaṃ=base. ;

Myanmar Nissaya

pāpakānanti=ကား။ ; lāmakānaṃ=ကုန်သော။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3121 | Chunk: 52

Akusalānaṃ dhammānan ti akosallasambhūtānaṃ dhammānaṃ.

AI Translation based on Nissaya

'Unwholesome states' means states that arise from the unwholesome condition of being unskillful.

Vietnamese AI Translation

'Các pháp bất thiện' nghĩa là các pháp sanh khởi từ điều kiện bất thiện của việc không khéo léo.

AI Translation Nissaya

akusalānaṃ dhammānanti=the phrase 'unwholesome states' means. ; akosallasambhūtānaṃ=arisen from the state of being unskillful, which is unwholesome. ; dhammānaṃ=states. ;

Myanmar Nissaya

akusalānaṃ dhammānanti=ကား။ ; akosallasambhūtānaṃ=မလိမ္မာသော သူ၏ အဖြစ်တည်းဟူသော အကုသိုလ်ကြောင့် ဖြစ်ကုန်သော။ ; dhammānaṃ=တို့ကို။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3122 | Chunk: 52

Anuppādāyāti na uppādanatthāya.

AI Translation based on Nissaya

'For the non-arising' means for the purpose of not causing them to arise.

Vietnamese AI Translation

'Vì sự không sanh khởi' nghĩa là vì mục đích không làm cho chúng sanh khởi.

AI Translation Nissaya

anuppādāyāti=the phrase 'for the non-arising' means. ; na uppādanatthāya=for the purpose of not causing to arise. ;

Myanmar Nissaya

anuppādāyāti=ကား။ ; na uppādanatthāya=မဖြစ်စေခြင်းငှါ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3123 | Chunk: 52

Chandaṃ janetīti kattukamyatāsaṅkhātaṃ kusalacchandaṃ janeti uppādeti.

AI Translation based on Nissaya

'Generates desire' means one generates or produces the wholesome desire which is called the wish to act.

Vietnamese AI Translation

'Phát sanh dục' nghĩa là người ta phát sanh hoặc tạo ra dục thiện được gọi là ý muốn hành động.

AI Translation Nissaya

chandaṃ janetīti=the phrase 'generates desire' means. ; kattukamyatāsaṅkhātaṃ=called the state of wishing to do. ; kusalacchanaṃ=wholesome desire. ; janeti uppādeti=generates, produces. ;

Myanmar Nissaya

chandaṃ janetīti=ကား။ ; kattukamyatāsaṅkhātaṃ=ပြုခြင်းငှါ အလိုရှိသည်၏ အဖြစ်ဟု ဆိုအပ်သော။ ; kusalacchanaṃ=ကို။ ; janeti uppādeti=တတ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3124 | Chunk: 52

Vāyamatīti payogaṃ janeti parakkamaṃ karoti.

AI Translation based on Nissaya

'Strives' means one generates strong effort, one makes great exertion.

Vietnamese AI Translation

'Tinh tấn' nghĩa là người ta phát sanh sự nỗ lực mạnh mẽ, người ta thực hiện sự tinh cần lớn lao.

AI Translation Nissaya

vāyamatīti=the word 'strives' means. ; payogaṃ=strong effort. ; janeti=one generates. ; parakkamaṃ=great exertion. ; karoti=one makes. ;

Myanmar Nissaya

vāyamatīti=ကား။ ; payogaṃ=အားကြီးသော ဝီရိယကို။ ; janeti=ဖြစ်စေ၏။ ; parakkamaṃ=လွန်စွာသော အားထုတ်ခြင်းကို။ ; karoti=ပြု၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3125 | Chunk: 52

Vīriyaṃ ārabhatīti kāyikaṃ cetasikaṃ vīriyaṃ karoti.

AI Translation based on Nissaya

'Arouses energy' means one produces bodily and mental energy.

Vietnamese AI Translation

'Khởi lên tinh tấn' nghĩa là người ta tạo ra năng lượng thân và tâm.

AI Translation Nissaya

vīriyaṃ ārabhatīti=the phrase 'arouses energy' means. ; kāyikaṃ=bodily. ; vīriyaṃ=energy. ; cetasikaṃ=mental. ; vīriyaṃ=energy. ; karoti=one makes. ;

Myanmar Nissaya

vīriyaṃ ārabhatīti=ကား။ ; kāyikaṃ=ကိုယ်၌ဖြစ်သော။ ; vīriyaṃ=ကို။ ; cetasikaṃ=ဖြစ်သော။ ; vīriyaṃ=ကို။ ; karoti=ပြု၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3126 | Chunk: 52

Cittaṃ paggaṇhātīti teneva sahajātavīriyena cittaṃ ukkhipati.

AI Translation based on Nissaya

'Exerts the mind' means one uplifts the mind with that very co-arisen energy.

Vietnamese AI Translation

'Hướng tâm' nghĩa là người ta nâng cao tâm với chính năng lượng đồng sanh đó.

AI Translation Nissaya

cittaṃ paggaṇhātīti=the phrase 'exerts the mind' means. ; teneva sahajātavīriyena=with that very co-arisen energy. ; tanaññaḥ=. ; teneva=with that very mind. ; sahajātavīriyena=with the co-arisen energy. ; cittaṃ=the mind. ; ukkhipati=one uplifts. ;

Myanmar Nissaya

cittaṃ paggaṇhātīti=ကား။ ; teneva sahajātavīriyena=ထိုစိတ်နှင့်တကွဖြစ်သော ဝီရိယနှင့်သာ လျှင်။ ; tanaññaḥ= ; teneva=ထိုစိတ်နှင့်သာလျှင်။ ; sahajātavīriyena=တကွဖြစ်သော ဝီရိယဖြင့်။ ; cittaṃ=ကို။ ; ukkhipati=ချီးမြှောက်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3127 | Chunk: 52

Padahatīti padhānavīriyaṃ karoti.

AI Translation based on Nissaya

'Strives' means one makes the effort of striving.

Vietnamese AI Translation

'Tinh cần' nghĩa là người ta thực hiện sự nỗ lực của sự tinh cần.

AI Translation Nissaya

padahatīti=the word 'strives' means. ; padhānavīriyaṃ=the effort of striving. ; karoti=one makes. ;

Myanmar Nissaya

padahatīti=ကား။ ; padhānavīriyaṃ=အားထုတ်ခြင်းကို။ ; karoti=ပြု၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3128 | Chunk: 52

Paṭipāṭiyā panetāni cattāripi padāni āsevanābhāvanābahulīkammasātaccakiriyāhi yojetabbāni.

AI Translation based on Nissaya

Furthermore, these four sequential terms—'strives,' 'arouses energy,' 'exerts the mind,' and 'strives'—should be connected with the actions of cultivating, developing, making much of, and acting with reverence.

Vietnamese AI Translation

Hơn nữa, bốn thuật ngữ tuần tự này—'tinh tấn,' 'khởi lên tinh tấn,' 'hướng tâm,' và 'tinh cần'—nên được liên kết với các hành động tu tập, phát triển, làm cho nhiều lên, và hành động với sự tôn kính.

AI Translation Nissaya

pana=To speak of a special point. ; paṭipāṭiyā=in sequence. ; cattāripi=all four. ; etāni padāni=of these terms: 'vāyamati' (strives), 'vīriyaṃ ārabhati' (arouses energy), 'cittaṃ paggaṇhāti' (exerts the mind), and 'padahati' (strives). ; āsevanā bhāvanābahulīkammasātaccakiriyāhi=with the actions of cultivating, developing, making much of, and acting with reverence. ; yojetabbāni=should be connected. ;

Myanmar Nissaya

pana=ဆိုဖွယ်အထူးကို ဆိုအံ့။ ; paṭipāṭiyā=အားဖြင့်။ ; cattāripi=ကုန်သော။ ; etāni padāni=ဝါယမတိ ဝီရိယံအာရဘတိ စိတ္တံပဂ္ဂဏှာတိ ပဒဟတိ ဟူသော ပုဒ်အစဉ်တို့ကို။ ; āsevanā bhāvanābahulīkammasātaccakiriyāhi=မှီဝဲခြင်း ပွားခြင်း အကြိမ်များစွာ အလေ့အလာပြုခြင်း အရိုအသေပြုခြင်းတို့ဖြင့်။ ; yojetabbāni=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3129 | Chunk: 52

Uppannānan ti anuppannānanti avattabbataṃ āpannānaṃ.

AI Translation based on Nissaya

'Arisen' means those states which have reached a point where they can no longer be called 'unarisen.'

Vietnamese AI Translation

'Đã sanh' nghĩa là những pháp đã đạt đến điểm mà chúng không còn có thể được gọi là 'chưa sanh' nữa.

AI Translation Nissaya

uppannānanti=the word 'arisen' means. ; anuppannānanti=as not yet arisen. ; avattabbataṃ=the state of being unable to be said. ; āppannānaṃ=which have reached. ;

Myanmar Nissaya

uppannānanti=ကား။ ; anuppannānanti=မဖြစ်ကုန်သေးဟူ၍။ ; avattabbataṃ=မဆိုအပ်သည်၏ အဖြစ်သို့။ ; āppannānaṃ=ကုန်သော။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3130 | Chunk: 52

Pahānāyāti pajahanatthāya.

AI Translation based on Nissaya

'For the abandoning' means for the purpose of abandoning.

Vietnamese AI Translation

'Vì sự từ bỏ' nghĩa là vì mục đích từ bỏ.

AI Translation Nissaya

pahānāyāti=the phrase 'for the abandoning' means. ; pajahanatthāya=for the purpose of abandoning. ;

Myanmar Nissaya

pahānāyāti=ကား။ ; pajahanatthāya=ငှါ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3131 | Chunk: 52

Anuppannānaṃ kusalānaṃ dhammānan ti anibbattānaṃ kosallasambhūtānaṃ dhammānaṃ.

AI Translation based on Nissaya

'Unarisen wholesome states' means states that arise from the wholesome condition of being skillful, which have not yet arisen.

Vietnamese AI Translation

'Các pháp thiện chưa sanh' nghĩa là các pháp sanh khởi từ điều kiện thiện của việc khéo léo, mà chưa sanh khởi.

AI Translation Nissaya

anuppannānaṃ kusalā naṃ dhammānanti=the phrase 'unarisen wholesome states' means. ; anibbattānaṃ=not yet arisen. ; kosallasambhūtānaṃ=arisen from the state of being skillful, which is wholesome. ; dhammānaṃ=states. ;

Myanmar Nissaya

anuppannānaṃ kusalā naṃ dhammānanti=ကား။ ; anibbattānaṃ=ကုန်သေးသော။ ; kosallasambhūtānaṃ=လိမ္မာသော သူ၏ အဖြစ်တည်းဟူသော ကုသိုလ်ကြောင့်ဖြစ်ကုန်သော။ ; dhammānaṃ=တို့ကို။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3132 | Chunk: 52

Uppādāyāti uppādanatthāya.

AI Translation based on Nissaya

'For the arising' means for the purpose of causing to arise.

Vietnamese AI Translation

'Vì sự sanh khởi' nghĩa là vì mục đích làm cho sanh khởi.

AI Translation Nissaya

uppādāyāti=the phrase 'for the arising' means. ; uppādanatthāya=for the purpose of causing to arise. ;

Myanmar Nissaya

uppādāyāti=ကား။ ; uppādanatthāya=ဖြစ်စေခြင်းငှါ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3133 | Chunk: 52

Uppannānan ti nibbattānaṃ.

AI Translation based on Nissaya

'Arisen' means already arisen.

Vietnamese AI Translation

'Đã sanh' nghĩa là đã sanh khởi rồi.

AI Translation Nissaya

uppannānanti=the word 'arisen' means. ; nibbattānaṃ=already arisen. ;

Myanmar Nissaya

uppannānanti=ကား။ ; nibbattānaṃ=ကုန်ပြီးသော။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3134 | Chunk: 52

Ṭhitiyāti ṭhitatthāya.

AI Translation based on Nissaya

'For the maintenance' means for the purpose of being established.

Vietnamese AI Translation

'Để duy trì' nghĩa là vì mục đích được thiết lập.

AI Translation Nissaya

ṭhitiyāti=the phrase 'for the maintenance' means. ; ṭhitatthāya=for the purpose of being established. ;

Myanmar Nissaya

ṭhitiyāti=ကား။ ; ṭhitatthāya=ငှါ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3135 | Chunk: 52

Asammosāyāti anassanatthaṃ.

AI Translation based on Nissaya

'For the non-confusion' means for the purpose of not perishing.

Vietnamese AI Translation

'Vì sự không lộn xộn' nghĩa là vì mục đích không hoại diệt.

AI Translation Nissaya

asammosāyāti=the phrase 'for the non-confusion' means. ; anassanatthaṃ=for the purpose of not perishing. ;

Myanmar Nissaya

asammosāyāti=ကား။ ; anassanatthaṃ=မပျောက်ပျက်ခြင်းငှါ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3136 | Chunk: 52

Bhiyyobhāvāyāti punappunaṃ bhāvāya.

AI Translation based on Nissaya

'For the increase' means for the purpose of becoming again and again.

Vietnamese AI Translation

'Vì sự gia tăng' nghĩa là vì mục đích trở thành hết lần này đến lần khác.

AI Translation Nissaya

bhiyyobhāvāyāti=the phrase 'for the increase' means. ; punuppunaṃ=again and again. ; bhāvāya=for the being/becoming. ;

Myanmar Nissaya

bhiyyobhāvāyāti=ကား။ ; punuppunaṃ=လဲလဲ။ ; bhāvāya=ခြင်းငှါ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3137 | Chunk: 52

Vepullāyāti vipulabhāvāya.

AI Translation based on Nissaya

'For the abundance' means for the purpose of becoming abundant.

Vietnamese AI Translation

'Vì sự phong phú' nghĩa là vì mục đích trở nên phong phú.

AI Translation Nissaya

vepullāyāti=the phrase 'for the abundance' means. ; vipulabhāvāya=for the purpose of being abundant. ;

Myanmar Nissaya

vepullāyāti=ကား။ ; vipulabhāvāya=ပြန့်ပြောသည်၏ အဖြစ်ငှါ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3138 | Chunk: 52

Bhāvanāyāti vaḍḍhiyā.

AI Translation based on Nissaya

'For the development' means for the purpose of growth.

Vietnamese AI Translation

'Vì sự phát triển' nghĩa là vì mục đích tăng trưởng.

AI Translation Nissaya

bhāvanāyāti=the phrase 'for the development' means. ; vaḍḍhiyā=for the purpose of growth. ;

Myanmar Nissaya

bhāvanāyāti=ကား။ ; vaḍḍhiyā=ပွားခြင်းငှါ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3139 | Chunk: 52

Pāripūriyāti paripūraṇatthāya.

AI Translation based on Nissaya

'For the fulfillment' means for the purpose of becoming complete.

Vietnamese AI Translation

'Vì sự hoàn thành' nghĩa là vì mục đích trở nên trọn vẹn.

AI Translation Nissaya

pāripūriyāti=the phrase 'for the fulfillment' means. ; paripūranatthāya=for the purpose of being complete. ;

Myanmar Nissaya

pāripūriyāti=ကား။ ; paripūranatthāya=ပြည့်စုံခြင်းငှါ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3140 | Chunk: 52

Ete pana sammāvāyāmasaṅkhātā cattāro sammappadhānā pubbabhāge lokiyā, maggakkhaṇe lokuttarā.

AI Translation based on Nissaya

These four right exertions, called Right Effort, are mundane in the preliminary stage of the path; at the moment of the path, they are supramundane.

Vietnamese AI Translation

Bốn chánh cần này, được gọi là Chánh Tinh Tấn, là thế gian trong giai đoạn sơ khởi của đạo; vào sát-na đạo, chúng là siêu thế.

AI Translation Nissaya

pana=To speak of the whole, apart from the parts. ; sammāvāyāmasaṅkhātā=called Right Effort. ; cattāro=the four. ; etesammappadhānā=these right exertions. ; pubbabhāge=in the preliminary stage of the path. ; lokiyā=are mundane. ; maggakkhaṇe=at the moment of the path. ; lokuttarā=are supramundane. ;

Myanmar Nissaya

pana=အဝယဝတ္ထမှ တပါး ပိဏ္ဍတ္ထကိုဆိုအံ့။ ; sammāvāyāmasaṅkhātā=သမ္မာဝါယာမဟု ဆိုအပ်ကုန်သော။ ; cattāro=ကုန်သော။ ; etesammappadhānā=တို့သည်။ ; pubbabhāge=မဂ်၏ ရှေ့အဖို့၌။ ; lokiyā=တို့တည်း။ ; maggakkhaṇe=၌။ ; lokuttarā=တို့တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3141 | Chunk: 52

Maggakkhaṇe pana ekameva vīriyaṃ catukiccasādhanavasena cattāri nāmāni labhati.

AI Translation based on Nissaya

However, at the moment of the path, one single effort itself obtains four names by the power of accomplishing four functions.

Vietnamese AI Translation

Tuy nhiên, vào sát-na đạo, một tinh tấn duy nhất tự nó có bốn tên gọi nhờ sức mạnh của việc hoàn thành bốn phận sự.

AI Translation Nissaya

pana=To speak of a special point. ; maggakkhaṇe=at the moment of the path. ; ekamevavīriyaṃ=one single effort itself. ; catukiccabhādhānavasena=by the power of accomplishing four functions. ; cattāri=four. ; nāmāni=names. ; labhati=obtains. ;

Myanmar Nissaya

pana=အထူးကို ဆိုအံ့။ ; maggakkhaṇe=၌။ ; ekamevavīriyaṃ=တခုသော ဝီရိယသည်ပင်လျှင်။ ; catukiccabhādhānavasena=အစွမ်းဖြင့်။ ; cattāri=ကုန်သော။ ; nāmāni=တို့ကို။ ; labhati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3142 | Chunk: 52

Tattha lokiyā kassapasaṃyutte vuttanayeneva veditabbā.

AI Translation based on Nissaya

Among them, the mundane ones should be understood according to the method spoken of in the Kassapa Saṃyutta.

Vietnamese AI Translation

Trong số đó, những cái thế gian nên được hiểu theo phương pháp đã nói trong Tương Ưng Kassapa.

AI Translation Nissaya

tattha=Among them, the mundane right exertions. ; kassapasaṃyutte=in the Kassapa Saṃyutta. ; vuttanayeneva=should be understood by the method spoken of. ; veditabbāni=should be understood. ;

Myanmar Nissaya

tattha=ထိုလောကီသမ္မပ္ပဓာန်တို့ကို။ ; kassapasaṃyutte=၌။ ; vuttanayeneva=သာလျှင်။ ; veditabbāni=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3143 | Chunk: 52

Vuttañhi tattha –

AI Translation based on Nissaya

Indeed, it is said in the Kassapa Saṃyutta:

Vietnamese AI Translation

Thật vậy, nó được nói trong Tương Ưng Kassapa:

AI Translation Nissaya

hi saccaṃ=Indeed. ; tattha=in that Kassapa Saṃyutta. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; tattha=ထိုကဿပသံယုတ်၌။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3144 | Chunk: 52

‘‘Cattārome [M1.156], āvuso, sammappadhānā;

AI Translation based on Nissaya

''Friend, these are the four right exertions.

Vietnamese AI Translation

''Này Hiền hữu, đây là bốn chánh cần.

AI Translation Nissaya

cattārome āvuso.la.=Friend, these are the four... ;

Myanmar Nissaya

cattārome āvuso.la.= ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3145 | Chunk: 52

Idhāvuso, bhikkhu ‘ anuppannā me pāpakā akusalā dhammā uppajjamānā anatthāya [V1.143] saṃvatteyyun ’ ti ātappaṃ karoti, ‘ uppannā me pāpakā akusalā dhammā appahīyamānā anatthāya saṃvatteyyun ’ ti ātappaṃ karoti, ‘ anuppannā me kusalā dhammā anuppajjamānā anatthāya saṃvatteyyun ’ ti ātappaṃ karoti, ‘ uppannā me kusalā dhammā nirujjhamānā anatthāya saṃvatteyyun ’ ti ātappaṃ karotī’’ ti ( saṃ. ni. 2.145);

AI Translation based on Nissaya

Here, friend, a bhikkhu generates effort thinking, 'May unarisen evil, unwholesome states, if they were to arise, lead to my harm.' He generates effort thinking, 'May arisen evil, unwholesome states, if they are not abandoned, lead to my harm.' He generates effort thinking, 'May unarisen wholesome states, if they do not arise, lead to my harm.' He generates effort thinking, 'May arisen wholesome states, if they were to cease, lead to my harm.' '' (saṃ. ni. 2.145);

Vietnamese AI Translation

Ở đây, này Hiền hữu, một tỳ khưu phát sanh tinh tấn, nghĩ rằng: 'Nguyện cho các pháp bất thiện ác chưa sanh, nếu chúng sanh khởi, sẽ dẫn đến sự tổn hại cho ta.' Ông ấy phát sanh tinh tấn, nghĩ rằng: 'Nguyện cho các pháp bất thiện ác đã sanh, nếu chúng không được từ bỏ, sẽ dẫn đến sự tổn hại cho ta.' Ông ấy phát sanh tinh tấn, nghĩ rằng: 'Nguyện cho các pháp thiện chưa sanh, nếu chúng không sanh khởi, sẽ dẫn đến sự tổn hại cho ta.' Ông ấy phát sanh tinh tấn, nghĩ rằng: 'Nguyện cho các pháp thiện đã sanh, nếu chúng hoại diệt, sẽ dẫn đến sự tổn hại cho ta.' '' (saṃ. ni. 2.145);

AI Translation Nissaya

ātappaṃ karotīti=he makes an effort. ; vuttaṃ=was said. ; āvuso=Friend Kassapa. ; sammappadhānā=right exertions. ; ime cattāro=are these four. ; ettāro=What are these four? ; katame=Which four? ; āvuso=Friend Kassapa. ; idha=here. ; bhikkhu=a bhikkhu. ; me=for me. ; anuppannā=unarisen. ; pāpakā=evil. ; akusalā=unwholesome. ; dhammā=states. ; uppajjamānā=if they arise. ; anatthāya=for harm. ; saṃvatteyyuṃ=would lead. ; iti=thus reflecting. ; ātappaṃ=effort. ; karoti=he makes. ; me=for me. ; uppannā=arisen. ; pāpakā=evil. ; akusalā=unwholesome. ; dhammā=states. ; appahīyamānā=if they are not abandoned. ; anatthāya=for harm. ; saṃvatteyyuṃ=would lead. ; iti=thus. ; ātappaṃ=effort. ; karoti=he makes. ; me=for me. ; anuppannā=unarisen. ; kusalā=wholesome. ; dhammā=states. ; anuppajjamānā=if they do not arise. ; anatthāya=for harm. ; saṃvatteyyuṃ=would lead. ; iti=thus reflecting. ; ātappaṃ=effort. ; karoti=he makes. ; me=for me. ; uppannā=arisen. ; kusalā=wholesome. ; dhammā=states. ; nirujjhamānā=if they cease. ; anatthāya=for harm. ; saṃvatteyyuṃ=would lead. ; iti=thus. ; ātappaṃ=effort. ; karoti=he makes. ; iti ime=These are they. ; (Note: This is a statement from Ven. Sāriputta to Ven. Mahākassapa). ;

Myanmar Nissaya

ātappaṃ karotīti=ဟူ၍။ ; vuttaṃ=၏။ ; āvuso=ငါ့ရှင် ကဿပ။ ; sammappadhānā=တို့သည်။ ; ime cattāro=တို့တည်း။ ; ettāro=တို့ဟူသည်။ ; katame=တို့နည်း။ ; āvuso=ကဿပ။ ; idha=၌။ ; bhikkhu=သည်။ ; me=ငါ့အား။ ; anuppannā=သေးသော။ ; pāpakā=ကုန်သော။ ; akusalā=ကုန်သော။ ; dhammā=တို့သည်။ ; uppajjamānā=ရှိသော်။ ; anatthāya=ဖြစ်ခြင်းငှါ။ ; saṃvatteyyuṃ=ကုန်ရာ၏။ ; iti=ဤသို့ နှလုံးပိုက်၍။ ; ātappaṃ=လုံ့လကို။ ; karoti=၏။ ; me=ငါ့အား။ ; uppannā=ကုန်ပြီးသော။ ; pāpakā=ကုန်သော။ ; akusalā=ကုန်သော။ ; dhammā=တို့သည်။ ; appahīyamānā=မပယ်အပ်ကုန်သည်ရှိသော်။ ; anatthāya=ဖြစ်ခြင်းငှါ။ ; saṃvatteyyuṃ=ကုန်ရာ၏။ ; iti=သို့။ ; ātappaṃ=ကို။ ; karoti=၏။ ; me=အား။ ; anuppannā=မဖြစ်ကုန်သေးသော။ ; kusalā=ဖြစ်ကုန်သော။ ; dhammā=တို့သည်။ ; anuppajjamānā=ရှိသော်။ ; anatthāya=ခြင်းငှါ။ ; saṃvatteyyuṃ=ကုန်ရာ၏။ ; iti=ဤသို့ နှလုံးပိုက်၍။ ; ātappaṃ=ကို။ ; karoti=၏။ ; me=အား။ ; uppannā=ဖြစ်ကုန်ပြီးသော။ ; kusalā=ကုန်သော။ ; dhammā=တို့သည်။ ; nirujjhamānā=သည်ရှိသော်။ ; anatthāya=ငှါ။ ; saṃvatteyyuṃ=ကုန်ရာ၏။ ; iti=၌။ ; ātappaṃ=ကို။ ; karoti=၏။ ; iti ime=ဤသည်တို့တည်း။ ; (ဣတိ- ကား ဂမျမာန်၊ ရှင်သာရိပုတ္တရာက အရှင်မဟာကဿပကို မေးသည့် စကား။) ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3146 | Chunk: 52

Tattha ca anuppannāti asamudācāravasena vā ananubhūtārammaṇavasena vā anuppannā.

AI Translation based on Nissaya

And there, 'unarisen' means unarisen either by way of not having occurred or by way of its object not having been experienced.

Vietnamese AI Translation

Và ở đó, 'chưa sanh' nghĩa là chưa sanh bằng cách chưa từng xảy ra hoặc bằng cách đối tượng của nó chưa được kinh nghiệm.

AI Translation Nissaya

ca=Furthermore. ; tattha=in that discourse on the varied right exertions. ; vā=or in that Kassapa Saṃyutta Pāli. ; anuppannāti=the word 'unarisen' means. ; asamudācāravasenavā=by way of not having occurred, and. ; ananubhūtārammaṇavasenavā=by way of the object not having been experienced. ; anuppannā=they are called unarisen. ;

Myanmar Nissaya

ca=ဆက်။ ; tattha=ထိုအပြားရှိသော သမ္မပ္ပဓာနကထာ၌။ ; vā=ထိုတဿပသံယုတ် ပါဠိ၌။ ; anuppannāti=ကား။ ; asamudācāravasenavā=မဖြစ်ဖူးသည်၏ အစွမ်းဖြင့် လည်းကောင်း။ ; ananubhūtārammaṇavasenavā=မခံစားဖူးသော အာရုံ၏ အစွမ်းအားဖြင့် လည်းကောင်း။ ; anuppannā=မည်ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3147 | Chunk: 52

Aññathā hi anamatagge saṃsāre anuppannā pāpakā akusalā dhammā nāma natthi, anuppannā pana uppajjamānāpi eteyeva uppajjanti, pahīyamānāpi eteyeva pahīyanti.

AI Translation based on Nissaya

Otherwise, in this saṃsāra with its unknowable beginning, there are no so-called evil, unwholesome states that have not arisen before. Indeed, even when 'unarisen' states arise, it is just those very states that arise; even when they are abandoned, it is just those very states that are abandoned.

Vietnamese AI Translation

Nói cách khác, trong vòng luân hồi này với khởi điểm không thể biết được, không có cái gọi là các pháp bất thiện ác mà chưa từng sanh khởi trước đây. Thật vậy, ngay cả khi các pháp 'chưa sanh' sanh khởi, chính những pháp đó sanh khởi; ngay cả khi chúng bị từ bỏ, chính những pháp đó bị từ bỏ.

AI Translation Nissaya

hi=To speak of the contrary. ; aññakā=If the meaning is taken in another way. ; atthe=the meaning. ; gayhamāne=if it is taken. ; anamatagge=with an unknown beginning. ; vā=or with no knowable beginning. ; saṃsāre=in saṃsāra. ; anuppannā=unarisen. ; pāpakā=evil. ; akusalā=unwholesome. ; dhammānāma=states. ; natthi nasanti=do not exist. ; pana=Indeed. ; anuppannā=unarisen unwholesome states. ; uppajjamānāpi=even when they arise. ; eteyeva=are just those same unwholesome states that have arisen in the course of saṃsāra. ; uppajjanti=they arise. ; pahīyamānāpi=even when they are abandoned. ; eteyeva=it is just those same unwholesome states that have arisen in the course of saṃsāra. ; pahīyanti=that are abandoned. ;

Myanmar Nissaya

hi=ဗျတိရေကကိို ဆိုအံ့။ ; aññakā=ဆိုအပ်ပြီးသည်မှ တပါးသော အခြင်းအရာအားဖြင့်။ ; atthe=အနက်ကို။ ; gayhamāne=သော်။ ; anamatagge=မသိအပ်သော အစရှိသော။ ; vā=သိအပ်သော အစမရှိသော။ ; saṃsāre=၌။ ; anuppannā=မဖြစ်ကုန်သော။ ; pāpakā=ကုန်သော။ ; akusalā=ကုန်သော။ ; dhammānāma=တရားတို့မည်သည်။ ; natthi nasanti=ကုန်။ ; pana=စင်စစ်သော်ကား။ ; anuppannā=မဖြစ်ကုန်သေးသော အကုသိုလ်တရားတို့သည်။ ; uppajjamānāpi=ဖြစ်ကုန်သော်လည်း။ ; eteyeva=ထိုသံသရာအစဉ်၌ ဖြစ်ထူးသော အကုသိုလ်တရားတို့သည်သာလျှင်။ ; uppajjanti=ကုန်၏။ ; pahīyamānāpi=ပယ်အပ်ကုန်သော်လည်း။ ; eteyeva=ထိုသံသရာအစဉ်၌ ဖြစ်ဖူးသော အကုသိုလ် တို့ကိုသာလျှင်။ ; pahīyanti=အပ်ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3148 | Chunk: 52

Tattha ekaccassa vattaganthadhutaṅgasamādhivipassanānavakammabhavānaṃ [P1.169] aññataravasena kilesā na samudācaranti.

AI Translation based on Nissaya

In that regard, for a certain person, due to one or another of these—observing duties, learning the scriptures, undertaking ascetic practices, developing concentration, practicing insight, performing new construction work, or being born in the Brahma realm—defilements do not occur.

Vietnamese AI Translation

Về vấn đề đó, đối với một người nào đó, do một hoặc một trong số này—hành trì bổn phận, học tập kinh điển, thực hành khổ hạnh, phát triển định, thực hành tuệ quán, thực hiện công việc xây dựng mới, hoặc được sanh trong cõi Phạm Thiên—các phiền não không phát sanh.

AI Translation Nissaya

tattha=Regarding those previously arisen unwholesome states and unexperienced objects. ; ekaccassa=for a certain person. ; vatthavantadhutaṅgasamādhivipassanānāvakammabhavānaṃ=among observing duties, learning the scriptures, undertaking ascetic practices, developing concentration, practicing insight, performing new construction work, and being born in the Brahma realm. ; aññataravasena=by the power of one or another of these. ; kilesā=defilements. ; nasamudācaranti=do not occur. ;

Myanmar Nissaya

tattha=ထိုဖြစ်ဖူးသော အကုသိုလ်, မခံစားဖူးသော အာရုံတို့၌။ ; ekaccassa=အချို့သော ပုဂ္ဂိုလ်အား။ ; vatthavantadhutaṅgasamādhivipassanānāvakammabhavānaṃ=ဝတ်ကို ကျင့်ခြင်း, ပရိယတ်ကို သင်ခြင်း, ဓူတင်ကို ဆောင်ခြင်း, သမာဓိကို ပွားခြင်း, ဝိပဿနာကို အားထုတ်ခြင်း, အမှုသစ်ကို ပြုခြင်း, ဗြဟ္မာ့ဘုံ၌ ဖြစ်ခြင်းတို့တွင်။ ; aññataravasena=တပါးပါး၏ အစွမ်းဖြင့်။ ; kilesā=တို့သည်။ ; nasamudācaranti=မဖြစ်ကုန်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3149 | Chunk: 52

Kathaṃ ?

AI Translation based on Nissaya

How so?

Vietnamese AI Translation

Tại sao vậy?

AI Translation Nissaya

kathaṃ na samudācaranti=How do they not occur? ;

Myanmar Nissaya

kathaṃ na samudācaranti=ကား။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3150 | Chunk: 52

Ekacco hi vattasampanno hoti, asīti khandhakavattāni cuddasa mahāvattāni cetiyaṅgaṇabodhiyaṅgaṇapānīyamāḷakauposathāgāraāgantukagamikavattāni ca karontasseva kilesā okāsaṃ na labhanti.

AI Translation based on Nissaya

For instance, a certain monk is accomplished in the observances. For a monk performing the eighty observances of the Khandhakas, the fourteen great observances, and the observances related to the stupa-yard, the Bodhi-tree yard, the water-pot stand, the Uposatha hall, visiting monks, and departing monks, defilements find no opportunity to arise.

Vietnamese AI Translation

Chẳng hạn, một tỳ khưu nào đó thành tựu trong các bổn phận. Đối với một tỳ khưu thực hiện tám mươi bổn phận của các Khandhaka, mười bốn đại bổn phận, và các bổn phận liên quan đến sân tháp, sân cây Bồ-đề, chỗ đặt bình nước, hội trường Uposatha, các tỳ khưu đến, và các tỳ khưu rời đi, các phiền não không tìm thấy cơ hội để sanh khởi.

AI Translation Nissaya

hi vitthāremi=I will explain in detail. ; ekacco=A certain monk. ; vattasampanno=is accomplished in the observances. ; hoti=is. ; asītikhandhakavattāni=the eighty observances of the Khandhakas, and. ; cuddasamahāvattāni=the fourteen great observances, and. ; cetiyaṅgaṇabodhiyaṅgaṇapānīyamāḷakauposathāgāraāgantukagamikavattānīca=the observances concerning the stupa-yard, the Bodhi-tree yard, the water-pot stand, the Uposatha hall, for visiting monks, and for departing monks. ; karontasseva=for the monk who performs these. ; kilesā=defilements. ; okāsaṃ=an opportunity to arise. ; nalabhanti=do not find. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; ekacco=အချို့သော ရဟန်းသည်။ ; vattasampanno=သည်။ ; hoti=၏။ ; asītikhandhakavattāni=ရှစ်ဆယ်သော ခန္ဓကဝတ်တို့ကိုလည်းကောင်း။ ; cuddasamahāvattāni=တဆယ့်လေးပါးသော ဝတ်ကြီးတို့ကို လည်းကောင်း။ ; cetiyaṅgaṇabodhiyaṅgaṇapānīyamāḷakauposathāgāraāgantukagamikavattānīca=စေတီ၌ ပြုရာသောဝတ်, ဗောဓိပင်၌ ပြုရာသော ဝတ်၊ ရေအိိုးစင်၌ ပြုရာသောဝတ်၊ ဥပုသ်အိမ်၌ ပြုရာသော ဝတ်၊ ဧသည့်သည်တို့၌ ပြုရာသောဝတ်၊ ခရီးသွားတို့၌ ပြုရာသော ဝတ်တို့ကို လည်းကောင်း။ ; karontasseva=ပြုသော ရဟန်းအားသာလျှင်။ ; kilesā=တို့သည်။ ; okāsaṃ=ဖြစ်ခြင်း၏ အခွင့်ကို။ ; nalabhanti=ကုန်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3151 | Chunk: 52

Aparabhāge panassa vattāni vissajjetvā bhinnavattassa carato ayonisomanasikāraṃ sativossaggañca āgamma uppajjanti.

AI Translation based on Nissaya

But later, if he neglects these observances and lives with his vows broken, they arise for him depending on improper attention and lapses of mindfulness.

Vietnamese AI Translation

Nhưng sau đó, nếu ông ấy sao nhãng các bổn phận này và sống với giới luật bị vi phạm, chúng sanh khởi cho ông ấy tùy thuộc vào sự tác ý không đúng đắn và sự lơ là niệm.

AI Translation Nissaya

pana=To speak of when they do get an opportunity. ; aparabhāge=Later on. ; vattāni=the duties to be performed. ; vissajjetvā=having neglected. ; carato=while living. ; bhinnavattassa=with broken observances. ; vā=or having broken the observances. ; assa=for that monk. ; ayonisomanasikāraṃ=improper attention, and. ; sativossaggañṇa=a lapse of mindfulness. ; vā=or. ; āgamma=depending on. ; vā=or having reached. ; uppajjanti=they arise. ;

Myanmar Nissaya

pana=ရသည်ကိုဆိုအံ့။ ; aparabhāge=၌။ ; vattāni=ပြုရာသော ဝတ်တို့ကို။ ; vissajjetvā=၍။ ; carato=ကျင့်သော။ ; bhinnavattassa=ပျက်သော ဝတ်ရှိသော။ ; vā=ဝတ်ကို ဖျက်သော။ ; assa=ထိုရဟန်းအား။ ; ayonisomanasikāraṃ=မသင့်သောအားဖြင့် နှထုံးသွင်းခြင်းကိုလည်းကောင်း။ ; sativossaggañṇa=သတိလွတ်ခင်းကို လည်းကောင်း။ ; vā=သို့လည်းကောင်း။ ; āgamma=စွဲ၍။ ; vā=ရောက်၍။ ; uppajjanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3152 | Chunk: 52

Evampi asamudācāravasena anuppannā uppajjanti nāma.

AI Translation based on Nissaya

In this way too, unwholesome states that were unarisen by way of not having occurred, are said to arise.

Vietnamese AI Translation

Theo cách này cũng vậy, các pháp bất thiện mà chưa sanh bằng cách chưa từng xảy ra, được nói là sanh khởi.

AI Translation Nissaya

evampi=In this way also. ; asamudācāravasena=by way of not having occurred. ; anuppannā=unarisen unwholesome states. ; uppajjanti nāma=are said to arise. ;

Myanmar Nissaya

evampi=ဤသို့လည်း။ ; asamudācāravasena=မဖြစ်ဖူးသည်၏အစွမ်းဖြင့်။ ; anuppannā=မဖြစ်ဖူးကုန်သော အကုသိုလ်တို့သည်။ ; uppajjanti nāma=မည်ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3153 | Chunk: 52

Ekacco ganthayutto hoti, ekampi nikāyaṃ gaṇhāti dvepi tayopi cattāropi pañcapi.

AI Translation based on Nissaya

A certain monk is devoted to the scriptures; he masters one Nikāya, or two, or three, or four, or five.

Vietnamese AI Translation

Một tỳ khưu nào đó chuyên tâm vào kinh điển; ông ấy tinh thông một Nikāya, hoặc hai, hoặc ba, hoặc bốn, hoặc năm.

AI Translation Nissaya

ekacco=A certain monk. ; ganthayutto=is devoted to the scriptures. ; hoti=is. ; ekampinikāyaṃ=one Nikāya. ; gaṇhāti=he learns. ; dvepi=two Nikāyas, or. ; tayopi=three, or. ; cattāropi=four, or. ; pañcapi=five. ; gaṇhāti=he learns. ;

Myanmar Nissaya

ekacco=ရဟန်းသည်။ ; ganthayutto=ပရိယတ်ကို အားထုတ်သည်။ ; hoti=၏။ ; ekampinikāyaṃ=ကိုလည်း။ ; gaṇhāti=သင်၏။ ; dvepi=နှစ်ပါးသော နိကာယ်တို့ကို လည်းကောင်း။ ; tayopi=လည်းကောင်း။ ; cattāropi=လည်းကောင်း။ ; pañcapi=လည်းကောင်း။ ; gaṇhāti=သင်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3154 | Chunk: 52

Tassa tepiṭakaṃ buddhavacanaṃ atthavasena pāḷivasena anusandhivasena pubbāparavasena gaṇhantassa sajjhāyantassa cintentassa vācentassa desentassa pakāsentassa kilesā okāsaṃ na labhanti.

AI Translation based on Nissaya

For that monk who learns, recites, reflects on, teaches, expounds, and elucidates the word of the Buddha, the Tipiṭaka—by way of its meaning, its text, its connections, and its sequence—defilements find no opportunity.

Vietnamese AI Translation

Đối với tỳ khưu đó, người học, tụng đọc, suy niệm, giảng dạy, trình bày, và làm rõ lời Phật dạy, Tipiṭaka—bằng ý nghĩa của nó, văn bản của nó, các mối liên kết của nó, và trình tự của nó—các phiền não không tìm thấy cơ hội.

AI Translation Nissaya

tepiṭakaṃ=the Tipiṭaka which is. ; buddhavacanaṃ=the word of the Buddha. ; atthavasena=by way of the commentary, and. ; pāḷivasena=by way of the Pāli text, and. ; anusandhivasena=by way of connecting the questions and answers, and. ; pubbāparavasena=by way of the preceding and succeeding parts. ; gaṇhantassa=for one who learns. ; sajjhāyantassa=recites. ; cintentassa=reflects on. ; vācentassa=teaches. ; desentassa=expounds. ; pakāsentassa=elucidates. ; tassa=for that monk. ; kilesā=defilements. ; hakāsaṃ=an opportunity. ; nalabhanti=do not find. ;

Myanmar Nissaya

tepiṭakaṃ=တည်းဟူသော။ ; buddhavacanaṃ=တော်ကို။ ; atthavasena=အဋ္ဌကထာ၏ အစွမ်းဖြင့်လည်းကောင်း။ ; pāḷivasena=ပါဠိ၏ အစွမ်းဖြင့်လည်းကောင်း။ ; anusandhivasena=ပုစ္ဆာနုသန္ဓေ, အဇ္ဈဘယာနုသန္ဓေ၏ အစွမ်းဖင့်လည်းကောင်း။ ; pubbāparavasena=လည်းကောင်း။ ; gaṇhantassa=သင်သော။ ; sajjhāyantassa=သရဇ္ဈာယ်သော။ ; cintentassa=ကြံသော။ ; vācentassa=ပို့ချသော။ ; desentassa=ဟောသော။ ; pakāsentassa=ပြသော။ ; tassa=ထိုရဟန်းအား။ ; kilesā=တို့သည်။ ; hakāsaṃ=ကို။ ; nalabhanti=ကုန်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3155 | Chunk: 52

Aparabhāge panassa ganthakammaṃ pahāya kusītassa carato ayonisomanasikārasativossagge āgamma uppajjanti.

AI Translation based on Nissaya

But later, having given up the work on the scriptures and become lazy, they arise for that monk depending on improper attention and lapses of mindfulness.

Vietnamese AI Translation

Nhưng sau đó, sau khi đã từ bỏ công việc về kinh điển và trở nên lười biếng, chúng sanh khởi cho tỳ khưu đó tùy thuộc vào sự tác ý không đúng đắn và sự lơ là niệm.

AI Translation Nissaya

pana=To speak of when they do find an opportunity. ; aparabhāge=Later on. ; ganthakammaṃ=the work on the scriptures. ; pahāya=having given up. ; carato=while moving about. ; kusītassa=being lazy. ; assa=for that monk. ; ayoni somanasikāravossagge=improper attention and a lapse of mindfulness. ; vā=or. ; āgamma=depending on. ; vā=or having reached. ; uppajjati=they arise. ;

Myanmar Nissaya

pana=ရသည်ကိုဆိုအံ့။ ; aparabhāge=၌။ ; ganthakammaṃ=ကို။ ; pahāya=၍။ ; carato=သွားလာသော။ ; kusītassa=ပျင်းရိသော။ ; assa=ထိုရဟန်းအား။ ; ayoni somanasikāravossagge=မသင့်သောအားဖြင့် နှလုံးသွင်းခြင်း, သတိ၏ လွတ်ခြင်းတို့ကို။ ; vā=တို့ကို။ ; āgamma=စွဲ၍။ ; vā=ရောက်၍။ ; uppajjati=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3156 | Chunk: 52

Evampi asamudācāravasena anuppannā uppajjanti nāma.

AI Translation based on Nissaya

In this way too, unwholesome states that were unarisen by way of not having occurred, are said to arise.

Vietnamese AI Translation

Theo cách này cũng vậy, các pháp bất thiện mà chưa sanh bằng cách chưa từng xảy ra, được nói là sanh khởi.

AI Translation Nissaya

evampi=In this way also. ; asamudācāravasena=by way of not having occurred. ; anuppannā=unarisen unwholesome states. ; vā=or. ; uppajjantināma=are said to arise. ;

Myanmar Nissaya

evampi=ဤသို့လည်း။ ; asamudācāravasena=မဖြစ်ဖူးသည်၏ အစွမ်းဖြင့်။ ; anuppannā=မဖြစ်ကုန်သေးသော အကုသိုလ်တရားတို့ကို။ ; vā=တို့သည်။ ; uppajjantināma=မည်ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3157 | Chunk: 52

Ekacco pana dhutaṅgadharo hoti, terasa dhutaṅgaguṇe samādāya vattati, tassa dhutaṅgaguṇe pariharantassa kilesā okāsaṃ na labhanti.

AI Translation based on Nissaya

Furthermore, a certain monk undertakes the ascetic practices. Having taken up the thirteen ascetic qualities, he lives accordingly. For him who maintains these ascetic qualities, defilements find no opportunity.

Vietnamese AI Translation

Hơn nữa, một tỳ khưu nào đó thực hành các hạnh đầu đà. Sau khi đã chấp nhận mười ba hạnh đầu đà, ông ấy sống theo đó. Đối với người duy trì các hạnh đầu đà này, các phiền não không tìm thấy cơ hội.

AI Translation Nissaya

pana=Furthermore. ; ekacco=a certain monk. ; dhutaṅgataro=undertakes the ascetic practices. ; hoti=is. ; terasadhutaṅgaguṇe=the thirteen ascetic qualities. ; vā=or the virtues of them. ; samādāya=having undertaken. ; vattati=he lives. ; dhutaṅgaguṇe=the ascetic qualities. ; pariharantassa=for one who maintains. ; tassa=for him. ; kilesā=defilements. ; okāsaṃ=an opportunity. ; nalabhanti=do not find. ;

Myanmar Nissaya

pana=ထိုမှတပါး။ ; ekacco=ရဟန်းသည်။ ; dhutaṅgataro=ဆောင်သည်။ ; hoti=၏။ ; terasadhutaṅgaguṇe=တို့ကို။ ; vā=တို့၏ ကျေးဇူးတို့ကို။ ; samādāya=၍။ ; vattati=ကျင့်၏။ ; dhutaṅgaguṇe=တို့ကို။ ; pariharantassa=ဆောင်သော။ ; tassa=အား။ ; kilesā=တို့သည်။ ; okāsaṃ=ကို။ ; nalabhanti=ကုန်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3158 | Chunk: 52

Aparabhāge [M1.157] panassa dhutaṅgāni vissajjetvā bāhullāya āvattassa carato ayonisomanasikārasativossagge āgamma uppajjanti.

AI Translation based on Nissaya

However, at a later time [M1.157], for one who has abandoned the ascetic practices and reverted to a life of abundance, they (defilements) arise based on unwise attention and lapse of mindfulness.

Vietnamese AI Translation

Tuy nhiên, vào một thời điểm sau này [M1.157], đối với người đã từ bỏ các hạnh đầu đà và trở lại một cuộc sống sung túc, chúng (phiền não) sanh khởi dựa trên sự tác ý phi như lý và sự lơ là niệm.

AI Translation Nissaya

pana=However. ; aparabhāge=at a later time. ; dhutaṅgāni=the ascetic practices. ; visajjetvā=having abandoned. ; bāhullāya=for the sake of abundance. ; āvattassa=for one who has reverted. ; carato=while practicing. ; assa=for him. ; ayonisomanasikārasativossagge=unwise attention and lapse of mindfulness. ; vā=or. ; āgamma=based on. ; vā=or. ; uppajjanti=they arise. ;

Myanmar Nissaya

pana=ရသည်ကိုဆိုအံ့။ ; aparabhāge=၌။ ; dhutaṅgāni=တို့ကို။ ; visajjetvā=စွန့်၍။ ; bāhullāya=ပစ္စည်းလေးပါးတို့၏ များသည်၏အဖြစ်ငှါ။ ; āvattassa=ဓုတင် အကျင့်မှ ပြန်လည်ဆုတ်နစ်သော အားဖြင့်။ ; carato=ကျင့်သော။ ; assa=အား။ ; ayonisomanasikārasativossagge=တို့ကို။ ; vā=တို့သို့။ ; āgamma=စွဲ၍။ ; vā=ရောက်၍။ ; uppajjanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3159 | Chunk: 53

Evampi asamudācāravasena anuppannā uppajjanti nāma.

AI Translation based on Nissaya

In this way too, unarisen defilements are said to arise due to their non-manifestation.

Vietnamese AI Translation

Theo cách này cũng vậy, các phiền não chưa sanh được nói là sanh khởi do sự không biểu hiện của chúng.

AI Translation Nissaya

evampi=Thus also. ; asamudācāravasena=by way of non-manifestation. ; anuppannā=unarisen things. ; uppajjantināma=are said to arise. ;

Myanmar Nissaya

evampi=ဤသို့လည်း။ ; asamudācāravasena=ဖြင့်။ ; anuppannā=တို့သည်။ ; uppajjantināma=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3160 | Chunk: 53

Ekacco aṭṭhasu samāpattīsu ciṇṇavasī hoti, tassa paṭhamajjhānādīsu āvajjanavasīādīnaṃ vasena viharantassa kilesā okāsaṃ na labhanti.

AI Translation based on Nissaya

A certain person is one who has practiced mastery in the eight attainments. For him, while dwelling by means of the mastery of adverting and so on in the first jhāna and the others, defilements do not find an opportunity.

Vietnamese AI Translation

Một người nào đó là người đã thực hành thành thạo trong tám thiền chứng. Đối với ông ấy, trong khi an trú bằng cách thành thạo trong sự hướng tâm v.v. trong sơ thiền và các thiền khác, các phiền não không tìm thấy cơ hội.

AI Translation Nissaya

ekacco=A certain person. ; aṭṭhasu samāpattīsu=in the eight attainments. ; ciṇṇavasī=has mastery that has been practiced. ; hoti=is. ; paṭhamajjhānādīsu=in the first jhāna, etc. ; āvajjanavasīādīnaṃ=of the mastery of adverting, etc. ; vasena=by means of. ; viharantassa=for one who is dwelling. ; tassa=for him. ; kilesā=defilements. ; okāsaṃ=an opportunity. ; nalabhanti=do not obtain. ;

Myanmar Nissaya

ekacco=သည်။ ; aṭṭhaṅaya=ကုန်သော။ ; samāpattīsu=တို့၌။ ; cittavasī=လေ့ကျက်အပ်ပြီးသော ဝသီဘော်ရှိသည်။ ; hoti=၏။ ; paṭhamajjhānādīsu=တို့၌။ ; āvajjanavasīādīnaṃ=အာဝဇ္ဇနဝသီ အစရှိသည်တို့၏။ ; vasena=ဖြင့်။ ; viharantassa=နေသော။ ; tassa=အား။ ; kilesā=တို့သည်။ ; okāsaṃ=ကို။ ; nalabhanti=ကုန်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3161 | Chunk: 53

Aparabhāge panassa parihīnajjhānassa vā vissaṭṭhajjhānassa vā bhassādīsu anuyuttassa viharato ayonisomanasikārasativossagge āgamma uppajjanti.

AI Translation based on Nissaya

But later on, for one whose jhāna has declined or been abandoned, who dwells devoted to things like delight in conversation, they arise based on unwise attention and lapse of mindfulness.

Vietnamese AI Translation

Nhưng sau này, đối với người mà thiền của họ đã suy yếu hoặc bị từ bỏ, người an trú chuyên tâm vào những điều như thích nói chuyện, chúng sanh khởi dựa trên sự tác ý phi như lý và sự lơ là niệm.

AI Translation Nissaya

pana=Now, let it be said. ; aparabhāge=At a later time. ; parihīnajjhānassavā=for one whose jhāna has declined, or. ; vissaṭṭhajjhānassavā=for one whose jhāna has been abandoned, or. ; bhassādīsu=in delight in conversation, etc. ; anuyuttassa=for one who is devoted. ; viharato=while dwelling. ; assa=for him. ; ayonissomanasikārasativossagge=unwise attention and lapse of mindfulness. ; vā=or. ; āgamma=based on. ; vā=or. ; uppajjanti=they arise. ;

Myanmar Nissaya

pana=ရသည်ကို ဆိုအံ့။ ; aparabhāge=၌။ ; parihīnajjhānassavā=လျော့ကျသော ဈာန်ရှိသည်လည်းဖြစ်သော။ ; vissaṭṭhajjhānassavā=စွန့်အပ်သော ဈာန်ရှိသည်လည်းဖြစ်သော။ ; bhassādīsu=ဘဿာရာမတာစသည်တို့၌။ ; anuyuttassa=အားထုတ်လျက်။ ; viharato=နေသော။ ; assa=ား။ ; ayonissomanasikārasativossagge=တို့ကို။ ; vā=တို့ကို။ ; āgamma=စွဲ၍။ ; vā=ရောက်၍။ ; uppajjanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3162 | Chunk: 53

Evampi asamudācāravasena anuppannā uppajjanti nāma.

AI Translation based on Nissaya

In this way too, unarisen defilements are said to arise due to their non-manifestation.

Vietnamese AI Translation

Theo cách này cũng vậy, các phiền não chưa sanh được nói là sanh khởi do sự không biểu hiện của chúng.

AI Translation Nissaya

evampi=Thus also. ; asamudācāravasena=by way of non-manifestation. ; anuppannā=unarisen things. ; uppajjantināma=are said to arise. ;

Myanmar Nissaya

evampi=ဤသို့လည်း။ ; asamudācāravasena=ဖြင့်။ ; anuppannā=တို့သည်။ ; uppajjantināma=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3163 | Chunk: 53

Ekacco [V1.144] pana vipassako hoti, sattasu vā anupassanāsu ( paṭi. ma. 3.35) aṭṭhārasasu vā mahāvipassanāsu ( paṭi. ma. 1.22) kammaṃ karonto viharati, tassa evaṃ viharato kilesā okāsaṃ na labhanti.

AI Translation based on Nissaya

Furthermore [V1.144], a certain person is an insight meditator; he dwells doing the work of either the seven contemplations ( paṭi . ma .3.35) or the eighteen great insights ( paṭi . ma .1.22). For him, while dwelling thus, defilements do not find an opportunity.

Vietnamese AI Translation

Hơn nữa [V1.144], một người nào đó là hành giả tuệ quán; ông ấy an trú thực hiện công việc của bảy sự quán ( paṭi . ma .3.35) hoặc mười tám đại tuệ ( paṭi . ma .1.22). Đối với ông ấy, trong khi an trú như vậy, các phiền não không tìm thấy cơ hội.

AI Translation Nissaya

ekacco=A certain person. ; vipassako=is a meditator of insight. ; hoti=is. ; sattasu anupassanāsu vā=in the seven contemplations, or. ; aṭṭhārasasu mahāvipassanāsuvā=in the eighteen great insights, or. ; kammaṃ=the work of cultivation. ; karonto=doing. ; hutvā=having become. ; (thañña့) viharati=dwells. ; evaṃ=thus. ; viharato=for one dwelling. ; tassa=for him. ; kilesā=defilements. ; okāsaṃ=an opportunity. ; nalabhanti=do not obtain. ;

Myanmar Nissaya

ekacco=သည်။ ; vipassako=ဝိပဿနာ ရှုတတ်သည်။ ; hoti=၏။ ; sattasu=ကုန်သော။ ; anupassanāsu vā=တို့၌လည်းကောင်း။ ; aṭṭhārasasu=ကုန်သော။ ; mahāvipassanāsuvā=မဟာဝိပဿနာတို့၌ လည်းကောင်း။ ; kammaṃ=စီးဖြန်းခြင်း အမှုကို။ ; karonto=ပြုသည်။ ; hutvā=ဖြစ်၍။ ; (thañña့) viharati=နေ၏။ ; evaṃ=ဤသို့။ ; viharato=နေသော။ ; tassa=အား။ ; kilesā=တို့သည်။ ; okāsaṃ=ကို။ ; nalabhanti=မရကုန်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3164 | Chunk: 53

Aparabhāge panassa vipassanākammaṃ pahāya kāyadaḷhībahulassa viharato ayonisomanasikārasativossagge āgamma uppajjanti.

AI Translation based on Nissaya

But later on, for one who has abandoned the work of insight meditation and dwells much engaged in strengthening the body, they arise based on unwise attention and lapse of mindfulness.

Vietnamese AI Translation

Nhưng sau này, đối với người đã từ bỏ công việc thiền tuệ và an trú rất chuyên tâm vào việc tăng cường thân thể, chúng sanh khởi dựa trên sự tác ý phi như lý và sự lơ là niệm.

AI Translation Nissaya

pana=Furthermore, let it be said. ; aparabhāge=At a later time. ; vipassanākammaṃ=the work of insight meditation. ; pahāya=having abandoned. ; kāyadaḷhībahulassa=for one who is much engaged in strengthening the body. ; vā=or being much engaged in. ; viharato=while dwelling. ; assa=for him. ; ayonisomanasikārasativossagge=unwise attention and lapse of mindfulness. ; vā=or. ; āgamma=based on. ; vā=or. ; upajjanti=they arise. ;

Myanmar Nissaya

pana=ရသည်ကို ဆိုဦးအံ့။ ; aparabhāge=၌။ ; vipassanākammaṃ=ကို။ ; pahāya=၍။ ; kāyadaḷhībahulassa=ကိုယ်၏ ခိုင်ခံ့ခြင်းကို ပြုခြင်း များသော။ ; vā=ပြုခြင်းများသည်ဖြစ်၍။ ; viharato=နေသော။ ; assa=အား။ ; ayonisomanasikārasativossagge=တို့ကို။ ; vā=တို့ကို။ ; āgamma=စွဲ၍။ ; vā=ရောက်၍။ ; upajjanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3165 | Chunk: 53

Evampi asamudācāravasena anuppannā uppajjanti nāma.

AI Translation based on Nissaya

In this way too, unarisen defilements are said to arise due to their non-manifestation.

Vietnamese AI Translation

Theo cách này cũng vậy, các phiền não chưa sanh được nói là sanh khởi do sự không biểu hiện của chúng.

AI Translation Nissaya

evampi=Thus also. ; asamudācāravasena=by way of non-manifestation. ; anuppannā=unarisen things. ; uppajjantināma=are said to arise. ;

Myanmar Nissaya

evampi=ဤသို့လည်း။ ; asamudācāravasena=ဖြင့်။ ; anuppannā=တို့သည်။ ; uppajjantināma=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3166 | Chunk: 53

Ekacco navakammiko hoti, uposathāgārabhojanasālādīni karoti [P1.170], tassa tesaṃ upakaraṇāni cintentassa kilesā okāsaṃ na labhanti.

AI Translation based on Nissaya

A certain monk is engaged in new construction work; he builds [P1.170] Uposatha halls, dining halls, and so on. For him, while he is thinking about the materials for them, defilements do not find an opportunity.

Vietnamese AI Translation

Một tỳ khưu nào đó đang tham gia vào công việc xây dựng mới; ông ấy xây dựng [P1.170] các giảng đường Uposatha, các phòng ăn, v.v. Đối với ông ấy, trong khi ông ấy đang nghĩ về các vật liệu cho chúng, các phiền não không tìm thấy cơ hội.

AI Translation Nissaya

ekacco=A certain monk. ; navakammiko=is engaged in new construction work. ; hoti=is. ; uposathāgārabhojanasālādīni=Uposatha halls, dining halls, etc. ; karoti=he builds. ; tesaṃ=of those Uposatha halls, dining halls, etc. ; upakaraṇāni=the materials like wood and bamboo. ; cintetassa=for one who is thinking about. ; tassa=for him. ; kilesā=defilements. ; okāsaṃ=an opportunity. ; na labhanti=do not obtain. ;

Myanmar Nissaya

ekacco=ရဟန်းသည်။ ; navakammiko=အမှုသစ်ကို ပြုခြင်းရှိသည်။ ; hoti=၏။ ; uposathāgārabhojanasālādīni=ဥပုသ်အိမ်ဆွမ်းစားဇရပ် အစရှိသည်တို့ကို။ ; karoti=၏။ ; tesaṃ=ထို ဥပုသ်အိမ် ဆွမ်းစားဇရပ် အစရှိသည်တို့၏။ ; upakaraṇāni=သစ်ဝါးအစရှိသော အဆောက်အဦတို့ကို။ ; cintetassa=ကြံအောက်မေ့ရသော။ ; tassa=အား။ ; kilesā=တို့သည်။ ; okāsaṃ=ကို။ ; na labhanti=ကုန်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3167 | Chunk: 53

Aparabhāge panassa navakamme niṭṭhite vā vissaṭṭhe vā ayonisomanasikārasativossagge āgamma uppajjanti.

AI Translation based on Nissaya

But later on for him, when the new work is finished or abandoned, they arise based on unwise attention and lapse of mindfulness.

Vietnamese AI Translation

Nhưng sau này đối với ông ấy, khi công việc mới đã hoàn thành hoặc bị từ bỏ, chúng sanh khởi dựa trên sự tác ý phi như lý và sự lơ là niệm.

AI Translation Nissaya

pana=Furthermore. ; aparabhāge=At a later time. ; assa=for him. ; navakamme=the new work. ; niṭṭhitevā=when it is finished, or. ; navakamme=the work. ; vissaṭṭhavā=when it is abandoned, or. ; ayonisomanasikārasatigossagge=unwise attention and lapse of mindfulness. ; āgamma=based on. ; uppajjanti=they arise. ;

Myanmar Nissaya

pana=ဦးအံ့။ ; aparabhāge=၌။ ; assa=အား။ ; navakamme=အမှုသစ်သည်၌။ ; niṭṭhitevā=ပြီးပြီးသော်လည်းကောင်း။ ; navakamme=၌။ ; vissaṭṭhavā=စွန့်လွှတ်သော်လည်းကောင်း။ ; ayonisomanasikārasatigossagge=တို့ကို။ ; āgamma=၍။ ; uppajjanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3168 | Chunk: 53

Evampi asamudācāravasena anuppannā uppajjanti nāma.

AI Translation based on Nissaya

In this way too, unarisen defilements are said to arise due to their non-manifestation.

Vietnamese AI Translation

Theo cách này cũng vậy, các phiền não chưa sanh được nói là sanh khởi do sự không biểu hiện của chúng.

AI Translation Nissaya

evampi=Thus also. ; asamudācāravasena=by way of non-manifestation. ; anuppannā=unarisen things. ; uppajjantināma=are said to arise. ;

Myanmar Nissaya

evampi=သို့လည်း။ ; asamudācāravasena=ဖြင့်။ ; anuppannā=တို့သည်။ ; uppajjantināma=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3169 | Chunk: 53

Ekacco pana brahmalokato āgato suddhasatto hoti, tassa anāsevanāya kilesā okāsaṃ na labhanti.

AI Translation based on Nissaya

Furthermore, a certain person is a pure being who has come from a Brahma world. For that being, because of not having associated with them, defilements do not find an opportunity.

Vietnamese AI Translation

Hơn nữa, một người nào đó là một hữu tình thanh tịnh đã đến từ một cõi Phạm Thiên. Đối với hữu tình đó, vì không có sự liên hệ với chúng, các phiền não không tìm thấy cơ hội.

AI Translation Nissaya

pana=Furthermore. ; e‌kacco=a certain person. ; brahmalokato=from the Brahma world. ; āgato=has come. ; hutvā=having been. ; suddhasatto=is a pure being. ; hoti=is. ; tassa=for that being. ; anāsevanāya=through not associating with defilements for a long time. ; vā=because of. ; kilesā=defilements. ; okāsaṃ=an opportunity. ; nalabhanti=do not obtain. ;

Myanmar Nissaya

pana=ထိုမှတပါး။ ; e‌kacco=အချို့သော ရဟန်းသည်။ ; brahmalokato=မှ။ ; āgato=လာသည်။ ; hutvā=ဖြစ်၍။ ; suddhasatto=စင်ကြယ်သော သတ္တဝါသည်။ ; hoti=၏။ ; tassa=ထိုသတ္တဝါအား။ ; anāsevanāya=ရှည်စွာသော နေ့ညဉ့်ပတ်လုံး ကိလေသာတို့ကို မမှီဝဲခြင်းဖြင့်။ ; vā=ကြောင့်။ ; kilesā=တို့သည်။ ; okāsaṃ=ကို။ ; nalabhanti=ကုန်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3170 | Chunk: 53

Aparabhāge panassa laddhāsevanassa ayonisomanasikārasativossagge āgamma uppajjanti.

AI Translation based on Nissaya

But later on, for that being who has obtained association (with them), they arise based on unwise attention and lapse of mindfulness.

Vietnamese AI Translation

Nhưng sau này, đối với hữu tình đó, người đã có được sự liên hệ (với chúng), chúng sanh khởi dựa trên sự tác ý phi như lý và sự lơ là niệm.

AI Translation Nissaya

pana=Now, let it be said. ; aparabhāge=At a later time. ; laddhāsevanassa=for one who has obtained association (with them). ; assa=for that being. ; ayānisomana sikārasativossagge=unwise attention and lapse of mindfulness. ; vā=or. ; āgamma=based on. ; uppajjanti=they arise. ;

Myanmar Nissaya

pana=ဆိုအံ့။ ; aparabhāge=၌။ ; laddhāsevanassa=ရအပ်သော မှီဝဲခြင်းရှိသော။ ; assa=ထိုသတ္တဝါား။ ; ayānisomana sikārasativossagge=တို့ကို။ ; vā=တို့သို့။ ; āgamma=၍။ ; uppajjanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3171 | Chunk: 53

Evampi asamudācāravasena anuppannā uppajjanti nāma.

AI Translation based on Nissaya

In this way too, unarisen defilements are said to arise due to their non-manifestation.

Vietnamese AI Translation

Theo cách này cũng vậy, các phiền não chưa sanh được nói là sanh khởi do sự không biểu hiện của chúng.

AI Translation Nissaya

evampi=Thus also. ; asamudācāravasena=by way of non-manifestation. ; anuppannā=unarisen things. ; uppajjantināma=are said to arise. ;

Myanmar Nissaya

evampi=လည်း။ ; asamudācāravasena=ဖြင့်။ ; anuppannā=တို့သည်။ ; uppajjantināma=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3172 | Chunk: 53

Evaṃ tāva asamudācāravasena anuppannatā veditabbā.

AI Translation based on Nissaya

Thus, first, the state of not having arisen should be understood by way of non-manifestation.

Vietnamese AI Translation

Như vậy, trước tiên, trạng thái chưa sanh khởi nên được hiểu bằng cách không biểu hiện.

AI Translation Nissaya

evaṃ=by the method described. ; tāva=first. ; asamudācāravasena=by way of non-manifestation. ; anuppannatā=the state of not having arisen. ; veditabbā=should be understood. ;

Myanmar Nissaya

evaṃ=ပြီးသော နည်းဖြင့်။ ; tāva=မဆွစွာ။ ; asamudācāravasena=မမြင်ဖူးသည်၏ အစွမ်းဖြင့်။ ; anuppannatā=မဖြစ်သည်၏ ဖြစ်ကို။ ; veditabbā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3173 | Chunk: 53

Kathaṃ ananubhūtārammaṇavasena ?

AI Translation based on Nissaya

How do they arise by way of an unexperienced object?

Vietnamese AI Translation

Làm sao chúng sanh khởi bằng cách một đối tượng chưa được kinh nghiệm?

AI Translation Nissaya

kathaṃ=How then. ; ananubhūtārammaṇavasena=by way of an unexperienced object. ; anuppannā=do unarisen defilements. ; uppajjanti=arise? ;

Myanmar Nissaya

kathaṃ=အတီသို့လျှင်။ ; ananubhūtārammaṇavasena=မခံစားဖူးသော အာရုံ၏ အစွမ်းဖြင့်။ ; anuppannā=မဖြစ်ကုန်သေးသော ကိလေသာတို့သည်။ ; uppajjanti=ကုန်သနည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3174 | Chunk: 53

Idhekacco ananubhūtapubbaṃ manāpikādibhedaṃ ārammaṇaṃ labhati, tassa tattha ayonisomanasikārasativossagge āgamma rāgādayo kilesā uppajjanti.

AI Translation based on Nissaya

Here, a certain person obtains an object not previously experienced, one that is pleasant, etc. For that person, with regard to that object, defilements such as lust arise based on unwise attention and lapse of mindfulness.

Vietnamese AI Translation

Ở đây, một người nào đó đạt được một đối tượng chưa từng được kinh nghiệm trước đây, một cái gì đó dễ chịu, v.v. Đối với người đó, liên quan đến đối tượng đó, các phiền não như tham dục sanh khởi dựa trên sự tác ý phi như lý và sự lơ là niệm.

AI Translation Nissaya

idha=Here. ; ekacco=a certain person. ; ananubhūtapubbaṃ=not previously experienced. ; manāpikādibhedaṃ=having the distinction of being a pleasant object, etc. ; ārammaṇaṃ=an object. ; labhati=obtains. ; tassa=for that person. ; tattha=regarding that object. ; ayonisomanasikārasativossagge=unwise attention and lapse of mindfulness. ; vā=or. ; āgamma=based on. ; rāgodayo kilesā=defilements such as lust. ; uppajjanti=arise. ;

Myanmar Nissaya

idha=၌။ ; ekacco=သူသည်။ ; ananubhūtapubbaṃ=မသုံးဆောင်ဖူးသော။ ; manāpikādibhedaṃ=နှစ်သက်ဖွယ်သော အာရုံစသည်အပြားရှိသော။ ; ārammaṇaṃ=ကို။ ; labhati=၏။ ; tassa=ထိုပုဂ္ဂိုလ်အား။ ; tattha=ထိုအာရုံ၌။ ; ayonisomanasikārasativossagge=တို့ကို။ ; vā=တို့ကို။ ; āgamma=၍။ ; rāgodayo=ကုန်သော။ ; kilesā=တို့သည်။ ; uppajjanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3175 | Chunk: 53

Evaṃ ananubhūtārammaṇavasena anuppannā uppajjanti nāma.

AI Translation based on Nissaya

Thus, unarisen defilements are said to arise by way of an unexperienced object.

Vietnamese AI Translation

Như vậy, các phiền não chưa sanh được nói là sanh khởi bằng cách một đối tượng chưa được kinh nghiệm.

AI Translation Nissaya

evaṃ=Thus. ; ananubhūtārammaṇavasena=by way of an unexperienced object. ; anuppannā=unarisen unwholesome states. ; uppajjantināma=are said to arise. ;

Myanmar Nissaya

evaṃ=ဤသို့။ ; ananubhūtārammaṇavasena=အစွမ်းအားဖြင့်။ ; anuppannā=သော အကုသိုလ်တို့သည်။ ; uppajjantināma=မည်ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3176 | Chunk: 53

Evaṃ anuppannānaṃ akusalānaṃ uppāde sati attano [M1.158] anatthaṃ passitvā tesaṃ anuppādāya satipaṭṭhānabhāvanānuyogena paṭhamaṃ sammappadhānaṃ bhāveti, uppannesu pana tesu tesaṃ appahānato attano anatthaṃ passitvā tesaṃ pahānāya dutiyaṃ tatheva sammappadhānaṃ bhāveti.

AI Translation based on Nissaya

Thus, seeing the disadvantage to oneself [M1.158] in the arising of unarisen unwholesome states, for their non-arising one develops the first right exertion by being devoted to the development of the establishments of mindfulness. Furthermore, when those states have arisen, seeing the disadvantage to oneself in their non-abandonment, for their abandonment one develops the second right exertion in the very same way.

Vietnamese AI Translation

Như vậy, thấy sự bất lợi cho bản thân [M1.158] trong sự sanh khởi của các pháp bất thiện chưa sanh, vì sự không sanh khởi của chúng, người ta phát triển chánh cần thứ nhất bằng cách chuyên tâm vào sự phát triển các nền tảng niệm. Hơn nữa, khi những pháp đó đã sanh khởi, thấy sự bất lợi cho bản thân trong sự không từ bỏ của chúng, vì sự từ bỏ của chúng, người ta phát triển chánh cần thứ hai theo cùng một cách.

AI Translation Nissaya

evaṃ=by the method described. ; anuppannānaṃ akusalānaṃ=of unarisen unwholesome states. ; uppāde sati=when there is the arising. ; attano=of oneself. ; anatthaṃ=the decline of benefit. ; passitvā=having seen. ; tesaṃ=of those unarisen unwholesome states. ; anuppādāya=for the non-arising. ; satipaṭṭhānabhāvanānuyogena=by means of devotion to the development of the establishments of mindfulness. ; paṭhamaṃ sammappadhānaṃ=the first right exertion. ; bhāveti=one develops. ; pana=Furthermore. ; tesu=those unwholesome states. ; uppannesu=when they have arisen. ; tesaṃ appahānako=because of their non-abandonment. ; attano anatthaṃ=the decline of one's own benefit. ; passitvā=having seen. ; tesaṃ pahānāya=for the abandonment of those arisen unwholesome states. ; dutiyaṃ sammappadhānaṃ=the second right exertion. ; tatheva satipaṭṭhānabhāvanānuyogena=in the same way by means of devotion to the development of the establishments of mindfulness. ; bhāveti=one develops. ;

Myanmar Nissaya

evaṃ=ပြီးသော နည်းဖြင့်။ ; anuppannānaṃ=ကုန်သော။ ; akusalānaṃ=တို့၏။ ; uppāde=ခြင်းသည်။ ; sati=သော်။ ; attano=မိမိ၏။ ; anatthaṃ=အကျိုး၏ ဆုတ်ယုတ်ခြင်းကို။ ; passitvā=မြင်၍။ ; tesaṃ=ထိုမဖြစ်ဖူးကုန်သော အကုသိုလ်တို့၏။ ; anuppādāya=ငှါ။ ; satipaṭṭhānabhāvanānuyogena=ကို အားထုတ်သောအားဖြင့်။ ; paṭhamaṃ=မဆွစွာသော။ ; sammappadhānaṃ=ကို။ ; bhāveti=ပွားစေ၏။ ; pana=ထိုမှ တပါး။ ; tesu=ထိုအကုသိုလ်တရားတို့သည်။ ; uppannesu=ရှိသော်။ ; tesaṃ=ထိုဖြစ်လာသော အကုသိုလ် တရားတို့ကို။ ; appahānako=ကြောင့်။ ; attano=၏။ ; anatthaṃ=အကျိုး၏ ဆုတ်ယုတ်ခြင်းကို။ ; passitvā=၍။ ; tesaṃ=ထိုဖြစ်လာသော အကုသိုလ်တရားတို့ကို။ ; pahānāya=ငှါ။ ; dutiyaṃ=နှစ်ခုမြောက်သော။ ; sammappadhānaṃ=ကို။ ; tatheva=သာလျှင်။ ; satipaṭṭhānabhāvanānuyogena=အားဖြင့်။ ; bhāveti=ပွား‌စေ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3177 | Chunk: 53

Anuppannā kusalā dhammāti samathavipassanā ceva maggo ca.

AI Translation based on Nissaya

`Unarisen wholesome states` refers to both serenity and insight, and the path.

Vietnamese AI Translation

'Các pháp thiện chưa sanh' đề cập đến cả tịnh chỉ và tuệ quán, và đạo.

AI Translation Nissaya

anuppannā kusalā dhammāti='Unarisen wholesome states' means. ; samathavipassanāceva=both serenity and insight. ; maggoca=and the path. ;

Myanmar Nissaya

anuppannā kusalā dhammāti=ကား။ ; samathavipassanāceva=သည်လည်းကောင်း။ ; maggoca=သည်လည်းကောင်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3178 | Chunk: 53

Tesaṃ anuppāde attano anatthaṃ passitvā tesaṃ uppādanatthāya tatheva tatiyaṃ sammappadhānaṃ bhāveti.

AI Translation based on Nissaya

Seeing the disadvantage to oneself in their non-arising, for the purpose of making them arise, one develops the third right exertion in the very same way.

Vietnamese AI Translation

Thấy sự bất lợi cho bản thân trong sự không sanh khởi của chúng, vì mục đích làm cho chúng sanh khởi, người ta phát triển chánh cần thứ ba theo cùng một cách.

AI Translation Nissaya

tesaṃ=of those unarisen serenity, insight, and path. ; anuppāde=in the non-arising. ; attano anatthaṃ=the decline of one's own benefit. ; passitvā=having seen. ; tesaṃ=those unarisen serenity, insight, and path. ; uppādanatthāya=for the purpose of causing to arise. ; tatheva satipaṭṭhānabhāvanānuyogena=in the same way by means of devotion to the development of the establishments of mindfulness. ; tatiyaṃ sammappadhānaṃ=the third right exertion. ; bhāveti=one develops. ;

Myanmar Nissaya

tesaṃ=ထိုမဖြစ်ဖူးကုန်သေးသော သမထ ဝိပဿနာ မဂ်တို့၏။ ; anuppāde=မဖြစ်ခြင်း၌။ ; attano=၏။ ; anatthaṃ=အကျိုး၏ ဆုတ်ယုတ်ခြင်းကို။ ; passitvā=၍။ ; tesaṃ=ထိုမဖြစ်ကုန်သေးသော သမထဝိပဿနာမဂ်တို့ကို။ ; uppādanatthāya=စေခြင်းငှါ။ ; tatheva=လျှင်။ ; satipaṭṭhānabhāvanānuyogena=အားဖြင့်။ ; tatiyaṃ=သော။ ; sammappadhānaṃ=ကို။ ; bhāveti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3179 | Chunk: 53

Uppannā kusalā dhammāti samathavipassanāva.

AI Translation based on Nissaya

`Arisen wholesome states` refers to only serenity and insight.

Vietnamese AI Translation

'Các pháp thiện đã sanh' đề cập đến chỉ tịnh chỉ và tuệ quán.

AI Translation Nissaya

uppannā kusalā dhammāti='Arisen wholesome states' means. ; samathavipassanāva=only serenity and insight. ;

Myanmar Nissaya

uppannā kusalā dhammāti=ကား။ ; samathavipassanāva=သမထဝိပဿနာ တို့သည်သာလျှင်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3180 | Chunk: 53

Maggo pana sakiṃ uppajjitvā nirujjhamāno anatthāya saṃvattanako nāma natthi.

AI Translation based on Nissaya

The path, however, having arisen once, is not something that, upon ceasing, leads to disadvantage.

Vietnamese AI Translation

Tuy nhiên, đạo, sau khi đã sanh khởi một lần, không phải là cái mà, khi chấm dứt, dẫn đến sự bất lợi.

AI Translation Nissaya

pana=Furthermore. ; maggo=the path. ; sakiṃ=once. ; uppajjitvā=having arisen. ; nirujjhamāno=ceasing. ; hutvā=having been. ; anatthāya saṃvattanakonāma=is not called something that leads to disadvantage. ; natthi=there is not. ;

Myanmar Nissaya

pana=ထိုမှတ ပါး။ ; maggo=မဂ်သည်။ ; sakiṃ=တစ်ကြိမ်။ ; uppajjitvā=ဖြစ်ပြီး၍။ ; nirujjhamāno=ချုပ်သည်။ ; hutvā=၍။ ; anatthāya=ငှါ။ ; saṃvattanakonāma=ဖြစ်စေတတ်သော မဂ်မည်သည်။ ; natthi=မရှိ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3181 | Chunk: 53

So hi phalassa paccayaṃ datvāva nirujjhati.

AI Translation based on Nissaya

Indeed, that path ceases only after giving its power as a condition for the fruit.

Vietnamese AI Translation

Thật vậy, đạo đó chấm dứt chỉ sau khi trao sức mạnh của nó làm điều kiện cho quả.

AI Translation Nissaya

hi saccaṃ=Indeed. ; so=that path. ; phalassa=to the fruit. ; paccayaṃ=its own power as a condition. ; datvāva=only after giving. ; nirujjhati=it ceases. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; so=ထိုမဂ်သည်။ ; phalassa=ဖိုလ်အား။ ; paccayaṃ=မိမိ၏ သတ္တိကို။ ; datvāva=ပေး၍ သာလျှင်။ ; nirujjhati=ချုပ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3182 | Chunk: 53

Tāsaṃ samathavipassanānaṃ nirodhato attano anatthaṃ passitvā tāsaṃ ṭhitiyā tatheva catutthaṃ sammappadhānaṃ bhāveti.

AI Translation based on Nissaya

Seeing the disadvantage to oneself from the cessation of those serenity and insight meditations, for their stability one develops the fourth right exertion in the very same way.

Vietnamese AI Translation

Thấy sự bất lợi cho bản thân từ sự chấm dứt của các thiền tịnh chỉ và tuệ quán đó, vì sự ổn định của chúng, người ta phát triển chánh cần thứ tư theo cùng một cách.

AI Translation Nissaya

tāsaṃ samathavipassanānaṃ=of those serenity and insight meditations. ; nirodhato=due to the cessation. ; attano anatthaṃ=the disadvantage to oneself. ; passitvā=having seen. ; tāsaṃ=of those serenity and insight meditations. ; ṭhitiyā=for the stability. ; tatheva satipaṭṭhānabhāvanānuyogena=in the same way by means of devotion to the development of the establishments of mindfulness. ; catutthaṃ sammappadhānaṃ=the fourth right exertion. ; bhāveti=one develops. ;

Myanmar Nissaya

tāsaṃ samathavipassanānaṃ=တို့၏။ ; nirodhato=ခြင်းကြောင့်။ ; attano=၏။ ; anatthaṃ=ကို။ ; passitvā=မြင်၍။ ; tāsaṃ=ထိုသမထဝိပဿနာတို့၏။ ; ṭhitiyā=ငှါ။ ; tatheva=လျှင်။ ; satipaṭṭhānabhāvanānuyogena=အားဖြင့်။ ; catutthaṃ=သော။ ; sammappadhānaṃ=ကို။ ; bhāveti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3183 | Chunk: 53

Lokuttaramaggakkhaṇe pana ekameva vīriyaṃ.

AI Translation based on Nissaya

However, at the moment of the supramundane path, there is only a single effort.

Vietnamese AI Translation

Tuy nhiên, vào sát-na đạo siêu thế, chỉ có một tinh tấn duy nhất.

AI Translation Nissaya

pana=Regarding the supramundane path, let it be said. ; lokuttarāmaggakkhaṇe=at the moment of the supramundane path. ; ekameva vīriyaṃ=only one single effort. ; (uppajjati=arises.) ;

Myanmar Nissaya

pana=လောကုတ္တရာမဂ်ကို ဆိုအံ့။ ; lokuttarāmaggakkhaṇe=ခဏ၌။ ; ekameva=ဖြစ်သော။ ; vīriyaṃ=သည်။ ; (uppajjati=၏။) ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3184 | Chunk: 53

Ye [V1.145] evaṃ anuppannā uppajjeyyuṃ, te yathā neva uppajjanti, evaṃ tesaṃ anuppannānaṃ anuppādakiccaṃ, uppannānañca pahānakiccaṃ sādheti.

AI Translation based on Nissaya

It accomplishes the task of preventing the arising of whatever unarisen [V1.145] (unwholesome states) might arise, so that they do not arise, and it accomplishes the task of abandoning those which have arisen.

Vietnamese AI Translation

Nó hoàn thành nhiệm vụ ngăn chặn sự sanh khởi của bất kỳ (các pháp bất thiện) chưa sanh [V1.145] nào có thể sanh khởi, để chúng không sanh khởi, và nó hoàn thành nhiệm vụ từ bỏ những cái đã sanh khởi.

AI Translation Nissaya

evaṃ=in the worldly way thus described. ; anuppannā=unarisen. ; ye=which unwholesome states. ; uppajjeyyuṃ=might arise. ; te=those unwholesome states. ; yathā=in which manner. ; (paṭipajjiyamāno=when practiced). ; nevauppajjanti=do not arise. ; evatathā=in that manner. ; anuppannānaṃ tesaṃ=of those unarisen unwholesome states. ; anuppādakiccañca=the task of non-arising, and. ; uppannānaṃ tesaṃ=of those arisen unwholesome states. ; pahānakiccaṃ=the task of abandonment. ; sādheti=it accomplishes. ;

Myanmar Nissaya

evaṃ=ဤလောကီ၌ ဆိုအပ်ပြီးသော နည်းဖြင့်။ ; anuppannā=မဖြစ်ကုန်သေးသော။ ; ye=အကြင်ကုသိုလ်တရားတို့သည်။ ; uppajjeyyuṃ=ဖြစ်ကုန်ရာ၏။ ; te=ထိုကုသိုလ်တရားတို့သည်။ ; yathā=အကြင်အခြင်းအရာဖြင့်။ ; (paṭipajjiyamāno=ကျင့်အပ်သည်ရှိသော်။) ; nevauppajjanti=မဖြစ်ကုန်။ ; evatathā=ထိုအခြင်းအရာအားဖြင့်။ ; anuppannānaṃ=သေးသော။ ; tesaṃ=ထိုကုသိုလ်တရား တို့၏။ ; anuppādakiccañca=ကို လည်းကောင်း။ ; uppannānaṃ=ကုန်ပြီးသော။ ; tesaṃ=ထိုအကုသိုလ်တရားတို့ကို။ ; pahānakiccaṃ=ကိုလည်းကောင်း။ ; sādheti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3185 | Chunk: 53

Uppannāti cettha catubbidhaṃ uppannaṃ vattamānuppannaṃ bhūtāpagatuppannaṃ okāsakatuppannaṃ bhūmiladdhuppannanti.

AI Translation based on Nissaya

Herein, in the word `arisen`, 'arisen' is fourfold: present-arisen, past-and-gone-arisen, opportunity-made-arisen, and plane-obtained-arisen.

Vietnamese AI Translation

Trong đó, trong từ 'đã sanh', 'đã sanh' có bốn loại: sanh hiện tại, sanh quá khứ và đã qua, sanh do tạo cơ hội, và sanh do đạt được cõi.

AI Translation Nissaya

ca=To state a special point. ; uppannātiettha=in this word 'uppanna'. ; uppannaṃ='uppanna' (arisen). ; vattamānuppannaṃ=is 'present-arisen'. ; bhūtāpagatuppannaṃ=is 'past-and-gone-arisen'. ; okāsakatuppannaṃ=is 'opportunity-made-arisen'. ; bhūmiladdhuppannaṃ=is 'plane-obtained-arisen'. ; iti=thus. ; catubbidhaṃ=it is fourfold. ;

Myanmar Nissaya

ca=ဆိုဖွယ်အထူးကို ဆိုအံ့။ ; uppannātiettha=ဥပ္ပန္နာ ဟူသော ပုဒ်၌။ ; uppannaṃ=ဥပ္ပန္န သည်။ ; vattamānuppannaṃ=လည်းကောင်း။ ; bhūtāpagatuppannaṃ=လည်းကောင်း။ ; okāsakatuppannaṃ=လည်းကောင်း။ ; bhūmiladdhuppannaṃ=လည်းကောင်း။ ; iti=ဤသို့။ ; catubbidhaṃ=ရှိ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3186 | Chunk: 53

Tattha sabbampi uppādajarābhaṅgasamaṅgisaṅkhātaṃ [P1.171] vattamānuppannaṃ nāma.

AI Translation based on Nissaya

Therein, all that is designated as endowed with arising, aging, and breaking [P1.171] is called `present-arisen`.

Vietnamese AI Translation

Trong đó, tất cả những gì được định nghĩa là đầy đủ sự sanh, lão, và diệt [P1.171] được gọi là 'sanh hiện tại'.

AI Translation Nissaya

tattha=Among these. ; sabbampi=all whatsoever. ; uppādajarābhaṅgasamaṅgisaṅkhātaṃ=that which is designated as endowed with arising, aging, and breaking. ; (dhammajātaṃ=the collection of phenomena). ; vattamānuppannaṃnāma=is called 'present-arisen'. ;

Myanmar Nissaya

tattha=တို့တွင်။ ; sabbampi=ဥဿုလည်းဖြစ်သော။ ; uppādajarābhaṅgasamaṅgisaṅkhātaṃ=ဥပါဒ်၊ ဌီ၊ ဘင်နှင့် ပြည့်စုံသော။ ; (dhammajātaṃ=တရားအပေါင်းသည်။) ; vattamānuppannaṃnāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3187 | Chunk: 53

Ārammaṇarasaṃ anubhavitvā niruddhaṃ anubhūtāpagatasaṅkhātaṃ kusalākusalaṃ uppādādittayamanuppatvā niruddhaṃ bhutvāpagatasaṅkhātaṃ sesasaṅkhatañca bhūtāpagatuppannaṃ nāma.

AI Translation based on Nissaya

Wholesome and unwholesome states that are designated as 'experienced-and-gone,' which have ceased after experiencing the flavour of an object, and the remaining conditioned phenomena that are designated as 'been-and-gone,' which have ceased after reaching the three moments of arising, etc., are called `past-and-gone-arisen`.

Vietnamese AI Translation

Các thiện pháp và bất thiện pháp được gọi là 'đã kinh nghiệm và đã qua', tức đã chấm dứt sau khi kinh nghiệm hương vị của đối tượng; và các pháp hữu vi còn lại được gọi là 'đã tồn tại và đã qua', tức đã chấm dứt sau khi đạt đến ba sát na sanh, v.v... được gọi là `đã quá khứ và đã sanh` (atītābhūtappaṭiladdhuppanna).

AI Translation Nissaya

ārammaṇarasaṃ=the flavour of the object. ; anubhavitvā=having experienced. ; niruddhaṃ=which has ceased. ; anubhūtāpagatasaṅkhātaṃ=designated as 'experienced and gone'. ; kusalākusalaṃ=wholesome and unwholesome states, and. ; uppādādittayaṃ=to the three moments of arising, etc. ; anuppattā=having reached. ; niruddhaṃ=which has ceased. ; bhutvā pagatasaṅkhātaṃ=designated as 'been and gone'. ; sesasaṅkhatañca=and the remaining conditioned phenomena other than wholesome and unwholesome states. ; bhūtāpagatuppannaṃnāma=is called 'past-and-gone-arisen'. ;

Myanmar Nissaya

ārammaṇarasaṃ=ကို။ ; anubhavitvā=သုံးဆောင်ပြီး၍။ ; niruddhaṃ=ချုပ်သော။ ; anubhūtāpagatasaṅkhātaṃ=ခံစားပြီး၍ ကင်းသည် ဟု ဆိုအပ်သော။ ; kusalākusalaṃ=ကုသိုလ် အကုသိုလ်သည်လည်းကောင်း။ ; uppādādittayaṃ=ဥပါဒ် အစရှ‌ိသော ခဏတ္တယသို့။ ; anuppattā=မူ၍။ ; niruddhaṃ=ချုပ်သော။ ; bhutvā pagatasaṅkhātaṃ=ဖြစ်ပြီး၍ ကင်းသည်ဟု ဆိုအပ်သော။ ; sesasaṅkhatañca=ကုသိုလ် အကုသိုလ်မှကြွင်းသော သင်္ခတတရားသည်လည်းကောင်း။ ; bhūtāpagatuppannaṃnāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3188 | Chunk: 53

‘‘Yānissa tāni pubbe katāni kammānī’’ ti evamādinā ( ma. ni. 3.248) nayena vuttaṃ kammaṃ atītampi samānaṃ aññaṃ vipākaṃ paṭibāhitvā attano vipākassa okāsaṃ katvā ṭhitattā tathā katokāsañca vipākaṃ anuppannampi samānaṃ evaṃ kate okāse ekantena uppajjanato okāsakatuppannaṃ nāma.

AI Translation based on Nissaya

The kamma spoken of by the method starting with, "Whatever kammas have been done by him in the past..." ( ma . ni .3.248)—even though it is past, because it stands having obstructed other results and made an opportunity for its own result; and the result for which an opportunity has been thus made—even though it has not yet arisen, because it will certainly arise when the opportunity is made in this way—is called `opportunity-made-arisen`.

Vietnamese AI Translation

Nghiệp được nói đến theo phương pháp bắt đầu bằng, “Bất cứ nghiệp nào đã được người ấy làm trong quá khứ...” (ma . ni .3.248)—dù đã quá khứ, nhưng vì nó tồn tại do đã ngăn chặn các quả khác và tạo cơ hội cho quả của chính nó; và quả mà cơ hội đã được tạo như vậy—dù chưa sanh, nhưng vì nó chắc chắn sẽ sanh khi cơ hội được tạo theo cách này—được gọi là `duyên đã được tạo và đã sanh` (okāsakatappaṭiladdhuppanna).

AI Translation Nissaya

katāni=which have been done. ; yāni tāni kammāni=whatever kammas. ; santi=there are. ; iti evamādinā nayena=by the method beginning with this passage. ; vuttaṃ kammaṃ=the kamma spoken of. ; atītaṃ samānampi=even though it is past. ; aññaṃ vipākaṃ=another result. ; paṭibāhitvā=having obstructed. ; attano vipākassa=of its own result. ; okāsaṃ=an opportunity. ; katvā=having made. ; ṭhitattā=because it stands. ; tathā katokāsaṃ vipākañca=and the result for which an opportunity has been thus made by the past kamma. ; anuppannaṃ samānampi=even though it has not yet arisen (is future). ; evaṃ okāse kate=when the opportunity is made in this way. ; ekantena=certainly. ; uppajjanato=because it will arise. ; okāsakatuppannaṃnāma=is called 'opportunity-made-arisen'. ;

Myanmar Nissaya

katāni=ပြုအပ်ကုန်ပြီးသော။ ; yāni tāni kammāni=အကြင်ကံတို့သည်။ ; santi=ကုန်၏။ ; iti evamādinā=သော။ ; nayena=ဖြင့်။ ; vuttaṃ=သော။ ; kammaṃ=သည်။ ; atītaṃ=အတိတ်သည်။ ; samānampi=ဖြစ်လျှင်မူလည်း။ ; aññaṃ=တပါးသော။ ; vipākaṃ=ကို။ ; paṭibāhitvā=တားမြစ်၍။ ; attano=မိမိဟု ဆိုအပ်သော အတိတ်ကံ၏။ ; vipākassa=၏။ ; vā=ဝိပါက်၏။ ; okāsaṃ=အခွင့်ကို။ ; katvā=၍။ ; ṭhitattā=ကြောင့်။ ; tathā=ထိုအခြင်းအရာအားဖြင့်။ ; katokāsaṃ=အတိတ်ကံသည် ပြုအပ်သော အခွင့်ရှိသော။ ; vipākañca=ဝိပါက်သည်လည်း။ ; anuppannaṃ=မဖြစ်သေးသည်။ ; vā=အနာဂတ်သည်။ ; samānampi=ဖြစ်လျှင်မူလည်း။ ; evaṃ=ဤသို့ ဆိုအပ်သော နည်းဖြင့်။ ; okāse=ကို။ ; kate=အတိတ်ကံသည် ပြုအပ်သည်ရှိသော်။ ; ekantena=အားဖြင့်။ ; uppajjanato=ဖြစ်လတ္တံ့သောကြောင့်။ ; okāsakatuppannaṃnāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3189 | Chunk: 53

Tāsu tāsu bhūmīsu asamūhataṃ akusalaṃ bhūmiladdhuppannaṃ nāma.

AI Translation based on Nissaya

Unwholesome states in those various planes that have not yet been uprooted by the path are called `plane-obtained-arisen`.

Vietnamese AI Translation

Các pháp bất thiện trong những cõi khác nhau mà chưa bị con đường nhổ bỏ được gọi là `đã đạt được cõi và đã sanh` (bhūmipatta-uppanna).

AI Translation Nissaya

tāsu tāsu bhūmīsu=in those various planes, which are the aggregates of clinging called the personal existence of humans and devas. ; asamūhataṃ=not yet uprooted by the path. ; akusalaṃ=unwholesome state. ; bhūmiladdhuppannaṃnāma=is called 'plane-obtained-arisen'. ;

Myanmar Nissaya

tāsu tāsu bhūmīsu=ထိုထိုလူနတ်တို့၏အတ္တဘောဟု ဆိုအပ်သော ဥပါဒါနက္ခန္ဓာတည်းဟူသော ဘုံတို့၌။ ; asamūhataṃ=မဂ်ဖြင့် မနုတ်ပယ်အပ်သေးသော။ ; akusalaṃ=အကုသိုလ်သည်။ ; bhūmiladdhuppannaṃnāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3190 | Chunk: 53

Ettha ca bhūmiyā bhūmiladdhassa ca nānattaṃ veditabbaṃ – bhūmīti hi vipassanāya ārammaṇabhūtā tebhūmakā pañcakkhandhā.

AI Translation based on Nissaya

Herein, the difference between 'plane' and 'plane-obtained' should be understood. `Plane` (bhūmi) refers to the five aggregates in the three planes of existence, which have become the object of insight.

Vietnamese AI Translation

Ở đây, sự khác biệt giữa 'cõi' và 'đạt được cõi' cần phải được hiểu. `Cõi` (bhūmi) đề cập đến ngũ uẩn trong ba cõi tồn tại, vốn đã trở thành đối tượng của tuệ quán.

AI Translation Nissaya

ca=Furthermore. ; ettha=in this term 'plane-obtained-arisen'. ; bhūmiyā=of the plane. ; bhūmiladdhassaca=and of 'plane-obtained'. ; nānattaṃ=the difference. ; veditabbaṃ=should be understood. ; kathaṃ veditabbaṃ=How should it be understood? ; bhūmīti='plane'. ; vipassanāya=of insight. ; ārammaṇabhūtā=which have become the object. ; vā=or which are worthy of being an object. ; tebhūmakā=existing in the three planes of existence. ; pañcakkhandhā=the five aggregates. ; bhūmināma=are called 'plane'. ;

Myanmar Nissaya

ca=ဆက်။ ; ettha=ဤဘူမိလဒ္ဓုပ္ပန္နံ ဟူသော ပုဒ်၌။ ; bhūmiyā=ဘုံ၏လည်းကောင်။ ; bhūmiladdhassaca=ဘူမိလဒ္ဓ ၏လည်းကောင်း။ ; nānattaṃ=အထူးကို။ ; veditabbaṃ=၏။ ; kathaṃ veditabbaṃ=ကား။ ; bhūmīti=ဟူသည်။ ; vipassanāya=၏။ ; ārammaṇabhūtā=ဖြစ်ကုန်သော။ ; vā=အာရုံပြုထိုက်ကုန်သော။ ; tebhūmakā=၌ဖြစ်ကုန်သော။ ; pañcakkhandhā=တို့သည်။ ; bhūmināma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3191 | Chunk: 53

Bhūmiladdhaṃ nāma tesu khandhesu uppattirahaṃ kilesajātaṃ.

AI Translation based on Nissaya

`Plane-obtained` is the mass of defilements that is fit to arise in those aggregates.

Vietnamese AI Translation

`Đạt được cõi` là khối phiền não phù hợp để sanh khởi trong những uẩn đó.

AI Translation Nissaya

bhūmiladdhaṃnāma=What is called 'plane-obtained' is. ; tesu khandhesu=in those planes, which are the aggregates of clinging called the personal existence of humans and devas. ; uppattirahaṃ=that which is fit to arise. ; kilesajātaṃ=the mass of defilements. ;

Myanmar Nissaya

bhūmiladdhaṃnāma=မည်သည်ကား။ ; tesu khandhesu=လူနတ်တို့၏ အတ္တဘောဟု ဆိုအပ်သော ဥပါဒါနက္ခန္ဓာတည်းဟူသောဘုံတို့၌။ ; uppattirahaṃ=ဖြစ်ခြင်းငှါထိုက်သော။ ; kilesajātaṃ=ကိလေသာအပေါင်းတည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3192 | Chunk: 53

Tena hi sā bhūmiladdhā nāma hotīti tasmā bhūmiladdhanti vuccati.

AI Translation based on Nissaya

Because that plane is said to be 'obtained' by that defilement, it is therefore called 'plane-obtained'.

Vietnamese AI Translation

Bởi vì cõi đó được nói là 'đạt được' bởi phiền não ấy, do đó nó được gọi là 'đạt được cõi'.

AI Translation Nissaya

vā=the mass of defilements. ; bhūmiladdhaṃnāma=is called 'plane-obtained'. ; hi yasmā=Because. ; sābhūmi=that plane, which is the object of insight called the aggregates of clinging, which has not yet been comprehended by the path. ; tena=by that defilement to be abandoned by the path. ; laddhānāma=is called 'obtained'. ; hoti=is. ; iti tasmā=Therefore. ; bhūmiladdhānāma=it is called 'plane-obtained'. ; tasmā=Therefore. ; bhūmiladdhanti=as 'plane-obtained'. ; vuccati=it is said. ;

Myanmar Nissaya

vā=အပေါင်းသည်။ ; bhūmiladdhaṃnāma=မည်၏။ ; hi yasmā=ကြောင့်။ ; sābhūmi=ထိုမဂ်ဖြင့် ပိုင်းခြား၍ မသိအပ်သေးသော ဝိပသနာ၏ အာရုံဖြစ်သော ဥပါဒါနက္ခန္ဓာဟု ဆိုအပ်သော ဘုံသို့။ ; tena=ထိုမဂ်ဖြင့် ပယ်အပ်သော ကိလေသာသည်။ ; laddhānāma=ရအပ်သည်မည်သည်။ ; hoti=၏။ ; iti tasmā=ကြောင့်။ ; bhūmiladdhānāma=မည်၏။ ; tasmā=ကြောင့်။ ; bhūmiladdhanti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3193 | Chunk: 53

Sā ca kho na ārammaṇavasena.

AI Translation based on Nissaya

And yet, that plane is not 'obtained' by way of being an object (for the defilement).

Vietnamese AI Translation

Tuy nhiên, cõi đó không phải 'đạt được' theo cách là một đối tượng (cho phiền não).

AI Translation Nissaya

sāca kho bhūmi=That plane, which is the object of insight called the aggregates of clinging. ; (tena kilesena=by that defilement). ; ārammaṇavasena=by way of being an object. ; naladdhā=is not obtained. ;

Myanmar Nissaya

sāca kho bhūmi=ထိုဝိပသနာ၏ အာရုံဖြစ်သော ဥပါဒါနက္ခန္ဓာဟု ဆိုအပ်သော ဘုံကိုလည်း။ ; (tena kilesena=သည်။) ; ārammaṇavasena=အာရုံပြုသည်၏ အစွမ်းဖြင့်။ ; naladdhā=ရအပ်သည်မဟုတ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3194 | Chunk: 53

Ārammaṇavasena hi sabbepi atītānāgate pariññātepi ca khīṇāsavānaṃ khandhe ārabbha kilesā uppajjanti.

AI Translation based on Nissaya

Indeed, by way of being an object, defilements can arise by taking as their object all the past and future aggregates, and even the aggregates of Arahants which have been fully understood by the path.

Vietnamese AI Translation

Thật vậy, theo cách là một đối tượng, phiền não có thể sanh khởi bằng cách lấy làm đối tượng tất cả các uẩn quá khứ và vị lai, và ngay cả các uẩn của bậc A-la-hán vốn đã được con đường thấu hiểu hoàn toàn.

AI Translation Nissaya

hisaccaṃ=Indeed. ; ārammaṇavasena=by way of being an object. ; sabbepi=all. ; atītā nāgate=past and future. ; pariññātepica=and even those fully understood by the path. ; khīṇāsavānaṃ=of the Arahants. ; khandhe=the aggregates. ; ārabbha=taking as an object. ; kilesā=defilements. ; uppajjanti=arise. ;

Myanmar Nissaya

hisaccaṃ=၏။ ; ārammaṇavasena=ဖြင့်။ ; sabbepi=ကုန်သော။ ; atītā nāgate=ဖြစ်ကုန်သော။ ; pariññātepica=မဂ်ဖြင့် ပိုင်းခြား၍ သိအပ်ပြီးသည်လည်း ဖြစ်ကုန်သော။ ; khīṇāsavānaṃ=ရဟန္တာ ပုဂ္ဂိုလ်တို့၏။ ; khandhe=တို့ကို။ ; ārabbha=အာရုံပြု၍။ ; kilesā=တို့သည်။ ; uppajjanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3195 | Chunk: 53

Yadi ca taṃ bhūmiladdhaṃ nāma siyā, tassa appaheyyato na koci bhavamūlaṃ pajaheyya.

AI Translation based on Nissaya

And if that mass of defilements (arising by taking another's aggregates as object) were called 'plane-obtained', then because it could not be abandoned (by oneself), no one would be able to abandon the root of existence.

Vietnamese AI Translation

Và nếu khối phiền não đó (sanh khởi bằng cách lấy uẩn của người khác làm đối tượng) được gọi là 'đạt được cõi', thì vì nó không thể bị từ bỏ (bởi chính mình), không ai sẽ có thể từ bỏ cội rễ của sự tồn tại.

AI Translation Nissaya

ca=Furthermore. ; chaṃ kilesajātaṃ=that mass of defilements which arises by taking another's aggregates as object. ; bhūmiladdhaṃnāma=were called 'plane-obtained'. ; yadi siyā=if it were so. ; tassa kilesajātassa=that mass of defilements which arises by taking the aggregates of Arahants as object. ; appaheyyato=because it is not to be abandoned, cannot be abandoned, or should not be abandoned by the Arahant. ; koci=any person. ; bhavamūlaṃ=the root of existence, which is defilement. ; napajaheyya=would not abandon. ;

Myanmar Nissaya

ca=ဆက်။ ; chaṃ kilesajātaṃ=ထိုသူတပါးခန္ဓာကို အာရုံပြု၍ ဖြစ်သော ကိလေသာ အပေါင်းသည်။ ; bhūmiladdhaṃnāma=မည်သည်။ ; yadi siyā=အံ့။ ; tassa kilesajātassa=ထိုရဟန္တာ ပုဂ္ဂိုလ်တို့၏ ခန္ဓာ၌ အာရုံပြုသောအားဖြင့် ဖြစ်လာသော ကိလေသာအပေါင်းကို။ ; appaheyyato=ရဟန္တာပုဂ္ဂိုလ်သည် မပယ်အပ်သော် မပယ်နိုင် မပယ်ကောင်းသောကြောင့်။ ; koci=တစုံတယောက်သော ပုဂ္ဂိုလ်သည်။ ; bhavamūlaṃ=ဘဝ၏အကြောင်းဖြစ်သော ကိလေသာကို။ ; napajaheyya=မပယ်ရာ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3196 | Chunk: 53

Vatthuvasena pana bhūmiladdhaṃ veditabbaṃ.

AI Translation based on Nissaya

Rather, 'plane-obtained' should be understood by way of being the physical basis.

Vietnamese AI Translation

Thay vào đó, 'đạt được cõi' nên được hiểu theo cách là cơ sở vật lý.

AI Translation Nissaya

pana=Now, to state the positive aspect apart from the negative. ; vatthuvasena=by way of being the basis (lit. ground, place). ; bhūmiladdhaṃ='plane-obtained'. ; veditabbaṃ=should be understood. ;

Myanmar Nissaya

pana=ဗျတိရိတ်မှ တပါး အနွယကိုဆိုအံ့။ ; vatthuvasena=ကိလေသာတို့၏ ဖြစ်ရာ ဌာန၏ အစွမ်းဖြင့်။ ; bhūmiladdhaṃ=ကို။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3197 | Chunk: 53

Yattha yattha [M1.159] hi vipassanāya apariññātā khandhā uppajjanti, tattha tattha uppādato pabhuti tesu vaṭṭamūlaṃ kilesajātaṃ anuseti.

AI Translation based on Nissaya

To elaborate [M1.159]: wherever the aggregates not yet fully understood by insight arise, from their arising onwards, the mass of defilements, the root of the round of existence, lies latent in them.

Vietnamese AI Translation

Để giải thích rõ hơn [M1.159]: bất cứ nơi nào các uẩn chưa được tuệ quán thấu hiểu hoàn toàn sanh khởi, từ lúc chúng sanh khởi trở đi, khối phiền não, cội rễ của vòng luân hồi, nằm tiềm ẩn trong chúng.

AI Translation Nissaya

hi vitthāremi=To elaborate. ; yattha yattha=In whatever existence. ; vā=or in whatever continuity. ; vipassanāya=by insight. ; apariññātā=not yet fully understood. ; khandhā=the aggregates of an ordinary person. ; uppajjanti=arise. ; tattha tattha=in that very existence. ; vā=or in that very continuity. ; uppādato pabhuti=from their arising onwards. ; tesu=in those aggregates not yet fully understood by insight. ; vaṭṭamūlaṃ=which is the root-cause of the round of existence. ; kilesajāhaṃ=the mass of defilements. ; anuseti=lies latent. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; yattha yattha=အကြင်အကြင် ဘဝ၌။ ; vā=အကြင်အကြင်သန္တာန်၌။ ; vipassanāya=ဖြင့်။ ; apariññātā=ပိုင်းခြား၍ မသိအပ်ကုန်သေးသော။ ; khandhā=ပုထုဇဉ်တို့၏ ခန္ဓာတို့သည်။ ; uppajjanti=ကုန်၏။ ; tattha tattha=ထိုထိုဘဝ၌။ ; vā=ထိုထိုသန္တာန်၌။ ; uppādato=ခန္ဓာတို့၏ ဥပါဒ်သည်မှ။ ; pabhuti=စ၍။ ; tesu=ထိုဝိပဿနာဖြင့် ပိုင်းခြား၍ မသိအပ်ကုန်သေးသော ခန္ဓာတို့သည်။ ; vaṭṭamūlaṃ=ဝဋ်၏ အကြေင်းရင်းဖြစ်သော။ ; kilesajāhaṃ=ကိလေသာအပေါင်းသည်။ ; anuseti=ကိန်း၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3198 | Chunk: 53

Taṃ appahīnaṭṭhena bhūmiladdhanti veditabbaṃ.

AI Translation based on Nissaya

That mass of defilements, in the sense of not yet being abandoned, should be understood as `plane-obtained`.

Vietnamese AI Translation

Khối phiền não đó, theo nghĩa chưa bị từ bỏ, nên được hiểu là `đạt được cõi`.

AI Translation Nissaya

taṃ kilesajātaṃ=That mass of defilements. ; appahīnaṭṭhena=because of the meaning of not yet being abandoned by the path. ; (anusayitaṃ=being latent). ; hutvā=having been. ; bhūmiladdhaṃ=is called 'plane-obtained'. ; iti=thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

taṃ kilesajātaṃ=သည်။ ; appahīnaṭṭhena=မဂ်ဖြင့် မပယ်အပ်သေးသော အနက်ကြောင့်။ ; (anusayitaṃ=အနုသယအားဖြင့် ဖြစ်သည်။ ; hutvā=၍။) ; bhūmiladdhaṃ=မည်၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3199 | Chunk: 53

Tattha ca yassa yesu khandhesu appahīnaṭṭhena anusayitā kilesā, tassa te eva khandhā tesaṃ kilesānaṃ vatthu, na aññesaṃ santakā khandhā.

AI Translation based on Nissaya

Therein, for whichever person latent defilements exist in certain aggregates because they are unabandoned, only those aggregates of that person are the basis for those defilements, not the aggregates belonging to others.

Vietnamese AI Translation

Trong đó, đối với bất cứ người nào mà phiền não tiềm ẩn tồn tại trong những uẩn nhất định vì chúng chưa bị từ bỏ, thì chỉ những uẩn đó của người đó mới là cơ sở cho những phiền não ấy, không phải là các uẩn thuộc về người khác.

AI Translation Nissaya

ca=Furthermore. ; tattha=among those aggregates which are the latent bed of the underlying tendencies. ; yassa puggalassa=of whichever person. ; yesu khandhesu=in whichever aggregates, distinguished as past, etc., or as belonging to the sense-sphere, etc. ; appahīnaṭṭhena=because of not being abandoned. ; anusayitā kilesā=latent defilements. ; (santi=exist). ; tassa puggalassa=of that person. ; te khandhā eva=only those aggregates. ; tesaṃ kilesānaṃ=of those defilements. ; vatthu=are the basis, called the plane. ; aññesaṃ=of other persons. ; santakā khandhā=the aggregates belonging to them. ; navatthu=are not the basis. ;

Myanmar Nissaya

ca=ဆက်။ ; tattha=ထိုအနုယ၏ ကိန်းရာခန္ဓာတို့တွင်။ ; yassa puggalassa=၏။ ; yesu khandhesu=အကြင်အတိတ် စသော အပြား ကာမာဝစရစသော အပြားအားဖြင့် ပြားသော ခန္ဓာတို့၌။ ; appahīnaṭṭhena=ကြောင့်။ ; anusayitā=ကုန်သော။ ; kilesā=တို့သည်။ ; (santi=ကုန်၏)။ ; tassa puggalassa=၏။ ; te khandhā eva=သာလျှင်။ ; tesaṃ kilesānaṃ=တို့၏။ ; vatthu=ဘုံဟုဆိုအပ်သော တရာတည်း။ ; aññesaṃ=တပါးသော ပုဂ္ဂိုလ်တို့၏။ ; santakā=ဖြစ်ကုန်သော။ ; khandhā=တို့သည်။ ; navatthu=တည်ရာမဟုတ်ကုန်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3200 | Chunk: 53

Atītakkhandhesu ca appahīnānusayitānaṃ kilesānaṃ atītakkhandhāva vatthu, na itare.

AI Translation based on Nissaya

And for defilements latent in past aggregates, only the past aggregates are their basis, not the others.

Vietnamese AI Translation

Và đối với phiền não tiềm ẩn trong các uẩn quá khứ, chỉ các uẩn quá khứ là cơ sở của chúng, không phải các uẩn khác.

AI Translation Nissaya

atītakkhandhesuca=And in the case of past aggregates. ; appahīnānusayitānaṃ kilesānaṃ=of the defilements that lie latent, not yet having been abandoned by the path. ; atītakkhandhāva=only the past aggregates. ; vatthu=are the basis. ; itare=The others, the future and present aggregates. ; navatthu=are not the basis. ;

Myanmar Nissaya

atītakkhandhesuca=အတိတ်ဖြစ်သော ခန္ဓာတို့၌လည်း။ ; appahīnānusayitānaṃ=မဂ်ဖြင့် မပယ်အပ်သေးသည်ဖြစ်၍ ကိန်းကုန်သော။ ; kilesānaṃ=တို့၏။ ; atītakkhandhāva=သာလျှင်။ ; vatthu=တည်ရာတည်း။ ; itare=ဤမှ တပါးကုန်သော အနာဂတ် ခန္ဓာ ပစ္စုပ္ပန် ခန္ဓာတို့သည်။ ; navatthu=ကုန်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3201 | Chunk: 53

Esa nayo anāgatādīsu.

AI Translation based on Nissaya

This same principle applies to future aggregates and the others.

Vietnamese AI Translation

Nguyên tắc tương tự này áp dụng cho các uẩn vị lai và các uẩn khác.

AI Translation Nissaya

anāgatādīsu=In the case of future aggregates, etc. ; vā=in the case of future and present aggregates. ; esa eso nayo=this is the method. ;

Myanmar Nissaya

anāgatādīsu=အနာဂတ်ခန္ဓာ အစရှိသည်တို့၌။ ; vā=အနာဂတ်ခန္ဓာ ပစ္စုပ္ပန် ခန္ဓာတို့၌။ ; esa eso nayo=နည်းရှိ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3202 | Chunk: 53

Tathā kāmāvacarakkhandhesu appahīnānusayitānaṃ kilesānaṃ kāmāvacarakkhandhā eva vatthu, na itare.

AI Translation based on Nissaya

Similarly, for defilements latent in the sense-sphere aggregates, only the sense-sphere aggregates are their basis, not the others.

Vietnamese AI Translation

Tương tự, đối với phiền não tiềm ẩn trong các uẩn Dục giới, chỉ các uẩn Dục giới là cơ sở của chúng, không phải các uẩn khác.

AI Translation Nissaya

tathā=Similarly. ; vā=furthermore. ; kāmāvacarakkhandhesu=in the sense-sphere aggregates. ; appahīnānusayitānaṃ kilesānaṃ=of the defilements that lie latent, not having been abandoned. ; kāmāvacarakkhandhāeva=only the sense-sphere aggregates. ; vatthu=are the basis. ; itare=the others, the fine-material and immaterial sphere aggregates. ; navatthu=are not the basis. ;

Myanmar Nissaya

tathā=ထို့အတူ။ ; vā=ထိုမှ တပါး။ ; kāmāvacarakkhandhesu=တို့၌။ ; appahīnānusayitānaṃ=ကုန်သော။ ; kilesānaṃ=တို့၏။ ; kāmāvacarakkhandhāeva=သည်သာလျှင်။ ; vatthu=တည်ရာတည်း။ ; itare=ဤမှ တပါး‌ကုန်သော ရူပါဝစရ အရူပါဝစရခန္ဓာတို့သည်။ ; navatthu=တည်ရာမဟုတ်ကုန်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3203 | Chunk: 53

Esa nayo rūpārūpāvacaresu.

AI Translation based on Nissaya

This same principle applies to the fine-material and immaterial sphere aggregates.

Vietnamese AI Translation

Nguyên tắc tương tự này áp dụng cho các uẩn Sắc giới và Vô sắc giới.

AI Translation Nissaya

rūpārūpāvacaresu=In the case of the fine-material and immaterial sphere aggregates. ; esanayo=this is the method. ;

Myanmar Nissaya

rūpārūpāvacaresu=ရူပါဝစရ အရူပါဝစရ ခန္ဓာတို့၌။ ; esanayo=ရှိ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3204 | Chunk: 53

Sotāpannādīsu pana yassa yassa ariyapuggalassa khandhesu taṃ taṃ vaṭṭamūlaṃ kilesajātaṃ tena tena maggena pahīnaṃ, tassa tassa [P1.172] te te khandhā pahīnānaṃ tesaṃ tesaṃ vaṭṭamūlakānaṃ kilesānaṃ avatthuto bhūmīti saṅkhaṃ na labhanti.

AI Translation based on Nissaya

However, in the case of a stream-enterer or other noble persons, for whichever noble person in whose aggregates this or that mass of defilements which is the root of the round of existence has been abandoned by this or that path, those aggregates of that noble person do not receive the designation `plane` [P1.172] with respect to those abandoned root-defilements, because they are no longer their basis.

Vietnamese AI Translation

Tuy nhiên, trong trường hợp một vị nhập lưu hay các bậc Thánh khác, đối với bất cứ bậc Thánh nào mà trong các uẩn của vị ấy, khối phiền não này hay phiền não kia, vốn là cội rễ của vòng luân hồi, đã bị từ bỏ bởi con đường này hay con đường kia, thì những uẩn đó của vị Thánh ấy không nhận được danh xưng `cõi` [P1.172] đối với những phiền não căn bản đã bị từ bỏ đó, bởi vì chúng không còn là cơ sở của chúng nữa.

AI Translation Nissaya

pana=Regarding the aggregates called 'plane', let it be said. ; sotāpannādīsu=Among the stream-enterers and other noble persons. ; yassa yassa ariyapuggalassa=of whichever noble person. ; khandhesu=in whose aggregates. ; vaṭṭamūlaṃ taṃ taṃ kilesajātaṃ=this or that mass of defilements which is the root of the round of existence. ; tena tena ma‌ggena=by this or that path. ; pahīnaṃ=has been abandoned. ; tassa tassa ariyapuggalassa=of that noble person. ; te te khandhā=those aggregates. ; pahīnānaṃ=of the abandoned. ; vaṭṭamūlakānaṃ tesaṃ tesaṃ kilesānaṃ=of those root-of-existence defilements. ; avatthuto=because they are not the basis. ; bhūmītisaṅkhaṃ=the designation 'plane'. ; nalabhanti=they do not receive. ;

Myanmar Nissaya

pana=ဘူမိမည်သော ခန္ဓာကိုဆိုအံ့။ ; sotāpannādīsu=ပုဂ္ဂိုလ်တို့တွင်။ ; yassa yassa ariyapuggalassa=၏။ ; khandhesu=တို့၌။ ; vaṭṭamūlaṃ=ဝဋ်၏ အကြောင်းရင်းဖြစ်သော။ ; taṃ taṃ kilesajātaṃ=ထိုထိုကိလေသာအပေါင်းကို။ ; tena tena ma‌ggena=ဖြင့်။ ; pahīnaṃ=အပ်ပြီ။ ; tassa tassa ariyapuggalassa=၏။ ; te te khandhā=တို့သည်။ ; pahīnānaṃ=ကုန်ပြီးသော။ ; vaṭṭamūlakānaṃ=ဖြစ်ကုန်သော။ ; tesaṃ tesaṃ kilesānaṃ=တို့၏။ ; avatthuto=တည်ရာ မဟုတ်သောကြောင့်။ ; bhūmītisaṅkhaṃ=ခြင်းကို။ ; nalabhanti=ကုန်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3205 | Chunk: 53

Puthujjanassa sabbaso vaṭṭamūlakilesānaṃ appahīnattā yaṃkiñci kariyamānaṃ kammaṃ kusalamakusalaṃ vā hoti, iccassa kammakilesapaccayāva vaṭṭaṃ vaṭṭati, tassa tasseva taṃ vaṭṭamūlaṃ rūpakkhandheyeva, na vedanādīsu.

AI Translation based on Nissaya

For an ordinary person, because the root-defilements of the round of existence are not abandoned at all, whatever action is performed, whether wholesome or unwholesome, the round turns for this person only because of the conditions of kamma and defilement. It should not be said that for that person that root of the round turns only in the form aggregate, and not in the feeling aggregate and the others.

Vietnamese AI Translation

Đối với một phàm nhân, vì các phiền não căn bản của vòng luân hồi hoàn toàn chưa bị từ bỏ, bất cứ hành động nào được thực hiện, dù thiện hay bất thiện, vòng luân hồi quay chuyển cho người này chỉ vì các điều kiện của nghiệp và phiền não. Không nên nói rằng đối với người đó, cội rễ của vòng luân hồi chỉ quay chuyển trong sắc uẩn, chứ không trong thọ uẩn và các uẩn khác.

AI Translation Nissaya

puthujjaissa=For an ordinary person. ; sabbaso=in all respects. ; vaṭṭamūlakilesānaṃ=of the defilements that are the root of the round of existence. ; appahīnattā=because they are not abandoned. ; yaṃ kiñci kariyamānaṃ kammaṃ=whatever action is done. ; kusalaṃvā=be it wholesome. ; akusalaṃvā=or unwholesome. ; hoti=it is. ; iti evaṃ iminā kāraṇena=Thus for this reason of having unabandoned latent tendencies. ; assa=for that ordinary person. ; kammakilesapaccayāva=only because of the conditions of kamma and defilement. ; vaṭṭaṃ=the round of existence. ; vaṭṭati=turns. ; tassa tasseva=of only that very ordinary person. ; taṃvaṭṭamūlaṃ=that root of the round of existence. ; rūpakkhandheyeva=in the form aggregate alone. ; vaṭṭati=turns. ; vedanādīsu=in the feeling aggregate and others. ; navaṭṭati=it does not turn. ;

Myanmar Nissaya

puthujjaissa=အား။ ; sabbaso=ခပ်သိမ်းစုံအားဖြင့်။ ; vaṭṭamūlakilesānaṃ=ဝဋ်၏ အကြောင်းရင်းဖြစ်သော ကိလေသာတို့၏။ ; vā=တို့ကို။ ; appahīnattā=ကြောင့်။ ; yaṃ kiñci=သော။ ; kariyamānaṃ=ပြုအပ်သော ။ ; kammaṃ=သည်။ ; kusalaṃvā=ကောင်း။ ; akusalaṃvā=ကောင်း။ ; hoti=၏။ ; iti evaṃ iminā kāraṇena=ဤသို့ မပယ်အပ်သေးသော အနုသယရှိခြင်း‌အကြောင်းကြောင့်။ ; assa=ထိုပုထုဇဉ် ပုဂ္ဂိုလ်အား။ ; kammakilesapaccayāva=ကံကိလေသာဟူသော အကြောင်းကြောင့်သာလျှင်။ ; vaṭṭaṃ=ဝဋ်တရားသည်။ ; vaṭṭati=လည်၏။ ; tassa tasseva=ထိုထိုပုထုဇဉ် ပုဂ္ဂိုလ်၏သာလျှင်။ ; taṃvaṭṭamūlaṃ=ထိုဝဋ်၏ အကြောင်းဖြစ်‌သော ကိလေသာသည်။ ; rūpakkhandheyeva=၌သာလျှင်။ ; vaṭṭati=လည်၏။ ; vedanādīsu=ဝေဒနာက္ခန္ဓာ အစရှိသည်တို့၌း။ ; navaṭṭati=မလည်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3206 | Chunk: 53

Viññāṇakkhandheyeva vā, na rūpakkhandhādīsūti na vattabbaṃ.

AI Translation based on Nissaya

Nor should it be said that it turns only in the consciousness aggregate and not in the form aggregate and the others.

Vietnamese AI Translation

Cũng không nên nói rằng nó chỉ quay chuyển trong thức uẩn mà không trong sắc uẩn và các uẩn khác.

AI Translation Nissaya

viññāṇakkhandheyevavā=Or only in the consciousness aggregate. ; vaṭṭati=it turns. ; rūpakkhandhādīsu=in the form aggregate and others. ; navaṭṭati=it does not turn. ; iti=thus. ; navattabbaṃ=it should not be said. ;

Myanmar Nissaya

viññāṇakkhandheyevavā=ဝိညာဏက္ခန္ဓာ၌သာလျှင်လည်း။ ; vaṭṭati=တည်၏။ ; rūpakkhandhādīsu=တို့၌။ ; navaṭṭati=မလည်။ ; iti=သို့။ ; navattabbaṃ=မဆိုအပ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3207 | Chunk: 53

Kasmā ?

AI Translation based on Nissaya

Why is that?

Vietnamese AI Translation

Tại sao lại như vậy?

AI Translation Nissaya

kasmā=Why? ;

Myanmar Nissaya

kasmā=ကား။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3208 | Chunk: 53

Avisesena pañcasupi khandhesu [V1.146] anusayitattā.

AI Translation based on Nissaya

Because they lie latent in all five aggregates [V1.146] without distinction.

Vietnamese AI Translation

Bởi vì chúng nằm tiềm ẩn trong tất cả ngũ uẩn [V1.146] không phân biệt.

AI Translation Nissaya

avisesena=Without distinction. ; pañcasupi khandhesu=in all five aggregates. ; anusayitattā=because they lie latent. ;

Myanmar Nissaya

avisesena=သာမညအားဖြင့်။ ; pañcasupi=ကုန်သော။ ; khandhesu=တို့၌။ ; anusayitattā=ကြောင့်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3209 | Chunk: 53

Kathaṃ ?

AI Translation based on Nissaya

How is this so?

Vietnamese AI Translation

Điều này như thế nào?

AI Translation Nissaya

kathaṃhoti=How is this so? ;

Myanmar Nissaya

kathaṃhoti=အတီသို့ ဖြစ်သနည်းဟူမူကား။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3210 | Chunk: 53

Pathavīrasādi viya rukkhe.

AI Translation based on Nissaya

Like the sap of the earth pervading a tree.

Vietnamese AI Translation

Giống như nhựa cây từ đất thấm khắp một cái cây.

AI Translation Nissaya

pathavīrasādi=The sap of the earth and so on. ; rukkhe=in a tree. ; anugatoviya=is just as it pervades. ;

Myanmar Nissaya

pathavīrasādi=မြေ၏ အရသာ အစရှိသည်သည်။ ; rukkhe=သစ်ပင်၌။ ; anugatoviya=နှံ့သကဲ့သို့ တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3211 | Chunk: 53

Yathā hi mahārukkhe pathavītalaṃ adhiṭṭhāya pathavīrasañca āporasañca nissāya tappaccayā mūlakhandhasākhāpasākhāpallavapalāsapupphaphalehi vaḍḍhitvā nabhaṃ pūretvā yāva kappāvasānā bījaparamparāya rukkhapaveṇiṃ santānayamāne ṭhite taṃ pathavīrasādimūleyeva, na khandhādīsu.

AI Translation based on Nissaya

For example, when a great tree, established on the earth's surface and relying on the sap of earth and water, grows with its root, trunk, branches, twigs, shoots, leaves, flowers, and fruits, filling the sky and continuing its lineage through a succession of seeds until the end of the aeon, it should not be said of that tree that the sap of the earth is only in the root and does not pervade the trunk and other parts.

Vietnamese AI Translation

Ví dụ, khi một cây lớn, đứng vững trên mặt đất và dựa vào nhựa đất và nước, mọc ra rễ, thân, cành, nhánh, chồi, lá, hoa và quả, che kín bầu trời và tiếp nối dòng dõi qua một chuỗi hạt giống cho đến hết kiếp, thì không nên nói về cây đó rằng nhựa đất chỉ ở rễ mà không thấm khắp thân và các bộ phận khác.

AI Translation Nissaya

hi vitthāremi=To elaborate. ; mahārukkhe=a great tree. ; pathavītalaṃ=the surface of the earth. ; adhiṭṭhāya=being established upon. ; pathavīrasañca=the sap of the earth. ; āporasañca=and the sap of water. ; nissāya=relying on. ; tappaccayā=due to that cause of the sap of earth and water. ; mūlakhandhasākhā pasākhāpallavapalāsapupphaphaleti=with root, trunk, branches, twigs, shoots, leaves, flowers, and fruits. ; vaḍḍhitvā=having grown. ; nabhaṃ=the sky. ; pūretvā=filling. ; yāva kappāva sānā=until the end of the aeon. ; bījaparamparāya=through a succession of seeds. ; rukkhapaveṇiṃ=the lineage of the tree. ; santānayamāne ṭhite=while it stands continuing its lineage. ; ṭhite mahārukkhe=in that standing great tree. ; taṃ pathavīrasādi=that sap of the earth and so on. ; mūleyeva=is only in the root. ; (anugato=it pervades). ; khandhādīsu=in the trunk and so on. ; naanugato=it does not pervade. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; mahārukkhe=ကြီးစွာသော သစ်ပင်သည်။ ; pathavītalaṃ=မြေအပြင်ကို။ ; adhiṭṭhāya=လွှမ်းမိုးသော အားဖြင့် တည်၍။ ; pathavīrasañca=မြေ၏ အရသာကိုလည်းကောင်း။ ; vā=မြေကိုမှီ၍ဖြစ်သော အစေးကိုလည်းကောင်း။ ; āporasañca=ရေ၏ အရသာကို လည်းကောင်း။ ; vā=သစ်ပင်ခြုံနွယ်တို့၏ အကြောင်းဖြစ်၍ ဖြစ်သော သသမ္ဘာရ အာပေါ၏ အရသာကိုလည်းကောင်း။ ; nissāya=မှီ၍။ ; tappaccayā=ထိုမြေ, ရေ၏ အရသာဟူသော အကြောင်းကြောင့်။ ; mūlakhandhasākhā pasākhāpallavapalāsapupphaphaleti=အမြစ် ပင်စည် ခက်သေး အခွ အညွန့် အရွက် အပွင့် အသီးတို့ဖြင့်။ ; vaḍḍhitvā=ကြီးပွား၍။ ; nabhaṃ=ကောင်းကင်ကို။ ; pūretvā=ပြည့်စေ၍။ ; yāva kappāva sānā=ကမ္ဘာဆုံးသည်တိုင်အောင်။ ; bījaparamparāya=မျိုးစေ့ အဆက်အနွယ်ဖြင့်။ ; rukkhapaveṇiṃ=သစ်ပင် အဆက်ကို။ ; santānayamāne=အစဉ်ကို ဆောင်လျက်။ ; ṭhite=တည်သည်ရှိသော်။ ; tanaññaḥ= ; ṭhite=တည်သော။ ; mahārukkhe=၌။ ; taṃ pathavīrasādi=ထိုမြေ၏ အရသာ အစရှိသည်သည်။ ; mūleyeva=အမြစ်၌သာလျှင်။ ; (anugato=နှံ့၏။) ; khandhādīsu=ပင်စည် အစရှိသည်တို့၌။ ; naanugato=မနှံ့။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3212 | Chunk: 53

Phaleyeva vā, na mūlādīsūti na vattabbaṃ.

AI Translation based on Nissaya

Nor should it be said that it pervades only the fruit and not the root and other parts.

Vietnamese AI Translation

Cũng không nên nói rằng nó thấm khắp chỉ ở quả mà không ở rễ và các bộ phận khác.

AI Translation Nissaya

phaleyevavā=Or only in the fruit. ; anugato=it pervades. ; mūlādīsu=in the root and so on. ; naanugato=it does not pervade. ; iti=thus. ; navatabbaṃ=it should not be said. ;

Myanmar Nissaya

phaleyevavā=အသီး၌သာလျှင်တည်း။ ; anugato=၏။ ; mūlādīsu=အမြစ်စသည်တို့၌။ ; naanugato=မနှံ့။ ; iti=သို့။ ; navatabbaṃ=မဆိုအပ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3213 | Chunk: 53

Kasmā ?

AI Translation based on Nissaya

Why is that?

Vietnamese AI Translation

Tại sao lại như vậy?

AI Translation Nissaya

kasmā=Why? ;

Myanmar Nissaya

kasmā=ကား။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3214 | Chunk: 53

Avisesena sabbesu mūlādīsu anugatattāti.

AI Translation based on Nissaya

Because it pervades all its parts, the root and so on, without distinction.

Vietnamese AI Translation

Bởi vì nó thấm khắp tất cả các bộ phận của cây, rễ và v.v., không phân biệt.

AI Translation Nissaya

avisesena=Without distinction. ; sabbesu mūlādīsu=in all parts, the root and so on. ; anugatattā=because of its pervasion. ;

Myanmar Nissaya

avisesena=သာမညအားဖြင့်။ ; vā=အထူးမရှိသောအားဖြင့်။ ; sabbesu=ကုန်သော။ ; mūlādīsu=အမြစ် စသည်တို့၌။ ; anugatattā=နှံ့သည်၏ အဖြစ်ကြောင့်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3215 | Chunk: 53

Yathā pana tasseva rukkhassa pupphaphalādīsu nibbinno koci puriso catūsu disāsu maṇḍūkakaṇṭakaṃ nāma visakaṇṭakaṃ ākoṭeyya, atha so rukkho tena visasamphassena phuṭṭho pathavīrasaāporasānaṃ pariyādinnattā appasavadhammataṃ āgamma puna santānaṃ nibbattetuṃ na sakkuṇeyya, evameva khandhappavattiyaṃ nibbinno kulaputto tassa purisassa catūsu disāsu rukkhe visayojanaṃ viya attano santāne catumaggabhāvanaṃ ārabhati.

AI Translation based on Nissaya

But just as a certain man, disgusted with that tree's flowers and fruits, might hammer a poisonous thorn called a 'frog-thorn' into it from the four directions; and then that tree, touched by the contact of that poison, its earth and water saps being exhausted, would reach a state of being unable to flourish and would be unable to produce its lineage again; in exactly the same way, a clansman disgusted with the process of the aggregates undertakes the development of the four paths in his own continuity, like that man's application of poison to the tree from the four directions.

Vietnamese AI Translation

Nhưng cũng như một người nào đó, chán ghét hoa và quả của cây đó, có thể đóng một cái gai độc gọi là 'gai ếch' vào nó từ bốn phương; và sau đó cái cây đó, bị chạm bởi sự tiếp xúc của chất độc đó, nhựa đất và nước bị cạn kiệt, sẽ đạt đến trạng thái không thể phát triển và không thể tạo ra dòng dõi của nó nữa; chính xác theo cách đó, một thiện nam tử chán ghét tiến trình của các uẩn đã thực hành sự phát triển của bốn con đường trong tự thân mình, giống như việc người đàn ông đó dùng thuốc độc cho cây từ bốn phương.

AI Translation Nissaya

vā=because of the state of being pervaded. ; iti idaṃ dhammajāti hotiyathā=just as this natural phenomenon is. ; pana=Now, to state the contrast. ; tasseva rukkhassa=of that very tree. ; pupphaphalādīsu=in its flowers, fruits, etc. ; nibbinno=a disgusted. ; koci puriso=certain man. ; catūsu disāsu=in the four directions. ; maṇḍukakaṇṭakaṃnāma=called 'frog-thorn'. ; visakaṇṭakaṃ=a poisonous thorn. ; ākoṭeyya=might hammer in. ; atha=Then. ; sorukkho=that tree. ; tena visasamphassena=by the contact with that poison. ; phuṭṭho hutvā=having been touched. ; pathavīrasaāporasānaṃ=of the sap of earth and water. ; pariyādinnattā=because of their exhaustion. ; appasavadhammataṃ=to a state of being unable to flourish. ; āgamma=having reached. ; puna=again. ; santānaṃ=its lineage. ; nibbattetuṃ=to produce. ; nasakkuṇeyyayathā=just as it would be unable. ; evameva=in exactly the same way. ; khandhappavattiyaṃ=in the process of the aggregates. ; nibbinno kulaputto=a clansman who is disgusted. ; tassa purisassa=of that man disgusted with the tree. ; catūsu disāsu=in the four directions. ; rukkhe visayojanaṃviya=like the application of poison to the tree. ; atta‌no santāne=in his own continuity. ; catumaggabhāvanaṃ=the development of the four paths. ; ārabhati=undertakes. ;

Myanmar Nissaya

vā=အစဉ်လျှောက်သည်၏ အဖြစ်ကြောင့်။ ; iti idaṃ dhammajāti=ဤသို့သော တရားသဘောသည်။ ; hotiyathā=ကဲ့သို့တည်း။ ; pana=အနွယမှ တပါး ဗျတိရိက်ကို ဆိုအံ့။ ; tasseva rukkhassa=သာလျှင်။ ; pupphaphalādīsu=အပွင့်အသီး စသည်တို့၌။ ; nibbinno=ငြီးငွေ့သော။ ; vā=ဦးလေးသော။ ; koci=သော။ ; puriso=သည်။ ; catūsu=ကုန်သော။ ; disāsu=တို့၌။ ; maṇḍukakaṇṭakaṃnāma=ငါးမန်းစွယ် မည်သော။ ; vā=လိပ်ကျောက်ဆူးမည်သော။ ; visakaṇṭakaṃ=အဆိပ်ရှိသော ဆူးကို။ ; ākoṭeyya=နှက် (ရိုက်သွင်း)ရာ၏။ ; atha=ထိုသို့နှက်သော အခါ၌။ ; sorukkho=သည်။ ; tena visasamphassena=ထိုငါးမန်းစွယ်၊ လိပ် ကျောက်ဆူး၏ အဆိပ်၏ တွေ့ခြင်းဖြင့်။ ; phuṭṭho=တွေ့သည်။ ; hutvā=၍။ ; pathavīrasaāporasānaṃ=မြေ၏ အရသာ, ရေ၏ အရသာတို့၏။ ; pariyādinnattā=ကုန်ခန်းသည်၏ အဖြစ်ကြောင့်။ ; appasavadhammataṃ=မပွားစိးသော သဘောရှိသည်၏ အဖြစ်ကို။ ; vā=သို့။ ; āgamma=စွဲ၍။ ; vā=ရောက်၍။ ; puna=ဖန်။ ; santānaṃ=အစဉ်ကို။ ; vā=မျို‌စေ့ အဆက်ဆက် သစ်ပင်အဆက်ဆက်ကို။ ; nibbattetuṃ=ခြင်းငှါ။ ; nasakkuṇeyyayathā=သကဲ့သို့။ ; evameva=သာလျှင်။ ; khandhappavattiyaṃ=ဥပါဒါနက္ခန္ဓာတို့၏ ဖြစ်ခြင်း၌။ ; nibbinno=ငြီးငွေ့သော။ ; vā=ဦးလေးသော။ ; kulaputto=ဇာတိကုလပုတ္တ, အာစာရ ကုလပုတ္တသည်။ ; tassa purisassa=ထိုသစ်ပင်၌ ငြီးငွေ့သော ယောင်္ကျား၏။ ; catūsu=ကုန်သော။ ; disāsu=တို့၌။ ; rukkhe=၌။ ; visayojanaṃviya=အဆိပ်ကို ယှဉ်ခြင်းကဲ့သို့။ ; atta‌no=၏။ ; santāne=၌။ ; catumaggabhāvanaṃ=လေးပါးသောမဂ်ကို ပွားစေခြင်းကို။ ; vā=လေးပါးသော မဂ်၏ ပွားခြင်းကို။ ; ārabhati=အားထုတ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3216 | Chunk: 53

Athassa so khandhasantāno tena catumaggavisasamphassena sabbaso vaṭṭamūlakilesānaṃ pariyādinnattā kiriyasabhāvamattaṃ [M1.160] upagatakāyakammādisabbakammappabhedo hutvā āyatiṃ punabbhavānabhinibbattanadhammataṃ āgamma bhavantarasantānaṃ nibbattetuṃ na sakkoti, kevalaṃ carimaviññāṇanirodhena nirindhano viya jātavedo anupādāno parinibbāyati.

AI Translation based on Nissaya

Then, that continuity of aggregates of his, due to contact with the 'poison' of the four paths, and because the root-defilements of the round of existence are completely exhausted, having all its various kinds of kamma (bodily, etc.) become merely functional [M1.160], it reaches a state where it does not produce a new existence in the future. It is unable to produce a continuity in another existence. With the cessation of the final consciousness, like a fire without fuel, it attains final Nibbāna without any more clinging.

Vietnamese AI Translation

Rồi, sự liên tục của các uẩn của người ấy, do tiếp xúc với 'thuốc độc' của bốn đạo, và vì các phiền não căn bản của vòng luân hồi hoàn toàn cạn kiệt, với tất cả các loại nghiệp khác nhau (thân, v.v.) của nó trở thành chỉ là hoạt động chức năng [M1.160], nó đạt đến trạng thái không tạo ra một sự tồn tại mới trong tương lai. Nó không thể tạo ra sự liên tục trong một sự tồn tại khác. Với sự chấm dứt của thức cuối cùng, như lửa không còn nhiên liệu, nó đạt đến Niết Bàn cuối cùng mà không còn bất kỳ sự bám víu nào nữa.

AI Translation Nissaya

atha tasmiṃ kāle=Then at that time of undertaking. ; assa=of that clansman. ; sokhandha santāno=that continuity of aggregates. ; tena catumaggavisasamphassena=due to the contact with the 'poison' of the four paths. ; sabbasā=completely. ; vaṭṭamūlakilesānaṃ=of the defilements that are the root of the round of existence. ; pariyādinnattā=because they are exhausted. ; kiriyasabhāvamattaṃ upagatakāyakammādi sabbakammapabhedo=having all its varieties of bodily action, etc., reached a state of mere functional consciousness. ; hutvā=having become. ; āyatiṃ=in the future. ; punabbhavānabhinibbattanadhammataṃ=to the nature of not producing a new existence again. ; āgamma=having reached. ; bhavantarasantānaṃ=a continuity in another existence. ; nibbattetuṃ=to produce. ; nasakkoti=is not able. ; kevalaṃ=merely. ; carimaviññāṇanirodhena=with the cessation of the final consciousness. ; nirundhano jātavedoviya=like a fire without fuel. ; anupādāno=without clinging. ; parinibbāyati=attains final Nibbāna. ;

Myanmar Nissaya

atha tasmiṃ kāle=ထိုအားထုတ်သော အခါ၌။ ; assa=ထိုဇာတိကုလပုတ္တ, အာစာရကုလပုတ္တ၏။ ; sokhandha santāno=ထိုခန္ဓာအစဉ်သည်။ ; tena catumaggavisasamphassena=ထိုမဂ်လေးပါးတည်းဟူသော အဆိပ်၏ တွေ့ခြင်းကြောင့်။ ; sabbasā=အားဖြင့်။ ; vaṭṭamūlakilesānaṃ=ဝဋ်၏ အကြောင်းဖြစ်သော ကိလေသာတို့၏။ ; pariyādinnattā=ကုန်သည်၏ အဖြစ်ကြောင့်။ ; kiriyasabhāvamattaṃ=ကြိယာဇော၏ သဘောမျှသို့။ ; upagatakāyakammādi sabbakammapabhedo=ရောက်သော ကာယကံ အစရှိသော ဥဿုံသော ကံအပြားရှိသည်။ ; hutvā=၍။ ; āyatiṃ=၌။ ; punabbhavānabhinibbattanadhammataṃ=တဖန်ဘဝသစ်သို့မဖြစ်စေခြင်း သဘောရှိသည်၏ အဖြစ်သို့။ ; vā=ကို။ ; āgamma=ရောက်၍။ ; vā=စွဲ၍။ ; bhavantarasantānaṃ=ဘဝတပါး၌ အစဉ်ကို။ ; vā=ဘဝတပါးတည်းဟူသော အစဉ်ကို ။ ; nibbattetuṃ=ငှါ။ ; nasakkoti=နိုင်။ ; kevalaṃ=သက်သက်။ ; carimaviññāṇanirodhena=အဆုံးဖြစ်သော ဝိညာဉ်၏ ချုပ်ခြင်းကြောင့်။ ; vā=စုတိစိတ်၏ချုပ်ခြင်း ကြောင့်။ ; nirundhano=မီးစာမရှိသော။ ; jātavedoviya=မီးကဲ့သို့။ ; anupādāno=ဥပါဒါန်တရားမရှိသည်ဖြစ်၍။ ; vā=ရူပက္ခန္ူာ အစရှိသည်တို့၌ စွဲလမ်းခြင်း မရှိသည်ဖြစ်၍။ ; parinibbāyati=ပရိနိဗ္ဗာန်ပြုရ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3217 | Chunk: 53

Evaṃ bhūmiyā bhūmiladdhassa ca nānattaṃ veditabbaṃ.

AI Translation based on Nissaya

In this way, the difference between 'plane' and 'plane-obtained' should be understood.

Vietnamese AI Translation

Theo cách này, sự khác biệt giữa 'cõi' và 'đạt được cõi' cần phải được hiểu.

AI Translation Nissaya

evaṃ=Thus. ; bhūmiyā=of 'plane'. ; bhūmiladdhassaca=and of 'plane-obtained'. ; nānattaṃ=the difference. ; veditabbaṃ=should be understood. ;

Myanmar Nissaya

evaṃ=သို့။ ; bhūmiyā=ဘူမိ၏ လည်းကောင်း။ ; bhūmiladdhassaca=ဘူမိလဒ္ဓ၏လည်းကောင်း။ ; nānattaṃ=အထူးကို။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3218 | Chunk: 53

Aparampi catubbidhaṃ uppannaṃ samudācāruppannaṃ ārammaṇādhiggahituppannaṃ [P1.173] avikkhambhituppannaṃ asamūhatuppannanti.

AI Translation based on Nissaya

Furthermore, the 'arisen' is fourfold: arisen as manifest, arisen through grasping an object [P1.173], arisen through not being suppressed, and arisen through not being eradicated.

Vietnamese AI Translation

Hơn nữa, 'sanh khởi' có bốn loại: sanh khởi như là hiển hiện, sanh khởi do nắm bắt đối tượng [P1.173], sanh khởi do không bị đàn áp, và sanh khởi do không bị diệt trừ.

AI Translation Nissaya

aparampi=Furthermore. ; uppannaṃ=the 'arisen'. ; samudācāruppannaṃ=as arisen as manifest. ; ārammaṇādhiggahituppannaṃ=as arisen through grasping an object. ; avikkhambhituppannaṃ=as arisen through not being suppressed. ; asamuhatuppannaṃ=and as arisen through not being eradicated. ; iti=thus. ; catubbidhaṃ=is fourfold. ;

Myanmar Nissaya

aparampi=ဖြစ်သော။ ; uppannaṃ=ဥပ္ပန္နသည်။ ; samudācāruppannaṃ=လည်းကောင်း။ ; ārammaṇādhiggahituppannaṃ=လည်းကောင်း။ ; avikkhambhituppannaṃ=လည်းကောင်း။ ; asamuhatuppannaṃ=လည်းကောင်း။ ; iti=သို့။ ; catubbidhaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3219 | Chunk: 54

Tattha vattamānuppannameva samudācāruppannaṃ.

AI Translation based on Nissaya

Among these, the presently arisen itself is the 'arisen as manifest'.

Vietnamese AI Translation

Trong số này, chính cái hiện tại sanh khởi là 'sanh khởi như là hiển hiện'.

AI Translation Nissaya

tattha=Among these. ; vattamānuppannameva=the presently arisen itself. ; samudācāruppannaṃ=is called 'arisen as manifest'. ;

Myanmar Nissaya

tattha=တို့တွင်။ ; vattamāppannameva=သည်ပင်လျှင်။ ; samudācāruppannaṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3220 | Chunk: 54

Cakkhādīnaṃ pana āpāthagate ārammaṇe pubbabhāge anuppajjamānampi kilesajātaṃ ārammaṇassa adhiggahitattā eva aparabhāge ekantena uppattito ārammaṇādhiggahituppannan ti vuccati.

AI Translation based on Nissaya

Now, regarding an object that has come into the range of the eye and so on, even though the mass of defilements has not yet arisen in the preliminary stage, just because the object has been grasped, it is called 'arisen through grasping an object' since it will certainly arise in a later stage when conditions are met.

Vietnamese AI Translation

Giờ đây, đối với một đối tượng đã đi vào tầm mắt và v.v., mặc dù khối phiền não chưa sanh khởi trong giai đoạn sơ khởi, nhưng chỉ vì đối tượng đã bị nắm giữ, nó được gọi là 'sanh khởi do nắm bắt đối tượng' vì nó chắc chắn sẽ sanh khởi trong giai đoạn sau khi các điều kiện được đáp ứng.

AI Translation Nissaya

pana=Now, as for 'arisen through grasping an object'. ; cakkhādīnaṃ=of the eye, etc. ; āpāthagate=when it has come into the range. ; ārammaṇe=of the object. ; pubbabhāge=in the preliminary stage before the defilement arises. ; anuppajjamānampi=even though not yet arisen. ; kilesajātaṃ=the mass of defilements. ; ārammaṇassa=of the object. ; adhiggahitattāeva=just because of it having been grasped. ; aparabhāge=in a later stage. ; ekantena=certainly. ; uppattito=because it will arise when conditions are met. ; arammaṇāmiggahituppannanti=is called 'arisen through grasping an object'. ; vuccati=it is said. ;

Myanmar Nissaya

pana=အာရမ္မဏာဓိဂ္ဂဟိတုပ္ပန္နကိုဆိုအံ့။ ; cakkhādīnaṃ=စက္ခုအစရှိသည်တို့ကို။ ; āpāthagate=ထင်ခြင်း သို့ရောက်သော်။ ; ārammaṇe=၌။ ; tanaññaḥ= ; arammaṇe=သည်။ ; āpāthagate=သော။ ; pubbabhāge=ကိလေသာဖြစ်သည်မှ ရှေးအဖို့၌။ ; vā=ရှေးအဖို့၌ ဖြစ်‌သော ဘဝင်္ဂစလန ဘဝင်္ဂုပစ္ဆေဒ ပဉ္စဒွါရာ ဝဇ္ဇန်း၊ စက္ခုဝိညာဉ် သမ္ပဋိစ္ဆိုင်း သန္တီရဏ ဝုဋ္ဌော၌။ ; vā=ရှေးအဖို့၌ ဖြစ်သော အာရုံကို ယူတတ်သော ဇောမှ စ၍ အောက်မေ့တတ်သော ဇောဖြစ်သော ကာလ၌။ ; (ဂဏ္ဌိနှင့်အညီ။) ; vā=ရှေးအဖို့၌ ဖြစ်သော အာရုံ အစဖြစ်သော ဇောဝါရ၌။ ; (ဝိသုဒ္ဓိမဂ်ဋီကာ)။ ; anuppajjamānampi=မဖြစ်သေးသည်လည်း ဖြစ်သော။ ; vā=မဖြစ်သေးမူလျှ မူလည်း။ ; kilesajātaṃ=ကိလေသာအပေါင်းကို။ ; ārammaṇassa=၏။ ; vā=ကို။ ; adhiggahitattāeva=နှိမ်နင်းလွှမ်းမိုး၍ ယူခြင်းကြောင့်သာလျှင်။ ; vā=‌ယောနိသောမနသိကာရကို နှိမ်နင်း၍ မသင့်သောအားဖြင့် အာရုံပြုအပ်သည်၏ အဖြစ်ကြောင့်သာလျှင်။ ; (ဂဏ္ဌိ)။ ; vā=ယောနိသောမနသိကာရအားဖြင့် ထည့်၍ ယူအပ်သည်၏ အဖြစ်ကြောင့်သာလျှင်။ ; (ဝိသုဒ္ဓိမဂ်ဋီကာ။) ; aparabhāge=အဖို့၌။ ; ekantena=အားဖြင့်။ ; uppattito=အကြောင်းညီညွတ်သဖြင့် ဖြစ်လတ္တံ့သောကြောင့်။ ; arammaṇāmiggahituppannanti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3221 | Chunk: 54

Samathavipassanānaṃ aññataravasena avikkhambhitaṃ kilesajātaṃ cittasantatimanārūḷhampi uppattinivārakassa hetuno abhāvā avikkhambhituppannaṃ nāma.

AI Translation based on Nissaya

The mass of defilements that has not been suppressed by means of either serenity or insight is called 'arisen through not being suppressed' because, even though it has not yet entered the stream of consciousness, there is an absence of a cause that would prevent its arising.

Vietnamese AI Translation

Khối phiền não mà chưa bị đàn áp bằng thiền định hay tuệ quán được gọi là 'sanh khởi do không bị đàn áp' bởi vì, mặc dù nó chưa đi vào dòng tâm thức, vẫn không có nguyên nhân nào ngăn cản sự sanh khởi của nó.

AI Translation Nissaya

samatha vipassanānaṃ=of serenity and insight. ; aññataravasena=by means of one or the other. ; avikkhambhitaṃ=not suppressed. ; kilesajātaṃ=the mass of defilements. ; cittasantatiṃ=into the stream of consciousness. ; anārūḷampi=even though it has not yet ascended. ; hetuno=of a cause that would prevent its arising. ; abhāvā=due to the absence. ; avikkhambhituppannaṃnāma=is called 'arisen through not being suppressed'. ;

Myanmar Nissaya

samatha vipassanānaṃ=တို့၏။ ; aññataravasena=တပါးပါး၏ အစွမ်းဖြင့်။ ; avikkhambhitaṃ=မခွာအပ်သေးသော။ ; kilesajātaṃ=သည်။ ; cittasantatiṃ=အစဉ်သို့။ ; anārūḷampi=မတက်သေးသော်လည်း။ ; hetuno=အကြောင်း၏။ ; abhāvā=ကြောင့်။ ; avikkhambhituppannaṃnāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3222 | Chunk: 54

Samathavipassanāvasena pana vikkhambhitampi ariyamaggena asamūhatattā uppattidhammataṃ anatītattā asamūhatuppannan ti vuccati.

AI Translation based on Nissaya

Now, even a defilement that has been suppressed by means of serenity and insight is called 'arisen through not being eradicated' because it has not been eradicated by the noble path and has not gone beyond its inherent nature of arising.

Vietnamese AI Translation

Giờ đây, ngay cả một phiền não đã bị đàn áp bằng thiền định và tuệ quán cũng được gọi là 'sanh khởi do không bị diệt trừ' bởi vì nó chưa bị diệt trừ bởi Thánh đạo và chưa vượt ra khỏi bản chất cố hữu của nó là sanh khởi.

AI Translation Nissaya

pana=Now, as for 'arisen through not being eradicated'. ; samathavipassanāvasena=by means of serenity and insight. ; vikkhambhitampi=even a defilement that has been suppressed. ; ariyamaggena=by the noble path. ; asamūhatattā=because of not being eradicated. ; uppattidhammataṃ=the nature of arising. ; anatītattā=because of not having gone beyond. ; asamūhatuppannanti=is called 'arisen through not being eradicated'. ; vuccati=it is said. ;

Myanmar Nissaya

pana=အသမူဟတုပ္ပန္နကို ဆိုအံ့။ ; samathavipassanāvasena=ဖြင့်။ ; vikkhambhitampi=ခွာအပ်ပြီးသော ကိလေသာကိုလည်း။ ; ariyamaggena=ဖြင့်။ ; vā=သည်။ ; asamūhatattā=မပယ်အပ်သေးသည်၏ အဖြစ်ကြောင့်။ ; uppattidhammataṃ=ဖြစ်ခြင်းသဘောရှိသည်၏ အဖြစ်ကို။ ; anatītattā=မလွန်သေးသည်၏ အဖြစ်ကြောင့်။ ; asamūhatuppannanti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3223 | Chunk: 54

Tividhampi cetaṃ ārammaṇādhiggahitāvikkhambhitāsamūhatuppannaṃ bhūmiladdheneva saṅgahaṃ gacchatīti veditabbaṃ.

AI Translation based on Nissaya

Furthermore, it should be understood that these three kinds—arisen through grasping an object, arisen through not being suppressed, and arisen through not being eradicated—are included only under 'arisen by gaining a plane'.

Vietnamese AI Translation

Hơn nữa, cần phải hiểu rằng ba loại này—sanh khởi do nắm bắt đối tượng, sanh khởi do không bị đàn áp, và sanh khởi do không bị diệt trừ—chỉ được bao gồm trong 'sanh khởi do đạt được cõi'.

AI Translation Nissaya

ca=Furthermore. ; tividhampi=all three kinds. ; etaṃ ārammaṇādhiggahitāvikkhambhitāsamūhatuppannaṃ=these: arisen through grasping an object, arisen through not being suppressed, and arisen through not being eradicated. ; bhūmiladdheneva=only by 'arisen by gaining a plane'. ; saṅgahaṃ=into the inclusion. ; gacchati=it goes. ; iti=thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

ca=ဆိုဖွယအထူးကို ဆိုအံ့။ ; tividhampi=သော။ ; etaṃ ārammaṇādhiggahitāvikkhambhitāsamūhatuppannaṃ=အမူဟတုပ္ပန္နသည်။ ; bhūmiladdheneva=ဘူမိလဒ္ဓုပ္ပန္န ဖြင့်သာလျှင်။ ; saṅgahaṃ=သို့။ ; gacchati=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3224 | Chunk: 54

Iccetasmiṃ vuttappabhede uppanne yadetaṃ vattamānabhūtāpagatokāsakatasamudācārasaṅkhātaṃ uppannaṃ, taṃ amaggavajjhattā kenaci maggañāṇena pahātabbaṃ na hoti.

AI Translation based on Nissaya

Thus, within these explained divisions of the 'arisen', whatever is designated as presently arisen, arisen as past, arisen by opportunity, and arisen as manifest—that is not to be abandoned by any path-knowledge, because it is not something to be eliminated by the path.

Vietnamese AI Translation

Như vậy, trong những phân loại đã giải thích của 'sanh khởi' này, bất cứ điều gì được gọi là hiện tại sanh khởi, sanh khởi như quá khứ, sanh khởi do cơ hội, và sanh khởi như hiển hiện—thì không phải là thứ để bị từ bỏ bởi bất kỳ đạo tuệ nào, bởi vì nó không phải là thứ để bị loại bỏ bởi đạo.

AI Translation Nissaya

iti iminā vuttanayena=In this way that has been explained. ; vuttappabhede=in the explained divisions. ; etasmiṃ uppanne=in these arisen phenomena. ; vā=or, in the eight kinds of arisen. ; vattamānabhūtāpagatokāsakatasamudācārasaṅkhātaṃ=that which is called presently arisen, arisen as past, arisen by opportunity, and arisen as manifest. ; yadetaṃ yaṃ etaṃ uppannaṃ=whatever 'arisen' phenomenon. ; atthi=there is. ; taṃ=that fourfold arisen. ; amaggavajjhattā=because it is not something to be eliminated by the path. ; kenaci maggañāṇena=by any path-knowledge. ; pahātabbaṃ=to be abandoned. ; na‌hoti=is not. ;

Myanmar Nissaya

iti iminā vuttanayena=ဖြင့်။ ; vuttappabhede=ရှိသော။ ; etasmiṃ uppanne=ထိုလေးပါးသော ဥပ္ပန္န၌။ ; vā=ရှစ်ပါးသော ဥပ္ပန္န၌။ ; vattamānabhūbhāpagatokāsakatasamudācārasaṅkhātaṃ=ဝတ္တမာ နုပ္ပန္န, ဘူတာပဂတုပ္ပန္န, ဩကာသကတုပ္ပန္န သမုဒါစာရုပ္ပန္န ဟု ဆိုအပ်သော။ ; yadetaṃ yaṃ etaṃ uppannaṃ=အကြင်ဥပ္ပန္နသည်။ ; atthi=၏။ ; taṃ=ထိုလေးပါးသော ဥပ္ပန္နကို။ ; vā=သည်။ ; amaggavajjhattā=မဂ်သည် မသတ်အပ်သည်၏ အဖြစ်ကြောင့်။ ; kenaci maggañāṇena=တစုံတခုသော မဂ်ဉာဏ်ဖြင့်။ ; vā=သည်။ ; pahātabbaṃ=ပယ်အပ်သည်။ ; na‌hoti=မဖြစ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3225 | Chunk: 54

Yaṃ panetaṃ bhūmiladdhārammaṇādhiggahitāvikkhambhitāsamūhatasaṅkhātaṃ uppannaṃ, tassa taṃ uppannabhāvaṃ nāsayamānaṃ yasmā taṃ taṃ lokiyalokuttarañāṇaṃ uppajjati, tasmā taṃ sabbampi pahātabbaṃ hotīti.

AI Translation based on Nissaya

However, whatever is designated as 'arisen by gaining a plane', 'arisen by grasping an object', 'arisen through not being suppressed', or 'arisen through not being eradicated'—because this or that mundane or supramundane knowledge arises destroying its potential to arise, therefore all of that is to be abandoned.

Vietnamese AI Translation

Tuy nhiên, bất cứ điều gì được gọi là 'sanh khởi do đạt được cõi', 'sanh khởi do nắm bắt đối tượng', 'sanh khởi do không bị đàn áp', hay 'sanh khởi do không bị diệt trừ'—bởi vì tuệ thế gian hay siêu thế này hay tuệ khác sanh khởi hủy diệt tiềm năng sanh khởi của nó, do đó tất cả điều đó phải bị từ bỏ.

AI Translation Nissaya

pana=However, as for that which is to be abandoned. ; bhūmiladdhārammaṇādhiggahitāvikkhambhitāsamūhatasaṅkhātaṃ=that which is called arisen by gaining a plane, arisen by grasping an object, arisen through not being suppressed, and arisen through not being eradicated. ; yaṃ etaṃ uppannaṃ=whatever 'arisen'. ; atthi=there is. ; tassa=of that fourfold 'arisen'. ; taṃ uppannabhāvaṃ=that state of being fit to arise. ; nāsayamānaṃ=destroying. ; yasmā=because. ; taṃ taṃ lokiyalokuttarañāṇaṃ=this or that mundane and supramundane knowledge. ; uppajjati=arises. ; tasmā=therefore. ; taṃsabbampi=all that—arisen by gaining a plane, arisen by grasping an object, arisen through not being suppressed, and arisen through not being eradicated. ; pahātabbaṃ=is to be abandoned. ; hoti=is. ;

Myanmar Nissaya

pana=ပယ်အပ်သည်ကို ဆိုအံ့။ ; bhūmiladdhārammaṇādhiggahitāvikkhambhitāsamūhatasaṅkhātaṃ=ဘူမိလဒ္ဓုပ္ပန္န, အာရမ္မဏာဓိဂ္ဂဟိတုပ္ပန္န, အဝိက္ခမ္ဘိတုပ္ပန္န, အသမူဟတုပ္ပန္န ဟု ဆိုအပ်သော။ ; yaṃ etaṃ uppannaṃ=သည်။ ; atthi=၏။ ; tassa=ထိုလေးပါးသော ဥပ္ပန္န၏။ ; taṃ uppannabhāvaṃ=ထိုသို့ ဖြစ်ခြင်းငှါ ထိုက်သည်၏ အဖြစ်ကို။ ; nāsayamānaṃ=ဖျက်ဆီးလျက်။ ; yasmā=ကြောင့်။ ; taṃ taṃ lokiyalokuttarañāṇaṃ=ဉာဏ်သည်။ ; uppajjati=၏။ ; tasmā=ကြောင့်။ ; taṃsabbampi=ထိုဥဿုံသော ဘူမိလဒ္ဓုပ္ပန္န အာရမ္မဏာဓိဂ္ဂဟိတုပ္ပန္န အဝိက္ခမ္ဘိတုပ္ပန္န အသမူဟ- တုပ္ပန္နကိုလည်း။ ; pahātabbaṃ=ပယ်အပ်သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3226 | Chunk: 54

Evaṃ ye maggo kilese pajahati, te sandhāya ‘‘uppannānan’’ tiādi vuttaṃ.

AI Translation based on Nissaya

In this way, the passage beginning with "of the arisen" was spoken with reference to those defilements that the path abandons.

Vietnamese AI Translation

Theo cách này, đoạn văn bắt đầu với "của cái đã sanh khởi" được nói với sự đề cập đến những phiền não mà con đường từ bỏ.

AI Translation Nissaya

evaṃ=In this way. ; maggo=the path. ; ye kilese=which defilements. ; pajahati=abandons. ; te=those defilements. ; sandhāya=with reference to. ; uppannānantiādi=the passage beginning with 'of the arisen'. ; vuttaṃ=was spoken. ;

Myanmar Nissaya

evaṃ=ဤဆိုအပ်ပြီးသော နည်းဖြင့်။ ; maggo=သည်။ ; ye kilese=တို့ကို။ ; pajahati=ပယ်၏။ ; te=ထိုကိလေသာတို့ကို။ ; sandhāya=၍။ ; uppannānantiādi=ကို။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3227 | Chunk: 54

Atha [V1.147] maggakkhaṇe kathaṃ anuppannānaṃ kusalānaṃ uppādāya bhāvanā hoti, kathañca uppannānaṃ ṭhitiyāti ?

AI Translation based on Nissaya

If that is so, at the moment of the path, how is there development for the arising of unarisen wholesome states, and how is there development for the stability of arisen ones?

Vietnamese AI Translation

Nếu vậy, tại sát na đạo, làm thế nào có sự phát triển cho sự sanh khởi của các thiện pháp chưa sanh khởi, và làm thế nào có sự phát triển cho sự an trú của các pháp đã sanh khởi?

AI Translation Nissaya

atha=If that is so. ; maggakkhaṇe=at the moment of the path. ; kathaṃ=how. ; anuppannānaṃ=of unarisen. ; kusalānaṃ=wholesome states. ; uppādāya=for the arising. ; bhāvanā=is there development. ; hoti=is there. ; kathañca=and how. ; uppannānaṃ=of arisen. ; kusalānaṃ=wholesome states. ; ṭhitiyā=for the stability. ; hoti=is there. ; iti ayaṃ=this is. ; pucchā=the question. ;

Myanmar Nissaya

atha=ထိုသို့ ဖြစ်ခဲ့သည်ရှိသော်။ ; maggakkhaṇe=၌။ ; kathaṃ=သို့လျှင်။ ; anuppannānaṃ=ကုန်သေးသော။ ; kusalānaṃ=တို့ကို။ ; uppādāya=ခြင်းငှါ။ ; bhāvanā=ပွားခြင်းသည်။ ; hoti=နည်း။ ; kathañca=သို့လျှင်။ ; uppannānaṃ=ကုန်ပြီးသော။ ; kusalānaṃ=တို့၏။ ; ṭhitiyā=ခြင်းငှါ။ ; hoti=နည်း။ ; iti ayaṃ=ကား။ ; pucchā=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3228 | Chunk: 54

Maggappavattiyā eva.

AI Translation based on Nissaya

Through the very occurrence of the path.

Vietnamese AI Translation

Thông qua sự xảy ra của chính đạo.

AI Translation Nissaya

maggappavattiyāeva=through the very occurrence of the path. ; bhāvanā=the development. ; hoti=occurs. ;

Myanmar Nissaya

maggappavattiyāeva=မဂ်ဖြစ်သဖြင့် သာလျှင်။ ; bhāvanā=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3229 | Chunk: 54

Maggo hi pavattamāno pubbe anuppannapubbattā anuppanno nāma vuccati.

AI Translation based on Nissaya

To explain, the path, while occurring, is called 'unarisen' because it had never arisen before its own moment of arising.

Vietnamese AI Translation

Để giải thích, đạo, trong khi xảy ra, được gọi là 'chưa sanh khởi' bởi vì nó chưa từng sanh khởi trước sát na sanh khởi của chính nó.

AI Translation Nissaya

hi vitthāremi=To explain. ; maggo=the path. ; pavattamāno=while occurring. ; pubbe=before the arising of the path. ; anuppannapubbattā=because of not having arisen before. ; anuppannonāma=is called 'unarisen'. ; iti=thus. ; vuccati=it is said. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; maggo=သည်။ ; pavattamāno=ရှိသော်။ ; pubbe=မဂ်ဥပါဒ်သည်မှ ရှေ့၌။ ; anuppannapubbattā=မဖြစ်ဖူးသေး သည်၏အဖြစ်ကြောင့်။ ; anuppannonāma=အနုပ္ပန္နမည်၏။ ; iti=သို့။ ; (ဣတိ ကား ဂမျမာန်။) ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3230 | Chunk: 54

Anāgatapubbañhi ṭhānaṃ āgantvā ananubhūtapubbaṃ vā ārammaṇaṃ anubhavitvā vattāro bhavanti ‘‘anāgataṭṭhānaṃ āgatamha, ananubhūtaṃ ārammaṇaṃ anubhavāmā’’ ti.

AI Translation based on Nissaya

Indeed, having arrived at a place never visited before or having experienced an object never experienced before, people say, "We have come to a place never visited before; we are experiencing an object never experienced before."

Vietnamese AI Translation

Thật vậy, khi đã đến một nơi chưa từng đến trước đây hoặc đã kinh nghiệm một đối tượng chưa từng kinh nghiệm trước đây, người ta nói: “Chúng ta đã đến một nơi chưa từng đến trước đây; chúng ta đang kinh nghiệm một đối tượng chưa từng kinh nghiệm trước đây.”

AI Translation Nissaya

hi saccaṃ=Indeed. ; anāgatapubbaṃ=to a place never gone to before. ; ṭhānaṃ=to a place. ; āgantvāvā=having gone, or. ; ananubhūtapubbaṃ=never experienced before. ; ārammaṇaṃ=an object. ; anubhavitvāvā=having experienced, or. ; vattāro=speakers. ; bhavanti=are. ; kiṃbhavanti=What do they say? ; anāgataṭṭhānaṃ=to a place never gone to before. ; āgatā=we have come. ; amha=we are. ; ananubhūtaṃ=never experienced before. ; ārammaṇaṃ=an object. ; anubhavāma=we experience. ; iti=thus. ; vattāro=they say. ; bhavanti=they are. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; hi saccaṃ=၏။ ; anāgatapubbaṃ=မရောက်ဖူးသော။ ; ṭhānaṃ=အရပ်သို့။ ; āgantvāvā=ရောက်၍ လည်းကောင်း။ ; ananubhūtapubbaṃ=မခံစားဖူးသေးသော။ ; ārammaṇaṃ=ကို။ ; anubhavitvāvā=ခံစား၍ လည်းကောင်း။ ; vattāro=ပြောဆိုတတ်ကုန်သည်။ ; bhavanti=ကုန်၏။ ; kiṃbhavanti=ကား။ ; anāgataṭṭhānaṃ=မရောက်ဖူးသော အရပ်သို့။ ; āgatā=ရောက်ရပေကုန်သည်။ ; amha=ဖြစ်ကုန်ပြီ။ ; ananubhūtaṃ=မခံစားဖူးသေးသော။ ; ārammaṇaṃ=ကို။ ; anubhavāma=ကုန်၏။ ; iti=သို့။ ; vattāro=ကုန်သည်။ ; bhavanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3231 | Chunk: 54

Yāvassa pavatti, ayameva ṭhiti nāmāti ṭhitiyā bhāvetītipi vattuṃ vaṭṭati.

AI Translation based on Nissaya

As long as its occurrence lasts, this very occurrence is called 'stability'. Therefore, it is also appropriate to say that it 'develops for the stability' of wholesome states that have arisen.

Vietnamese AI Translation

Chừng nào sự xảy ra của nó còn kéo dài, chính sự xảy ra này được gọi là 'an trú'. Do đó, cũng thích hợp để nói rằng nó 'phát triển cho sự an trú' của các thiện pháp đã sanh khởi.

AI Translation Nissaya

yāva=As long as. ; assa=its (the path of Arahantship's). ; pavatti=occurrence. ; atthi=exists. ; ayameva=this very occurrence. ; ṭhitināma=is called stability. ; ititasmā=therefore. ; ṭhitiyā=for the stability of arisen wholesome states. ; vā=or to make stable the arisen wholesome states. ; bhāveti=it develops. ; itipi=thus also. ; vattuṃ=to say. ; vaṭṭati=is appropriate. ;

Myanmar Nissaya

yāva=မျှလောက်။ ; assa=ထိုအရဟတ္တမဂ်စိတ်၏။ ; pavatti=ခြင်းသည်။ ; atthi=ရှိ ; ayameva=ဤသို့ ဖြစ်ခြင်းသည်သာလျှင်။ ; ṭhitināma=တည်ခြင်းတည်၏။ ; ititasmā=ကြောင့်။ ; ṭhitiyā=ဖြစ်ပြီးသော ကုသိုလ်တရားတို့၏ တည်ခြင်းငှါ။ ; vā=ဖြစ်ပြီးသော ကုသိုလ်တရားတို့ကို တည်စေခြင်းငှါ။ ; bhāveti=ပွား‌စေ၏။ ; itipi=သို့လည်း။ ; vattuṃ=ငှါ။ ; vaṭṭati=သင့်ပါသတည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3232 | Chunk: 54

Evametassa bhikkhuno idaṃ lokuttaramaggakkhaṇe ekameva vīriyaṃ ‘‘anuppannānaṃ [M1.161] pāpakānaṃ akusalānaṃ dhammānaṃ anuppādāyā’’ tiādīni cattāri nāmāni labhati.

AI Translation based on Nissaya

In this way, at the moment of the supramundane path, this one and the same energy of the monk obtains four names, beginning with 'for the non-arising of unarisen evil, unwholesome states'.

Vietnamese AI Translation

Theo cách này, tại sát na siêu thế đạo, cùng một năng lượng này của vị Tỳ khưu đạt được bốn tên gọi, bắt đầu với 'để các pháp ác, bất thiện chưa sanh khởi không sanh khởi'.

AI Translation Nissaya

evaṃ=In this way. ; etassa bhikkhuno=of this monk who is striving. ; lokuttarāmaggakkhaṇe=at the moment of the supramundane path. ; ekameva=one and the same. ; idaṃ vīriyaṃ=this energy. ; anuppannānaṃ pāpakānaṃ akusalānaṃ dhammānaṃ anuppādāyātiādīni=beginning with 'for the non-arising of unarisen evil unwholesome states'. ; cattāri=four. ; nāmāni=names. ; labhati=obtains. ;

Myanmar Nissaya

evaṃ=ဤသို့ဆိုအပ်ပြီးသော နည်းဖြင့်။ ; etassa bhikkhuno=ဤသို့ အားထုတ်ခြင်းရှိသော ရဟန်း၏။ ; lokuttarāmaggakkhaṇe=၌။ ; ekameva=တခုတည်းသာလျှင် ဖြစ်၏။ ; idaṃ vīriyaṃ=သည်။ ; anuppannānaṃ pāpakānaṃ akusalānaṃ dhammānaṃ anuppādāyātiādīni=ဤသို့ အစရှိကုန်သော။ ; cattāri=ကုန်သော။ ; nāmāni=တို့ကို။ ; labhati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3233 | Chunk: 54

Ayaṃ lokuttaramaggakkhaṇe sammappadhānakathā.

AI Translation based on Nissaya

This is the discourse on the right strivings at the moment of the supramundane path.

Vietnamese AI Translation

Đây là bài giảng về chánh tinh tấn tại sát na siêu thế đạo.

AI Translation Nissaya

ayaṃ=This that has been stated. ; lokuttarāmaggakkhaṇe=at the moment of the supramundane path. ; vuttā=is the exposition on. ; sammappadhānakathā=the discourse on the right strivings. ;

Myanmar Nissaya

ayaṃ=ဤဆိုအပ်ပြီးသော စကားသည်။ ; lokuttarāmaggakkhaṇe=၌။ ; vuttā=ဆိုအပ်သော။ ; sammappadhānakathā=သမ္မပ္ပဓာန်ကို ဆိုရာဖြစ်သော စကားတည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3234 | Chunk: 54

Evamettha lokiyalokuttaramissakā sammappadhānā niddiṭṭhāti.

AI Translation based on Nissaya

Thus, herein, the right strivings, mixed as mundane and supramundane, have been explained.

Vietnamese AI Translation

Như vậy, trong đây, chánh tinh tấn, được giải thích theo cả phương diện thế gian và siêu thế, đã được trình bày.

AI Translation Nissaya

evaṃ=Thus. ; ettha=in this exposition of the right strivings. ; lokiya lokutataramissakā=mixed mundane and supramundane. ; sammappadhānā=right strivings. ; niddiṭṭhā=have been explained. ;

Myanmar Nissaya

evaṃ=သို့။ ; ettha=ဤသမ္မပ္ပဓာနနိဒ္ဒေသ၌။ ; lokiya lokutataramissakā=ကုန်သော။ ; sammappadhānā=တို့ကို။ ; niddiṭṭhā=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3235 | Chunk: 54

Sammāsatiniddese [P1.174] kāyeti rūpakāye.

AI Translation based on Nissaya

In the Exposition of Right Mindfulness [P1.174], the word 'kāye' (in the body) means in the material body.

Vietnamese AI Translation

Trong Phần giải thích về Chánh Niệm [P1.174], từ 'kāye' (trong thân) có nghĩa là trong thân vật chất.

AI Translation Nissaya

sammāsatiniddese=In the exposition of right mindfulness. ; kāyeti=the word 'kāye'. ; rūpakāye=means in the material body. ;

Myanmar Nissaya

sammāsatiniddese=၌။ ; kāyeti=ကား။ ; rūpakāye=၌။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3236 | Chunk: 54

Rūpakāyo hi idha aṅgapaccaṅgānaṃ kesādīnañca dhammānaṃ samūhaṭṭhena hatthikāyarathakāyādayo viya kāyoti adhippeto.

AI Translation based on Nissaya

For here, the material body is intended as 'kāya' (body) in the sense of a collection, a collection of phenomena like major and minor limbs and hair of the head, etc., just as one speaks of the 'body of an elephant' or the 'body of a chariot'.

Vietnamese AI Translation

Bởi vì ở đây, thân vật chất được hiểu là 'kāya' (thân) theo nghĩa là một tập hợp, một tập hợp các hiện tượng như các chi lớn và nhỏ, lông tóc, v.v., cũng như người ta nói 'thân voi' hay 'thân xe'.

AI Translation Nissaya

rūpakāyo=The material body. ; idha=in this context. ; aṅgapaccaṅgānaṃ=of the major and minor limbs. ; dhammānañca=and of the dhammas. ; kesādīnaṃ=such as hair of the head, etc. ; dhammanañca=and of the dhammas. ; samūha‌ṭṭhena=because of the meaning 'collection'. ; hatthikāyarathakāyādayovīya=like 'the body of an elephant', 'the body of a chariot', etc. ; kāyo=is called 'body' (kāya). ; iti=thus. ; adhippeto=is intended. ;

Myanmar Nissaya

rūpakāyo=သည်။ ; vā=ကို။ ; idha=ဤအရာ၌။ ; aṅgapaccaṅgānaṃ=လက် ခြေ စသော အင်္ဂါကြီးငယ်ဟု ဆိုအပ်ကုန်သော။ ; dhammānañca=တရားတို့၏လည်းကောင်း။ ; kesādīnaṃ=ကုန်သော။ ; dhammanañca=တရားတို့၏ လည်းကောင်း။ ; samūha‌ṭṭhena=အပေါင်းဖြစ်သော အနက်ကြောင့်။ ; hatthikāyarathakāyādayovīya=တို့ကဲ့သို့။ ; kāyo=မည်၏။ ; iti=သို့။ ; adhippeto=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3237 | Chunk: 54

Yathā ca samūhaṭṭhena, evaṃ kucchitānaṃ āyaṭṭhena.

AI Translation based on Nissaya

And just as it is meant in the sense of a 'collection', so too is it meant in the sense of a 'place of origin' for disgusting things.

Vietnamese AI Translation

Và cũng như nó được hiểu theo nghĩa 'tập hợp', nó cũng được hiểu theo nghĩa 'nơi phát sinh' của những thứ ghê tởm.

AI Translation Nissaya

ca=Furthermore. ; samūhaṭṭhena=because of the meaning 'collection'. ; kāyoti=as 'kāya'. ; adhippeto yathā=just as it is intended. ; evaṃtathā=similarly. ; kucchitānaṃ=of disgusting things such as hair, etc. ; āyaṭṭhena=because of the meaning 'place of origin'. ; kāyoti=as 'kāya'. ; adhippeto=is intended. ;

Myanmar Nissaya

ca=ထိုမှ တပါး။ ; samūhaṭṭhena=အပေါင်းဖြစ်သော အနက်ကြောင့်။ ; kāyoti=ဟူ၍။ ; adhippeto yathā=ကဲ့သို့။ ; evaṃtathā=တူ။ ; kucchitānaṃ=စက်ဆိုအပ်ကုန်သော ဆံ အစရှိသော တရားတို့၏။ ; āyaṭṭhena=ဖြစ်ရာဟူသော အနက်ကြောင့်။ ; kāyoti=ဟူ၍။ ; adhippeto=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3238 | Chunk: 54

Kucchitānañhi paramajegucchānaṃ so āyotipi kāyo.

AI Translation based on Nissaya

Indeed, that body is the place of origin of what is disgusting and extremely loathsome.

Vietnamese AI Translation

Thật vậy, thân đó là nơi phát sinh của những gì ghê tởm và vô cùng đáng ghét.

AI Translation Nissaya

hi saccaṃ=Indeed. ; so kāyo=that body. ; kucchitānaṃ paramajegucchānaṃ=of things that are disgusting and extremely loathsome, such as hair, etc. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; so kāyo=သည်။ ; kucchitānaṃ paramajegucchānaṃ=အလွန် စက်ဆုပ်ဖွယ်ရှိကုန်သော ဆံ အစရှိသောတရားတို့၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3239 | Chunk: 54

Āyoti uppattideso.

AI Translation based on Nissaya

'Āyo' means the place of origin.

Vietnamese AI Translation

'Āyo' có nghĩa là nơi phát sinh.

AI Translation Nissaya

uppattideso=The place of arising. ;

Myanmar Nissaya

uppattideso=ဖြစ်ရာအရပ်သည်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3240 | Chunk: 54

Tatrāyaṃ vacanattho – āyanti tatoti āyo.

AI Translation based on Nissaya

Herein, this is the etymological explanation: They arise from it (`tato āyanti`); therefore, it is a place of origin (`āyo`).

Vietnamese AI Translation

Trong đây, đây là lời giải thích từ nguyên: Chúng sanh khởi từ nó (tato āyanti); do đó, nó là một nơi phát sinh (āyo).

AI Translation Nissaya

tatra=In that word 'kāyo'. ; ayaṃ=this which will be stated is. ; vacanattho=the word-meaning. ; tato=from that body. ; tato tasmiṃ sarīre=in that body. ; āyanti=phenomena such as hair arise. ; iti tasmā=therefore. ; āyo=it is called 'āyo' (place of arising). ;

Myanmar Nissaya

tatra=ထိုကာယော ဟူသော ပုဒ်၌။ ; ayaṃ=ဤဆိုလတ္တံသည်ကား။ ; vacanattho=တည်း။ ; tato=ထိုကိုယ်မှ။ ; tanaññaḥkāḥ=။ ; tato tasmiṃ sarīre=ထိုကိုယ်၌။ ; āyanti=ဆံ အစရှိသော တရားတို့ဖြစ်တတ်ကုန်၏။ ; iti tasmā=ကြောင့်။ ; āyo=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3241 | Chunk: 54

Ke āyanti ?

AI Translation based on Nissaya

What things arise?

Vietnamese AI Translation

Những gì sanh khởi?

AI Translation Nissaya

ke=What things. ; āyanti=arise? ;

Myanmar Nissaya

ke=အဘယ်တရားတို့သည်။ ; āyanti=ဖြစ်တတ်ကုန်သနည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3242 | Chunk: 54

Kucchitā kesādayo.

AI Translation based on Nissaya

Disgusting things, such as hair of the head, etc.

Vietnamese AI Translation

Những thứ ghê tởm, như lông tóc, v.v.

AI Translation Nissaya

kucchitā=Disgusting things. ; kesādayo=such as hair of the head, etc. ; āyanti=arise. ;

Myanmar Nissaya

kucchitā=အပ်ကုန်သော။ ; kesādayo=တို့သည်။ ; āyanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3243 | Chunk: 54

Iti kucchitānaṃ āyoti kāyo.

AI Translation based on Nissaya

Thus, it is the 'place of origin' (`āyo`) 'of disgusting things' (`kucchitānaṃ`); therefore, it is `kāyo`.

Vietnamese AI Translation

Như vậy, nó là 'nơi phát sinh' (āyo) 'của những thứ ghê tởm' (kucchitānaṃ); do đó, nó là `kāyo`.

AI Translation Nissaya

iti=Thus. ; kucchitānaṃ=of disgusting things. ; āyo=it is the place of origin. ; ititasmā=therefore. ; kāyo=it is called 'kāya'. ;

Myanmar Nissaya

iti=သို့။ ; kucchitānaṃ=တရားတို့၏။ ; āyo=ဖြစ်ရာတည်း။ ; ititasmā=ကြောင့်။ ; kāyo=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3244 | Chunk: 54

Kāyānupassīti kāyaṃ anupassanasīlo, kāyaṃ vā anupassamāno.

AI Translation based on Nissaya

'Kāyānupassī' means one who has the nature of repeatedly contemplating the body, or one who is repeatedly contemplating the body.

Vietnamese AI Translation

'Kāyānupassī' có nghĩa là người có bản chất lặp đi lặp lại quán sát thân, hoặc người đang lặp đi lặp lại quán sát thân.

AI Translation Nissaya

kāyānupassīti=The term 'kāyānupassī' means. ; kāyaṃ=the body. ; anupassanasīlo=one who has the nature of repeatedly contemplating. ; vā=or. ; kāyaṃ=the material body. ; anupassamāno=one who is repeatedly contemplating. ;

Myanmar Nissaya

kāyānupassīti=ကား။ ; kāyaṃ=ကိုယ်ကို။ ; anupassanasīlo=တလုံလဲလဲ ရှုလေ့ရှိသည်ဖြစ်၍။ ; vā=ကား။ ; kāyaṃ=ရူပကာယကို။ ; anupassamāno=တအော်လဲလဲရှုသည်ဖြစ်၍။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3245 | Chunk: 54

Kāyeti ca vatvāpi puna kāyānupassīti dutiyaṃ kāyaggahaṇaṃ asammissato vavatthānaghanavinibbhogādidassanatthaṃ katanti veditabbaṃ.

AI Translation based on Nissaya

And it should be understood that even after saying 'in the body' (kāye), the second use of the word 'kāya' in 'contemplating the body' (kāyānupassī) is made for the purpose of showing the defining, the breaking down of the compact, and so on, without confusion.

Vietnamese AI Translation

Và cần phải hiểu rằng ngay cả sau khi nói 'trong thân' (kāye), việc sử dụng thứ hai của từ 'kāya' trong 'quán thân' (kāyānupassī) được thực hiện với mục đích chỉ ra sự định nghĩa, sự phá vỡ khối đặc, v.v., mà không bị nhầm lẫn.

AI Translation Nissaya

ca=Moreover. ; kāyeti=as 'in the body'. ; vatvāpi=even having said. ; puna=again. ; kāyānupassīti=as 'contemplating the body'. ; dutiyaṃ=the second. ; kāyaggahaṇaṃ=taking up of the word 'kāya'. ; asammissato=by way of not mixing with each other. ; vavattānaghanavinibbhogādidassanaṃtthaṃ=for the purpose of showing the defining, the breaking down of the compact into parts, and so on. ; kataṃ=was made. ; iti=thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

ca=ဆက်။ ; kāyeti=ဟူ၍။ ; vatvāpi=ဆိုပြီး၍လည်း။ ; puna=ဖန်။ ; kāyānupassīti=ဟူ၍။ ; dutiyaṃ=သော။ ; kāyaggahaṇaṃ=ကာယ သဒ္ဒါကို ယူခြင်းကို။ ; asammissato=အချင်းချင်း မရောယှက်သော အားဖြင့်။ ; vavattānaghanavinibbhogādidassanaṃtthaṃ=ပိုင်းခြားခြင်း, တခဲနက်ကို အသီးသီး ဝေဖန်ခြင်း အစရှိသည်ကို ပြခြင်းငှါ။ ; kataṃ=အပ်၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3246 | Chunk: 54

Tena na kāye vedanānupassī cittadhammānupassī vā, atha kho kāyānupassīyevāti kāyasaṅkhāte vatthusmiṃ kāyānupassanākārasseva dassanena asammissato vavatthānaṃ dassitaṃ hoti.

AI Translation based on Nissaya

By this, it is shown that one is not contemplating feelings, mind, or mental objects in the body, but rather one is only contemplating the body. Thus, by showing only the mode of contemplating the body in the subject-matter designated as 'body', the defining of it without confusion is shown.

Vietnamese AI Translation

Bằng cách này, nó chỉ ra rằng người ta không quán thọ, tâm, hay pháp trong thân, mà đúng hơn là chỉ quán thân. Như vậy, bằng cách chỉ ra phương thức quán thân trong đối tượng được gọi là 'thân', sự định nghĩa về nó mà không nhầm lẫn được chỉ ra.

AI Translation Nissaya

tena kāyānupassanātipadena=By that phrase 'contemplating the body'. ; kāye=in the material body. ; vedanānupassīvā=one who repeatedly contemplates feeling, or. ; cittadhammānupassīvā=one who repeatedly contemplates mind-objects. ; nahoti=is not. ; iti=Thus. ; kāyasaṅkhāte=called 'body'. ; vatthusmiṃ=in the subject-matter. ; kāyānupassanākārasseva=only the mode of contemplating the body. ; dassenena=by showing. ; asammissato=by way of not mixing. ; vavatthānaṃ=the defining of things such as hair, etc. ; dassitaṃ=is shown. ; hoti=to be. ;

Myanmar Nissaya

tena kāyānupassanātipadena=ဖြင့်။ ; kāye=ရူပကာယ၌။ ; vedanānupassīvā=ဝေဒနာကို တလုံလဲလဲ ရှုလေ့ရှိသည်လည်းကောင်း။ ; cittadhammānupassīvā=စိတ္တဓမ္မကို တလုံလဲလဲ ရှုလေ့ရှိသည် လည်းကောင်း။ ; nahoti=မဖြစ်။ ; iti=သို့။ ; kāyasaṅkhāte=သော။ ; vatthusmiṃ=၌။ ; kāyānupassanākārasseva=ကိုသာလျှင်။ ; dassenena=ပြသဖြင့်။ ; asammissato=အားဖြင့်။ ; vavatthānaṃ=ဆံ အစရှိသည်တို့ကိုပိုင်းခြားခြင်းကို။ ; dassitaṃ=အပ်သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3247 | Chunk: 54

Tathā na kāye aṅgapaccaṅgavinimuttaekadhammānupassī, nāpi kesalomādivinimuttaitthipurisānupassī.

AI Translation based on Nissaya

Similarly, one does not contemplate a single phenomenon in the body separate from its major and minor limbs, nor does one repeatedly contemplate a 'woman' or a 'man' separate from the hair of the head, body hair, and so on.

Vietnamese AI Translation

Tương tự, người ta không quán một hiện tượng đơn lẻ trong thân tách rời khỏi các chi lớn và nhỏ của nó, cũng không lặp đi lặp lại quán sát một 'người nữ' hay một 'người nam' tách rời khỏi lông tóc, lông trên thân, v.v.

AI Translation Nissaya

tathā=Furthermore. ; kāye=in the body. ; aṅgapaccaṅgavinimuttaekadhammanupassī=one who contemplates a single phenomenon separate from the major and minor limbs. ; nahoti=is not. ; kesālomādivinimuttaitthipurisānupassī=one who repeatedly contemplates a woman or a man separate from hair of the head, body hair, etc. ; nāpi hoti=is also not. ;

Myanmar Nissaya

tathā=ထိုမှတပါး။ ; kāye=၌။ ; aṅgapaccaṅgavinimuttaekadhammanupassī=လက် ခြေစသော အင်္ဂါကြီးငယ်မှ လွတ်သော တခုသော တရားကို ရှုလေ့ရှိသည်။ ; nahoti=မဖြစ်။ ; kesālomādivinimuttaitthipurisānupassī=ဆံပင်, မွေးညင်းစသည်တို့မှ လွတ်သော ဣတ္ထိပုရိသကို တလုံလဲလဲ ရှုလေ့ရှိသည်။ ; nāpi hoti=ဖြစ်လည်းမဖြစ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3248 | Chunk: 54

Yopi cettha kesalomādiko bhūtupādāyasamūhasaṅkhāto kāyo, tatthāpi na bhūtupādāyavinimuttaekadhammānupassī, atha kho rathasambhārānupassako viya aṅgapaccaṅgasamūhānupassī, nagarāvayavānupassako viya kesalomādisamūhānupassī, kadalikkhandhapattavaṭṭivinibhujjako viya rittamuṭṭhiviniveṭhako viya ca bhūtupādāyasamūhānupassīyevāti samūhavaseneva kāyasaṅkhātassa vatthuno nānappakārato dassanena ghanavinibbhogo dassito hoti.

AI Translation based on Nissaya

Moreover, whatever body there is in this material body—consisting of hair, body hair, and so on, called the collection of primary elements and derived matter—there too, one does not contemplate a single phenomenon separate from the primary elements and derived matter. Rather, like one inspecting the components of a chariot, one repeatedly contemplates the collection of major and minor limbs; like one inspecting the parts of a city, one repeatedly contemplates the collection of hair, body hair, and so on; and like one peeling the sheaths of a banana stalk or unclenching an empty fist, one repeatedly contemplates only the collection of primary elements and derived matter. Thus, by seeing the thing called 'body' in various ways, but only as a collection, the breaking down of the compact mass is shown.

Vietnamese AI Translation

Hơn nữa, bất cứ thân nào có trong thân vật chất này—bao gồm lông, lông trên thân, v.v., được gọi là tập hợp của các yếu tố chính và vật chất phái sinh—ở đó cũng vậy, người ta không quán một hiện tượng đơn lẻ tách rời khỏi các yếu tố chính và vật chất phái sinh. Đúng hơn, như người kiểm tra các bộ phận của một cỗ xe, người ta lặp đi lặp lại quán sát tập hợp của các chi lớn và nhỏ; như người kiểm tra các bộ phận của một thành phố, người ta lặp đi lặp lại quán sát tập hợp của lông tóc, lông trên thân, v.v.; và như người bóc vỏ cây chuối hoặc mở một nắm tay rỗng, người ta lặp đi lặp lại quán sát chỉ tập hợp của các yếu tố chính và vật chất phái sinh. Như vậy, bằng cách nhìn thấy vật gọi là 'thân' theo nhiều cách khác nhau, nhưng chỉ như một tập hợp, sự phá vỡ khối đặc được chỉ ra.

AI Translation Nissaya

ca=Moreover. ; ettha=in this material body. ; kesālomādiko=consisting of hair of the head, body hair, and so on. ; bhūtupādāyasamūhasaṅkhāto=called the collection of primary elements and derived matter. ; yopikāyo=whatever body. ; atthi=there is. ; tatthāpi=in that material body also. ; bhūtupādāyavinimuttaekadhammānupassī=one who repeatedly contemplates a single phenomenon separate from the primary elements and derived matter. ; nahoti=is not. ; athakho=But rather. ; rathasambhārānupassakovīya=like one inspecting the components of a chariot. ; aṅgapaccaṅgasamūhānupassī=one repeatedly contemplates the collection of major and minor limbs. ; hoti=is. ; nagarāvayavānupassakoviya=like one inspecting the parts of a city, such as turrets, pavilions, etc. ; kesalomādisamūhānupassī=one repeatedly contemplates the collection of hair, body hair, etc. ; hoti=is. ; kadalikkhandhapattavaṭṭi nibhujjakoviya=like one peeling the sheaths of a banana stalk. ; rittamuṭṭhiviniveṭhako viyaca=and like one unclenching an empty fist. ; bhūtupādāyasamūhānupassīyeva=one only repeatedly contemplates the collection of primary elements and derived matter. ; hoti=is. ; iti=thus. ; samūhavaseneva=only by way of the collection. ; kāyasaṅkhāssa=of the thing called 'body'. ; vatthuno=of the object. ; nānappakārato=in various ways. ; dassanena=by seeing. ; ghanavinibbhogo=the breaking down of the compact mass. ; dassito=is shown. ; hoti=to be. ;

Myanmar Nissaya

ca=ဆက်။ ; ettha=ဤရူပကာယ၌။ ; kesālomādiko=ဆံပင်, မွေးညင်း အစရှိသော။ ; bhūtupādāyasamūhasaṅkhāto=ဘူတရုပ် ဥပါဒါရုပ်တို့၏ အပေါင်းဟု ဆိုအပ်သော။ ; yopikāyo=သည်လည်း။ ; atthi=၏။ ; tatthāpi=ထိုရူပကာယ၌လည်း။ ; bhūtupādāyavinimuttaekadhammānupassī=ဘူတရုပ် ဥပါဒါရုပ်တို့မှ လွတ်သော တခုသော တရားကို တလုံလဲလဲ ရှုလေ့ရှိသည်။ ; nahoti=မဖြစ်။ ; athakho=စင်စစ်သော်ကား။ ; rathasambhārānupassakovīya=ရထား၏ အဆောက်အဦကို ရှုသကဲ့သို့။ ; aṅgapaccaṅgasamūhānupassī=လက် ခြေ စသော အင်္ဂါကြီးငယ်အပေါင်းကို တလုံလဲလဲ ရှုလေ့ရှိသည်။ ; hoti=၏။ ; nagarāvayavānupassakoviya=မြို့၏ အစိတ်ဖြစ်သော ပြအိုး, တန်ဆောင်းအစရှိသည်ကို ရှုသူကဲ့သို့။ ; kesalomādisamūhānupassī=ဆံပင် မွေးညင်း စရှိသော အပေါင်းကို တလုံလဲလဲ ရှုလေ့ရှိသည်။ ; hoti=၏။ ; kadalikkhandhapattavaṭṭi nibhujjakoviya=ငှက်ပျောတုံး၏ ရွက်ပတ်ကို ခွာ၍ ရှူသူကဲ့သို့ လည်းကောင်း။ ; rittamuṭṭhiviniveṭhako viyaca=အချည်းနှီးသော လက်ဆုပ်ကို ဖြေ၍ ရှုသူကဲ့သို့ လည်းကောင်း။ ; bhūtupādāyasamūhānupassīyeva=ဘူတရုပ် ဥပါဒါယရုပ်တို့၏ အပေါင်းကို တအော်လဲလဲ ရှုလေ့ရှိသည်သာလျှင်။ ; hoti=၏။ ; iti=သို့။ ; samūhavaseneva=သာလျှင်။ ; kāyasaṅkhāssa=အပ်သော။ ; vatthuno=၏။ ; vā=ကို။ ; nānappakārato=အားဖြင့်။ ; dassanena=ရှုသဖြင့်။ ; vā=သဖြင့်။ ; ghanavinibbhogo=အပေါင်းကိုအသီးသီး ခွဲခြမ်းဝေဖန်ခြင်းကို။ ; dassito=ပြအပ်၏။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3249 | Chunk: 54

Na hettha yathāvuttasamūhavinimutto kāyo vā itthī vā puriso vā añño vā koci dhammo dissati, yathāvuttadhammasamūhamatteyeva pana tathā tathā sattā micchābhinivesaṃ karonti.

AI Translation based on Nissaya

Indeed, in this body, no 'body', 'woman', 'man', or any other such thing is seen separate from the aforementioned collection of phenomena. However, it is in the mere collection of these phenomena that ordinary beings wrongly adhere to the idea of a 'woman' or 'man' in various ways.

Vietnamese AI Translation

Thật vậy, trong thân này, không có 'thân', 'người nữ', 'người nam', hay bất kỳ thứ nào khác như vậy được thấy tách rời khỏi tập hợp các hiện tượng đã nói ở trên. Tuy nhiên, chính trong tập hợp thuần túy của những hiện tượng này mà phàm phu bám víu sai lầm vào ý tưởng về 'người nữ' hay 'người nam' theo nhiều cách khác nhau.

AI Translation Nissaya

hisaccaṃ=Indeed. ; ettha imasmiṃ kāye=in this body. ; yathāvuttasamūhavinimutto=separate from the aforementioned collection of hair, etc. ; kāyovā=a body, or. ; itthīvā=a woman, or. ; purisovā=a man, or. ; añño=another. ; koci=some. ; dhammovā=phenomenon. ; nadissati=is not seen. ; pana=However. ; yathāvuttadhammasamūhamatteyeva=in the mere collection of the aforesaid phenomena. ; tathātathā=in this or that way. ; sattā=ordinary beings. ; micchābhinivesaṃ=wrong adherence that it is a 'woman' or a 'man'. ; karonti=make. ;

Myanmar Nissaya

hisaccaṃ=၏။ ; ettha imasmiṃ kāye=၌။ ; yathāvuttasamūhavinimutto=အကြင်အကြင်ဆိုအပ်ပြီးသော ဆံ အစရှိသည့်အပေါင်းမှလွတ်သော။ ; kāyovā=ကိုယ်သည်လည်းကောင်း။ ; itthīvā=မိန်းမဒြပ်သည်လည်းကောင်း။ ; purisovā=လည်းကောင်း။ ; añño=တပါးသော။ ; koci=သော။ ; dhammovā=လည်းကောင်း။ ; nadissati=မထင်။ ; pana=စင်စစ်။ ; yathāvuttadhammasamūhamatteyeva=တို့၏ အပေါင်းမျှ၌သာလျှင်။ ; tathātathā=ထိုထိုအခြင်းအရာအားဖြင့်။ ; sattā=ပုထုဇဉ် သတ္တဝါတို့သည်။ ; micchābhinivesaṃ=မှားသောအားဖြင် ဣတ္ထိပုရိသဟူ၍ နှလုံးသွင်းခြင်းကို။ ; karonti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3250 | Chunk: 54

Tenāhu porāṇā –

AI Translation based on Nissaya

Therefore, the ancients said:

Vietnamese AI Translation

Do đó, người xưa đã nói:

AI Translation Nissaya

tena=Therefore. ; porāṇā=the ancients. ;

Myanmar Nissaya

tena=ကြောင့်။ ; porāṇā=တို့သည်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3251 | Chunk: 54

‘‘Yaṃ [V1.148] passati na taṃ diṭṭhaṃ, yaṃ diṭṭhaṃ taṃ na passati;

AI Translation based on Nissaya

"What one perceives is not what is seen, what is seen one does not perceive.

Vietnamese AI Translation

“Cái mà người ta tri giác không phải là cái được thấy, cái được thấy thì người ta không tri giác.

AI Translation Nissaya

yaṃ passati.la.=What one sees is not what is seen... ;

Myanmar Nissaya

yaṃ passati.la.= ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3252 | Chunk: 54

Apassaṃ bajjhate mūḷho, bajjhamāno na muccatī’’ ti.

AI Translation based on Nissaya

The fool, not perceiving, is bound; being bound, they are not freed."

Vietnamese AI Translation

Kẻ ngu si, vì không tri giác, nên bị trói buộc; bị trói buộc, họ không được giải thoát.”

AI Translation Nissaya

na muccatīti=is not freed. ; āhu=they said. ; Explanation of the verse. ; ayaṃ=What 'woman' or 'man'. ; (puthujjano=an ordinary person). ; passati=perceives. ; taṃ=that 'woman' or 'man' perceived by the ordinary person. ; diṭṭhaṃ=is not the visible object seen by the fleshly eye. ; na=is not. ; yaṃ=what visible object. ; diṭṭhaṃ=is seen by the fleshly eye. ; taṃ=that visible object seen by the fleshly eye. ; (puthujjano=an ordinary person). ; napassati=does not see (as it truly is). ; yaṃ=what 'woman' or 'man'. ; (puthujjano=an ordinary person). ; passati=perceives. ; taṃ=that 'woman' or 'man' perceived by the ordinary person. ; diṭṭhaṃ=is not the collection of primary and derived matter, such as hair of the head, body hair, etc., seen with the eye of wisdom. ; na=is not. ; yaṃ=what collection of primary and derived matter, such as hair of the head, body hair, etc. ; diṭṭhaṃ=is seen with the eye of wisdom. ; taṃ=that collection...seen with the eye of wisdom. ; puthujjano=the ordinary person. ; napassati=does not see. ; apassaṃ apassanto=not seeing. ; mūḷho=the deluded person. ; bajjhate=is bound by lust, etc. ; bajjhamāno=the person bound by lust, etc. ; namuccati=is not freed from the round of rebirths. ;

Myanmar Nissaya

na muccatīti=ဟူ၍။ ; āhu=ကုန်ပြီ။ ; ဂါထာအနက်။ ။ ; ayaṃ=အကြင်ဣတ္ထိပုရိသကို။ ; (puthujjano=သည်။) ; passati=ရှု၏။ ; taṃ=ထိုပုထုဇဉ်တို့သည် ရှုအပ်သော ဣတ္ထိပုရိသသည်။ ; diṭṭhaṃ=မံသစက္ခုဖြင့် ရှုအပ်သော ရူပါရုံသည်။ ; na=မဟုတ်။ ; yaṃ=အကြင်ရူပါရုံကို။ ; diṭṭhaṃ=မံသစက္ခုဖြင့် ရှုအပ်၏။ ; taṃ=ထိုမံသစက္ခုဖြင့် ရှုအပ်သော ရူပါရုံကို။ ; (puthujjano=သည်။) ; napassati=မမြင်။ ; tanaññaḥ= ; yaṃ=အကြင် ဣတ္ထိပုရိသကို။ ; (puthujjano=သည်။) ; passati=ရှု၏။ ; taṃ=ထိုပုထုဇဉ်တို့သည် ရှုအပ်သော ဣတ္ထိပုရိသသည်။ ; diṭṭhaṃ=ပညာစက္ခုဖြင့် ရှုအပ်သော ကေသာ လောမာ အစရှိသော ဘူတရုပ် ဥပါဒါရုပ်တို့၏ အပေါင်းသ်ည။ ; na=မဟုတ်။ ; yaṃ=အကြင် ကေသာ လောမာ အစရှိသောဘူတရုပ် ဥပါဒါရုပ်တို့၏ အပေါင်းကို။ ; diṭṭhaṃ=ပညာစက္ခုဖြင့်ရှုအပ်၏။ ; taṃ=ထိုပညာစက္ခုဖြင့် ရှုအပ်သော ကေသာ လောမာ အစရှိသောဘူတရုပ် ဥပါဒါရုပ်တို့၏ အပေါင်းကို။ ; puthujjano=သည်။ ; napassati=မမြင်။ ; vā=မရှု။ ; apassaṃ apassanto=မရှုသော။ ; mūḷho=တွေဝေသော ပုဂ္ဂိုလ်ကို။ ; bajjhate=ရာဂအစရှိသည်တို့သည် ဖွဲ့အပ်၏။ ; bajjhamāno=ရာဂအစရှိသည်တို့သည် ဖွဲ့အပ်သော ပုဂ္ဂိုလ်သည်။ ; namuccati=သံသရာဝဋ်မှ မလွတ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3253 | Chunk: 54

Ghanavinibbhogādidassanatthanti [M1.162] vuttaṃ.

AI Translation based on Nissaya

The statement 'for the purpose of showing the breaking down of the compact, and so on' [M1.162] was said.

Vietnamese AI Translation

Lời tuyên bố 'với mục đích chỉ ra sự phá vỡ khối đặc, v.v.' [M1.162] đã được nói.

AI Translation Nissaya

ghanavinibbhovā didassanatthanti='for the purpose of showing the breaking down of the compact, and so on'. ; yaṃvacanaṃ=which statement. ; mayā=by me. ; vuttaṃ=was said. ;

Myanmar Nissaya

ghanavinibbhovā didassanatthanti=ဟူ၍။ ; yaṃvacanaṃ=ကို။ ; mayā=သည်။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3254 | Chunk: 54

Ādisaddena cettha ayampi attho veditabbo – ayañhi etasmiṃ kāye kāyānupassīyeva, na aññadhammānupassī.

AI Translation based on Nissaya

And by the word 'and so on' in that phrase, this meaning should also be understood: this person is one who contemplates only the body in this body, not one who contemplates some other phenomenon.

Vietnamese AI Translation

Và bởi từ 'v.v.' trong cụm từ đó, ý nghĩa này cũng nên được hiểu: người này là người chỉ quán thân trong thân này, không phải là người quán một hiện tượng khác.

AI Translation Nissaya

etta=In this statement 'for the purpose of showing the breaking down of the compact, and so on'. ; ādisaddenaca=by the word 'and so on' (ādi). ; ayampi attho=this meaning which is about to be stated. ; veditabbo=should also be known. ; hi vitthāremi=To explain. ; ayaṃ puggalo=this person. ; etasmiṃ kāye=in this body. ; kāyānupassīyeva=is only one who repeatedly contemplates the body. ; hoti=is. ; aññadhammānupassī=one who repeatedly contemplates a phenomenon other than the body. ; nahoti=is not. ;

Myanmar Nissaya

etta=ဤ ဃနဝိနိဗ္ဘောဂါဒိဒဿနတ္ထံ ဟူသော စကား၌။ ; (samābhiniviṭṭhena=ကောင်းစွာ အကျုံးဝင်သော။) ; ādisaddenaca=ဖြင့်လည်း။ ; ayampi attho=ဤဆိုလတ္တံ့သော အနက်ကိုလည်း။ ; veditabbo=၏။ ; hi vitthāremi=အံ့။ ; ayaṃ puggalo=သည်။ ; etasmiṃ kāye=၌။ ; kāyānupassīyeva=ကိုယ်ကို တလုံလဲလဲ ရှုလေ့ရှိသည်သာလျှင်။ ; hoti=ဖြစ်၏။ ; aññadhammānupassī=ကိုယ်မှ တပါးသော တရားကို တလုံလဲလဲ ရှုလေ့ရှိသည်။ ; nahoti=မဖြစ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3255 | Chunk: 54

Kiṃ vuttaṃ hoti ?

AI Translation based on Nissaya

What is meant by this?

Vietnamese AI Translation

Điều này có nghĩa là gì?

AI Translation Nissaya

kiṃ koadhippāyo=What is the intention. ; vuttaṃ vutto=that is stated. ; hoti=is? ;

Myanmar Nissaya

kiṃ koadhippāyo=ကို။ ; vuttaṃ vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3256 | Chunk: 54

Yathā anudakabhūtāyapi marīciyā udakānupassino honti, na evaṃ aniccadukkhānattāsubhabhūteyeva imasmiṃ kāye niccasukhattasubhabhāvānupassī, atha kho kāyānupassī [P1.175]

AI Translation based on Nissaya

Just as there are those who see water in a mirage even though it is not water, one does not, in this body which is in fact impermanent, suffering, not-self, and impure, see it as permanent, pleasant, self, and pure. Rather, one contemplates it as body. [P1.175]

Vietnamese AI Translation

Cũng như có những người thấy nước trong ảo ảnh dù đó không phải là nước, người ta không, trong thân này vốn thực sự là vô thường, khổ, vô ngã, và bất tịnh, thấy nó là thường, lạc, ngã, và tịnh. Đúng hơn, người ta quán nó là thân. [P1.175]

AI Translation Nissaya

anudakabhūtāyapi=although it is not water. ; marīciyā=in a mirage. ; udakānupassīno=those who repeatedly see it as water. ; honti yathā=just as there are. ; evaṃtathā=similarly. ; anicca dukkhānattāsubhabhūteyeva=which is only impermanent, suffering, not-self, and impure. ; imasmiṃkāye=in this body. ; niccasukhattasubhabhāvānupassī=one who repeatedly sees it as permanent, pleasant, self, and pure. ; nahoti=is not. ; athakho=But rather. ; kāyānupassī=one who repeatedly contemplates it as body. ;

Myanmar Nissaya

anudakabhūtāyapi=ရေမဟုတ်သည်လည်းဖြစ်သော။ ; marīciyā=တံလျှပ်၌။ ; udakānupassīno=ရေဟူ၍ ရှုလေ့ရှိကုန်သည်။ ; honti yathā=ကဲ့သို့။ ; evaṃtathā=တူ။ ; anicca dukkhānattāsubhabhūteyeva=အနိစ္စဒုက္ခအနတ္တအသုဘဖြစ်၍ သာလျှင်ဖြစ်သော။ ; imasmiṃkāye=၌။ ; niccasukhattasubhabhāvānupassī=နိစ္စ သုခအတ္တသုဘအားဖြင့် အဖန်တလဲလဲ ရှလေ့ရှိသည်။ ; nahoti=မဖြစ်။ ; athakho=စင်စစ်သော်ကား။ ; kāyānupassī=ကိုယ်ဟူ၍ တလုံလဲလဲ ရှုလေ့ရှိသည်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3257 | Chunk: 54

Aniccadukkhānattāsubhākārasamūhānupassīyevāti vuttaṃ hoti.

AI Translation based on Nissaya

It is meant that one only repeatedly contemplates the collection of characteristics—impermanence, suffering, not-self, and impurity.

Vietnamese AI Translation

Điều đó có nghĩa là người ta chỉ lặp đi lặp lại quán sát tập hợp các đặc tính—vô thường, khổ, vô ngã, và bất tịnh.

AI Translation Nissaya

aniccasukkhānattāsubhākāyasamūhānupassīyeva=One only repeatedly contemplates the collection of things such as hair, etc., which has the characteristics of impermanence, suffering, not-self, and impurity. ; hoti=is. ; iti=thus. ; vuttaṃ vutto=it is stated. ; hoti=is. ;

Myanmar Nissaya

aniccasukkhānattāsubhākāyasamūhānupassīyeva=အနိစ္စအခြင်းအရာ ဒုက္ခအခြင်းအရာ အနတ္တအခြင်းအရာ အသုဘအခြင်းအရာရှိသော ဆံအစရှိသည်တို့၏ အပေါင်းကို တလုံလဲလဲ ရှုလေ့ရှိသည်သာလျှင်။ ; hoti=၏။ ; iti=သို့။ ; vuttaṃ vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3258 | Chunk: 54

Atha vā yvāyaṃ mahāsatipaṭṭhāne ‘‘idha, bhikkhave, bhikkhu araññagato vā rukkhamūlagato vā … pe … so satova assasatī’’ tiādinā ( dī. ni. 2.374; ma. ni. 1.107) nayena assāsapassāsādi cuṇṇakajātaaṭṭhikapariyosāno kāyo vutto, yo ca parato satipaṭṭhānakathāyaṃ ‘‘idhekacco pathavīkāyaṃ aniccato anupassati, āpokāyaṃ, tejokāyaṃ, vāyokāyaṃ, kesakāyaṃ, lomakāyaṃ, chavikāyaṃ, cammakāyaṃ, maṃsakāyaṃ, ruhirakāyaṃ, nhārukāyaṃ, aṭṭhikāyaṃ, aṭṭhimiñjakāyan’’ ti ( paṭi. ma. 3.35) kāyo vutto, tassa sabbassa imasmiṃyeva kāye anupassanato kāye kāyānupassīti evampi attho daṭṭhabbo.

AI Translation based on Nissaya

Alternatively, the meaning should also be understood in this way: whatever 'body' was spoken of in the Mahāsatipaṭṭhāna Sutta by the method beginning, "Here, monks, a monk... breathes in mindful" (D.ii.291; M.i.56), starting with the in-and-out breaths and ending with the bones reduced to dust; and whatever 'body' was spoken of further on in the discourse on the establishments of mindfulness, as "Here, someone contemplates the earth-body as impermanent... the bone-marrow body..." (Pṭs.iii.35) — because one repeatedly contemplates all of that within this very body, it is called 'contemplating the body in the body'.

Vietnamese AI Translation

Hoặc cách khác, ý nghĩa cũng nên được hiểu theo cách này: bất cứ 'thân' nào đã được nói đến trong Mahāsatipaṭṭhāna Sutta bằng phương pháp bắt đầu, “Ở đây, này các Tỳ khưu, một Tỳ khưu... hít vào có niệm” (D.ii.291; M.i.56), bắt đầu bằng hơi thở vào ra và kết thúc bằng xương bị nghiền thành bụi; và bất cứ 'thân' nào đã được nói đến xa hơn trong bài giảng về các căn bản niệm, như “Ở đây, một người quán thân đất là vô thường... thân tủy xương...” (Pṭs.iii.35) — bởi vì người ta lặp đi lặp lại quán sát tất cả những điều đó trong chính thân này, nên nó được gọi là 'quán thân trong thân'.

AI Translation Nissaya

athavā=Alternatively. ; mahāsatipaṭṭhāne=in the Mahāsatipaṭṭhāna Sutta. ; idha bhikkhave.la. assasatītiādinā=by the method beginning with 'Here, monks, a monk... he breathes in mindful'. ; nayena=by the method. ; assāsapassāsādicuṇṇakajātaaṭṭhika pariyosāno=beginning with the in-and-out breaths and ending with the bones crumbled to dust. ; yvāyaṃ yo ayaṃ kāyo=whatever body. ; vutto=was spoken of. ; parato=further on. ; satipaṭṭhānakathāyaṃ=in the discourse on the establishments of mindfulness. ; idhekacco.la. aṭṭhimiñjakāyanti=as 'here, someone contemplates the earth-body as impermanent... the bone-marrow-body...'. ; yo ca kāyo=whatever body also. ; vutto=was spoken of. ; sabbassa=of all. ; tassa kāyassa=that 'body'. ; imasmiṃyeva kāye=in this very same body. ; anupassanato=because of repeatedly contemplating. ; kāye kāyānupassīti=it is 'contemplating the body in the body'. ; iti evampi=thus also. ; attho=the meaning. ; daṭṭhabbo=should be seen. ;

Myanmar Nissaya

athavā=ကား။ ; mahāsatipaṭṭhāne=မဟာသတိပဋ္ဌာန်သုတ်၌။ ; idha bhikkhave.la. assasatītiādinā=ဤသို့ အစရှိသော။ ; nayena=ဖြင့်။ ; assāsapassāsādicuṇṇakajātaaṭṭhika pariyosāno=အဿာသပဿာသအစ စုဏ္ဏကဇာတအဋ္ဌိက အဆုံးရှိသော။ ; vā=အဿာသပဿာသအစ သေးသေးအဖွဲဖွဲအားဖြင့်ဖြစ်သော အဋ္ဌိက အဆုံးရှိသော။ ; yvāyaṃ yo ayaṃ kāyo=အကြင်ကာယကို။ ; vutto=အပ်၏။ ; parato=နောက်မှ။ ; satipaṭṭhānakathāyaṃ=ကထာ၌။ ; idhekacco.la. aṭṭhimiñjakāyanti=ဟူ၍။ ; yo ca kāyo=အကြင်ကာယကိုလည်း။ ; vutto=အပ်၏။ ; idha imasmiṃ sāsane=၌။ ; ekacco=ပုဂ္ဂိုလ်သည်။ ; pathavīkāyaṃ=ပထဝီဓာတ်အပေါင်းကို။ ; aniccato=အားဖြင့်။ ; anupassati=၏။ ; (ဤကဲ့သို့ချည်း လိုက်၍ သမ္ဗန်။) ; āpokāyaṃ=ကို။ ; aniccato=အားဖြင့်။ ; anupassati=၏။ ; tejokāyaṃ=ကို။ ; vāyokāyaṃ=ကို။ ; kesakāyaṃ=ဆံအပေါင်းကိဒ။ ; lomakāyaṃ=မွေးညင်းအပေါင်းကို။ ; chavikāyaṃ=အရေအပေါင်းကို။ ; cammakāyaṃ=အတွင်းအရေးအပေါင်းကို။ ; maṃsakāsaṃ=အသားအပေါင်းကို။ ; ruhirakāsaṃ=သွေးအပေါင်းကို။ ; nhārukāyaṃ=အကြောအပေါင်းကို။ ; aṭṭhikāyaṃ=အရိုးအပေါင်းကို။ ; aṭṭhimiñjakāyaṃ=ချဉ်ဆီအပေါင်းကို။ ; aniccato=အားဖြင့်။ ; anupassati=၏။ ; sabbassa=ဥဿုံသော။ ; tassa kāyassa=ထိုကာယကို။ ; imasmiṃyeva kāye=ဤအတ္တဘော၌သာလျှင်။ ; anupassanato=တလုံလဲလဲရှုခြင်းကြောင့်။ ; kāye kāyānupassīti=မည်၏။ ; iti evampi=ဤသို့လည်း။ ; attho=ကို။ ; daṭṭhabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3259 | Chunk: 54

Atha vā kāye ahanti vā mamanti vā evaṃ gahetabbassa kassaci ananupassanato tassa tasseva pana kesalomādikassa nānādhammasamūhassa anupassanato kāye kesādidhammasamūhasaṅkhātakāyānupassīti evamattho daṭṭhabbo.

AI Translation based on Nissaya

Alternatively, the meaning should be understood in this way: because one does not contemplate anything in the body that could be grasped as 'I' or 'mine', but rather repeatedly contemplates just those various collections of phenomena such as hair of the head and body hair, one is, in the body, a contemplator of the body which is designated as a collection of phenomena like hair.

Vietnamese AI Translation

Hoặc cách khác, ý nghĩa nên được hiểu theo cách này: bởi vì người ta không quán bất cứ điều gì trong thân mà có thể được nắm giữ là 'tôi' hay 'của tôi', mà đúng hơn là lặp đi lặp lại quán sát chỉ những tập hợp hiện tượng khác nhau như lông tóc và lông trên thân, nên người ta, trong thân, là người quán thân được gọi là một tập hợp các hiện tượng như lông.

AI Translation Nissaya

athavā=Alternatively. ; kāye=in the body. ; ahaṃ='I'. ; itivā=or. ; mama='my'. ; santakaṃ=possession. ; itivā=or. ; evaṃ=thus. ; gahetabbassa=of what could be grasped or conceived. ; kassaci=of any such thing. ; ananupassanato=because of not contemplating. ; pana=and. ; kesalāmādikassa=of the various collections of hair of the head, body hair, and so on. ; tassa tassevanānāsamūhassa=of those very same various collections. ; anupassanato=because of repeatedly contemplating. ; kāye=in the body. ; kesādidhammasamūhasaṅkhātakāyānupassī=one is a repeated contemplator of the body designated as the collection of phenomena such as hair. ; hoti=is. ; itievaṃ=thus. ; attho=the meaning. ; daṭṭhabbo=should be seen. ;

Myanmar Nissaya

athavā=ကား။ ; kāye=၌။ ; ahaṃ=ငါတည်း။ ; itivā=ဤသို့လည်းကောင်း။ ; mama=ငါ၏။ ; santakaṃ=ဥစ္စာတည်း။ ; itivā=ကောင်း။ ; evaṃ=သို့။ ; gahetabbassa=စွဲလမ်း မှတ်ထင်အပ်သော။ ; kassaci=တစုံတခုသော တရားကို။ ; ananupassanato=မရှုခြင်းကြောင့်။ ; pana=အနွယကို ဆိုဦးအံ့။ ; kesalāmādikassa=ဆံပင်မွေးညင်း အစရှိသော။ ; tassa tassevanānāsamūhassa=ထိုထိုအထူးအထူးသော ဆံအစရှိသော တရားအပေါင်းကို သာလျှင်။ ; anupassanato=တလုံလဲလဲ ရှုခြင်းကြောင့်. ; kāye=ကိုယ်၌။ ; kesādidhammasamūhasaṅkhātakāyānupassī=ဆံ အစရှိသောတို့၏ အပေါင်းဟု ဆိုအပ်သော ကာယကို တလုံလဲလဲရှုလေ့ရှိသည်။ ; hoti=၏။ ; itievaṃ=သို့။ ; attho=ကို။ ; daṭṭhabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3260 | Chunk: 54

Apica ‘‘imasmiṃ kāye aniccato anupassati, no niccato’’ tiādinā anukkamena parato āgatanayassa sabbasseva aniccalakkhaṇādino ākārasamūhasaṅkhātassa kāyassa anupassanatopi kāye kāyānupassīti evampi attho daṭṭhabbo.

AI Translation based on Nissaya

Furthermore, the meaning 'contemplating the body in the body' should also be seen from the fact that one contemplates the body designated as a collection of aspects, beginning with the characteristic of impermanence and so on, according to the entire method that comes later in sequence, beginning with, "In this body, one contemplates as impermanent, not as permanent."

Vietnamese AI Translation

Hơn nữa, ý nghĩa 'quán thân trong thân' cũng nên được nhìn từ sự thật rằng người ta quán thân được gọi là một tập hợp các khía cạnh, bắt đầu với đặc tính vô thường và v.v., theo toàn bộ phương pháp mà sẽ đến sau theo trình tự, bắt đầu với, “Trong thân này, người ta quán là vô thường, không phải là thường còn.”

AI Translation Nissaya

apica aparo=Furthermore, another. ; nayo=method. ; mayā=by me. ; vuccate=is stated. ; imasmiṃ kāye=in this material body. ; aniccato aniccatoeva=only as impermanent. ; anupassati=one contemplates. ; niccato=as permanent. ; no nupassati=one does not contemplate. ; iti ādinā=by the passage beginning with. ; anukkamena=in sequence. ; parato=further on. ; kāgatanayassa=of the method that comes. ; sabbasseva=of all. ; aniccalakkhaṇādino=beginning with the characteristic of impermanence. ; ākārasamūhaṅkhātassa=called the collection of aspects. ; kāyassa=of the body. ; anupassanatopi=also from contemplating. ; kāyekāyānupassīti=it is 'contemplating the body in the body'. ; itievampi=thus also. ; attho=the meaning. ; daṭṭhabbo=should be seen. ;

Myanmar Nissaya

apica aparo=တပါးသော။ ; nayo=ကို။ ; mayā=သည်။ ; vuccate=၏။ ; imasmiṃ kāye=ဤရူပကာယ၌။ ; aniccato aniccatoeva=ဖြင့်သာလျှင်။ ; anupassati=၏။ ; niccato=အားဖြင့်။ ; no nupassati=မရှု။ ; iti ādinā=သော။ ; anukkamena=အစဉ်ဖြင့်။ ; parato=နောက်မှ။ ; kāgatanayassa=လာသော နည်းဖြစ်သော။ ; sabbasseva=သော။ ; aniccalakkhaṇādino=အနိစ္စလက္ခဏာအစရှိသော။ ; ākārasamūhaṅkhātassa=အခြင်းအရာပေါင်းဟု ဆိုအပ်သော။ ; kāyassa=ကာယကို။ ; anupassanatopi=ရှုခြင်းကြောင့်လည်း။ ; kāyekāyānupassīti=မည်၏။ ; itievampi=ဤသို့လည်း။ ; attho=ကို။ ; daṭṭhabbo=ကို။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3261 | Chunk: 54

Ayaṃ pana catusatipaṭṭhānasādhāraṇo attho.

AI Translation based on Nissaya

This, however, is a meaning common to all four establishments of mindfulness.

Vietnamese AI Translation

Tuy nhiên, điều này là một ý nghĩa chung cho cả bốn căn bản niệm.

AI Translation Nissaya

pana=However. ; ayaṃ=this. ; catusatipaṭṭhānasādhāraṇo=is a meaning common to the four establishments of mindfulness. ; attho=meaning. ;

Myanmar Nissaya

pana=အစိတ်မှ တပါးအပေါင်းကို ဆိုအံ့။ ; ayaṃ=ဤဆိုလတ္တံ့သည်ကား။ ; catusatipaṭṭhānasādhāraṇo=တို့နှင့် ဆက်ဆံသော။ ; attho=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3262 | Chunk: 54

Kāye kāyānupassīti assāsapassāsakāyādike bahudhā vutte kāye ekekakāyānupassī.

AI Translation based on Nissaya

'Contemplating the body in the body' means: in the 'body' which is spoken of in many ways—beginning with the body of in-and-out breaths—one contemplates each single 'body'.

Vietnamese AI Translation

'Quán thân trong thân' có nghĩa là: trong cái 'thân' được nói đến theo nhiều cách—bắt đầu với thân của hơi thở vào ra—người ta quán từng 'thân' một.

AI Translation Nissaya

kāye kāyānupassīti='Contemplating the body in the body' means. ; assāsapassāsakāyādike=beginning with the body which is the in-and-out breaths. ; bahudhā=in many ways. ; vutte=spoken of. ; kāya=in the body. ; ekekakāyānussī=one contemplates each single body. ;

Myanmar Nissaya

kāye kāyānupassīti=ကား။ ; assāsapassāsakāyādike=ထွက်သက်ဝင်သက်ဟုဆိုအပ်သော ကာယ်အစရှိသော။ ; bahudhā=အားဖြင့်။ ; vutte=အပ်သော။ ; kāya=၌။ ; vā=တွင်။ ; ekekakāyānussī=တပါးပါးသော ကာယကို တလုံလဲလဲ ရှုသည်ဖြစ်၍။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3263 | Chunk: 54

Viharatīti catūsu iriyāpathavihāresu aññataravihārasamāyogaparidīpanametaṃ, ekaṃ iriyāpathabādhanaṃ aññena iriyāpathena vicchinditvā apatamānaṃ attānaṃ harati pavattetīti attho.

AI Translation based on Nissaya

'Viharati' (dwells) indicates the practitioner's engagement with one of the four postures. The meaning is that one bears, or maintains, one's continuity without collapsing by cutting off the pain of one posture with another posture.

Vietnamese AI Translation

'Viharati' (an trú) chỉ ra sự tham gia của hành giả vào một trong bốn oai nghi. Ý nghĩa là người ta chịu đựng, hay duy trì, sự liên tục của mình mà không sụp đổ bằng cách cắt đứt nỗi đau của một oai nghi bằng một oai nghi khác.

AI Translation Nissaya

viharatītietaṃ=The word 'viharatī' (dwells). ; catūsu=among the four. ; iriyāpathavihāresu=postural dwellings. ; aññataravihāsamāyogaparidīpanaṃ=is a statement that indicates the person's connection with one or another of the dwellings. ; etaṃ=This. ; iriyāpathabādhanaṃ=the pain of a posture. ; aññena=by another. ; iriyāpathena=posture. ; vicchinditvā=having cut off. ; apatamānaṃ=not collapsing. ; attānaṃ=one's own continuity. ; harati=one bears. ; pavatteti=one maintains. ; itiattho=this is the meaning. ;

Myanmar Nissaya

viharatītietaṃ=စကားသည်။ ; catūsu=ကုန်သော။ ; iriyāpathavihāresu=ဣရိယာ ပထဝိဟာရတို့တွင်။ ; aññataravihāsamāyogaparidīpanaṃ=တပါးပါးသော ဝိဟာရနှင့်ယှဉ်သော ပုဂ္ဂိုလ်ကို ပြကြောင်း, ဖြစ်သော စကားတည်း။ ; etaṃ=သော။ ; iriyāpathabādhanaṃ=ဣရိယာ ပုတ်၏ နာကျင်ခြင်းကို။ ; vā=ဣရိယာ ပုထ်ဖြင့် နာကျင်ခြင်းကို။ ; aññena=တပါးသော။ ; iriyāpathena=ဖြင့်။ ; vicchinditvā=ဖြတ်၍။ ; apatamānaṃ=မကျအောင်။ ; vā=မပျက်စီးအောင်။ ; attānaṃ=အတ္တဘောကို။ ; harati=တတ်၏။ ; pavatteti=တတ်၏။ ; itiattho=ဤကားအနက်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3264 | Chunk: 54

Ātāpīti kāyapariggāhakavīriyasamāyogaparidīpanametaṃ.

AI Translation based on Nissaya

'Ātāpī' (ardent) indicates the practitioner's connection with the energy that comprehends the body.

Vietnamese AI Translation

'Ātāpī' (nhiệt tâm) chỉ ra sự kết nối của hành giả với năng lượng thấu hiểu thân.

AI Translation Nissaya

ātāpīti etaṃ=The word 'ātāpī' (ardent). ; kāyapariggāhakavīriyasamāyogaparidīpanaṃ=is a statement that indicates the person's connection with the energy that comprehends the body, such as the hair, etc. ;

Myanmar Nissaya

ātāpīti etaṃ=ဤစကားသည်။ ; kāyapariggāhakavīriyasamāyogaparidīpanaṃ=ဆံ အစရှိသောကာယကို သိမ်းဆည်းတတ်သော ဝီရိယနှင့် ယှဉ်သော ပုဂ္ဂိုလ်ကို ပြကြောင်းဖြစ်သော စကားတည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3265 | Chunk: 54

So hi yasmā tasmiṃ samaye yaṃ taṃ vīriyaṃ tīsu bhavesu kilesānaṃ ātāpanato ātāpoti vuccati, tena samannāgato hoti [M1.163], tasmā ‘‘ātāpī’’ ti vuccati.

AI Translation based on Nissaya

Indeed, because that energy, at the time of practice, burns up the defilements in the three realms of existence, it is called 'ātāpa' (ardor). Because that person is endowed with it [M1.163], they are called 'ātāpī' (ardent).

Vietnamese AI Translation

Thật vậy, bởi vì năng lượng đó, vào thời điểm thực hành, thiêu đốt các phiền não trong ba cõi tồn tại, nên nó được gọi là 'ātāpa' (nhiệt tâm). Bởi vì người đó được trang bị nó [M1.163], nên họ được gọi là 'ātāpī' (nhiệt tâm).

AI Translation Nissaya

hi saccaṃ=Indeed. ; sopuggalo=that person connected with energy. ; yasmā=because. ; tasmiṃ samaye=at the time of striving. ; yaṃtaṃvīriyaṃ=that energy. ; tīsu bhavesu=in the three realms of existence. ; kilesānaṃ=the defilements that arise by taking an object. ; ātāpanano=because it burns. ; ātāpoti=is called 'ātāpa' (ardor). ; vuccati=it is said. ; tena=with that energy called 'ātāpa'. ; samannāgato=the person is endowed. ; hoti=is. ; tasmā=therefore. ; ātāpīti=as 'ātāpī' (ardent). ; vuccati=is called. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; sopuggalo=ထိုဝီရိယနှင့် ယှဉ်သော ပုဂ္ဂိုလ်ကို။ ; yasmā=ကြောင့်။ ; tasmiṃ samaye=ထိုထိုအားထုတ်သောအခါ၌။ ; yaṃtaṃvīriyaṃ=ကို။ ; tīsu bhavesu=ဘဝသုံးပါးတို့၌။ ; kilesānaṃ=အာရုံပြုသော အားဖြင့် ဖြစ်သော ကိလေသာတို့ကို။ ; ātāpanano=ပူပန်စေတတ်သောကြောင့်။ ; ātāpoti=ဟူ၍။ ; vuccati=၏။ ; tena=ထိုအာတပ မည်သာ ဝီရိယနှင့်။ ; samannāgato=ပုဂ္ဂိုလ်သည်။ ; hoti=၏။ ; tasmā=ကြောင့်။ ; ātāpīti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3266 | Chunk: 54

Sampajānoti kāyapariggāhakena sampajaññasaṅkhātena ñāṇena samannāgato.

AI Translation based on Nissaya

'Sampajāno' (clearly comprehending) means endowed with the knowledge called clear comprehension, which comprehends the body.

Vietnamese AI Translation

'Sampajāno' (có chánh tri kiến) có nghĩa là được trang bị tri kiến gọi là chánh tri kiến, vốn thấu hiểu thân.

AI Translation Nissaya

sampajānoti='Sampajāno' (clearly comprehending) means. ; kāyapariggāhakena=that comprehends the body, such as its hair, etc. ; sampajaññasaṅkhātena=called clear comprehension. ; ñāṇena=with the knowledge. ; samannāgato=endowed. ;

Myanmar Nissaya

sampajānoti=ကား။ ; kāyapariggāhakena=ဆံ အစရှိသော ကာယကို သိမ်းဆည်းတတ်သော။ ; sampajaññasaṅkhātena=ဟုဆိုအပ်သော။ ; ñāṇena=နှင့်။ ; samannāgato=ပြည့်စုံသည်ဖြစ်၍။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3267 | Chunk: 54

Satimāti kāyapariggāhikāya satiyā samannāgato.

AI Translation based on Nissaya

'Satimā' (mindful) means endowed with the mindfulness that comprehends the body.

Vietnamese AI Translation

'Satimā' (có chánh niệm) có nghĩa là được trang bị chánh niệm thấu hiểu thân.

AI Translation Nissaya

satimāti='Satimā' (mindful) means. ; kāyapariggāhikāya=that comprehends the body, such as its hair, etc. ; satiyā=with mindfulness. ; samannāto=endowed. ;

Myanmar Nissaya

satimāti=ကား။ ; kāyapariggāhikāya=ဆံ အစရှိသော ကာယကို သိမ်းဆည်းတတ်သော။ ; satiyā=နှင့်။ ; samannāto=ဖြစ်၍။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3268 | Chunk: 54

Ayaṃ pana yasmā satiyā ārammaṇaṃ pariggahetvā [V1.149] paññāya anupassati [P1.176].

AI Translation based on Nissaya

Because this practitioner [V1.149] grasps the object with mindfulness and then contemplates it with wisdom (as clear comprehension) [P1.176].

Vietnamese AI Translation

Bởi vì hành giả này [V1.149] nắm bắt đối tượng bằng chánh niệm và sau đó quán sát nó bằng trí tuệ (như chánh tri kiến) [P1.176].

AI Translation Nissaya

pana=Now, regarding the function of mindfulness and clear comprehension. ; ayaṃ puggalo=this person endowed with clear comprehension and mindfulness. ; yassmā=because. ; satiyā=with mindfulness. ; ārammaṇaṃ=the object such as hair, etc. ; pariggahetvā=having grasped. ; paññāya=with clear comprehension. ; anupassati=one repeatedly contemplates. ;

Myanmar Nissaya

pana=သတိပမ္ပဇညတို့၏ ကိစ္ဏကို ဆိုအံ့။ ; ayaṃ puggalo=ဤသမ္ပဇညသတိနှင့် ပြည့်စုံသော ပုဂ္ဂိုလ်သည်။ ; yassmā=ကြောင့်။ ; satiyā=ဖြင့်။ ; ārammaṇaṃ=ဆံ အစရှိသော အာရုံကို။ ; pariggahetvā=၍။ ; vā=ထက်ဝန်းကျင်မှ ယူ၍။ ; paññāya=သမ္ပဇဉ်ဖြင့်။ ; anupassati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3269 | Chunk: 54

Na hi sativirahitassa anupassanā nāma atthi.

AI Translation based on Nissaya

Indeed, for a person devoid of mindfulness, there is no such thing as the wisdom of contemplation.

Vietnamese AI Translation

Thật vậy, đối với một người thiếu chánh niệm, không có thứ gọi là trí tuệ của sự quán sát.

AI Translation Nissaya

hi saccaṃ=Indeed. ; sativirahitassa=for a person devoid of mindfulness. ; anupassanānāma=what is called the wisdom of repeated contemplation. ; naatthi=does not exist. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; sativirahitassa=ပုဂ္ဂိုလ်အား။ ; anupassanānāma=တလုံလဲလဲရှုတတ်သော ပညာမည်သည်။ ; naatthi=မရှိ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3270 | Chunk: 54

Tenevāha –

AI Translation based on Nissaya

For that very reason, he said:

Vietnamese AI Translation

Chính vì lý do đó, Ngài đã nói:

AI Translation Nissaya

teneva=For that very reason. ;

Myanmar Nissaya

teneva=ကြောင့်သာလျှင်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3271 | Chunk: 54

‘‘satiñca khvāhaṃ, bhikkhave, sabbatthikaṃ vadāmī’’ ti ( saṃ. ni. 5.234).

AI Translation based on Nissaya

"Mindfulness, O monks, I declare to be desirable in all circumstances." (S.v.180).

Vietnamese AI Translation

“Này các Tỳ khưu, Ta tuyên bố chánh niệm là đáng mong muốn trong mọi hoàn cảnh.” (S.v.180).

AI Translation Nissaya

satiṃ ca khvāhaṃ bhikkhave sabbatthikaṃ vadāmīti=I say, O monks, that mindfulness is beneficial everywhere. ; āha=he said. ; bhikkhave=Monks. ; kho=indeed. ; ahaṃ=I. ; satiṃca=mindfulness. ; sabbatthikaṃ=declare it to be desirable in all circumstances. ; vadāmi=I say. ;

Myanmar Nissaya

satiṃ ca khvāhaṃ bhikkhave sabbatthikaṃ vadāmīti=ဟူ၍။ ; āha=ဟောတော်မူ၏။ ; (သံ-၃။ ၁၀၀)။ ; bhikkhave=တို့။ ; kho=စင်စစ်။ ; ahaṃ=ငါသည်။ ; satiṃca=သတိတရားကိုလည်း။ ; sabbatthikaṃ=အလုံးစုံသော အကျိုး၌ ဖြစ်၏ ဟူ၍။ ; vadāmi=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3272 | Chunk: 54

Tasmā ettha ‘‘kāye kāyānupassī viharatī’’ ti ettāvatā kāyānupassanāsatipaṭṭhānakammaṭṭhānaṃ vuttaṃ hoti.

AI Translation based on Nissaya

Therefore, herein, by the phrase 'dwells contemplating the body in the body', the meditation subject of the establishment of mindfulness through contemplation of the body is stated.

Vietnamese AI Translation

Do đó, trong đây, bởi cụm từ 'an trú quán thân trong thân', đề mục thiền định của căn bản niệm quán thân được trình bày.

AI Translation Nissaya

tasmā=Therefore. ; ettha=herein. ; kāye kāyānupassī viharati='dwells contemplating the body in the body'. ; iti=thus. ; ettāvatā=by this much of the phrase. ; kāyānupassanāsatipaṭṭhānakammaṭṭhānaṃ=the meditation subject of the establishment of mindfulness through contemplation of the body. ; vuttaṃ=is stated. ; hoti=to be. ;

Myanmar Nissaya

tasmā=ထို့ကြောင့်။ ; ettha=ဤအရာ၌။ ; kāye kāyānupassī viharati=မည်၏။ ; iti=သို့။ ; ettāvatā=စကားအစဉ်ဖြင့်။ ; kāyānupassanāsatipaṭṭhānakammaṭṭhānaṃ=ကမ္မဋ္ဌာန်းကို။ ; vuttaṃ=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3273 | Chunk: 54

Atha vā yasmā anātāpino antosaṅkhepo antarāyakaro hoti, asampajāno upāyapariggahe anupāyaparivajjane ca sammuyhati, muṭṭhassati upāyāpariccāge anupāyāpariggahe ca asamattho hoti, tenassa taṃ kammaṭṭhānaṃ na sampajjati, tasmā yesaṃ dhammānaṃ ānubhāvena taṃ sampajjati, tesaṃ dassanatthaṃ ‘‘ātāpī sampajāno satimā’’ ti idaṃ vuttanti veditabbaṃ.

AI Translation based on Nissaya

Alternatively, it should be understood that the phrase 'ardent, clearly comprehending, mindful' was stated to show the qualities by whose power the meditation succeeds. Because for one without ardor, mental shrinkage is an obstacle; one without clear comprehension becomes confused about grasping the right method and rejecting the wrong one; and one with lapsed mindfulness is incapable of not abandoning the right method and not grasping the wrong one. For such a person, the meditation subject does not succeed.

Vietnamese AI Translation

Hoặc cách khác, cần phải hiểu rằng cụm từ 'nhiệt tâm, có chánh tri kiến, có chánh niệm' đã được trình bày để chỉ ra các phẩm chất nhờ sức mạnh của chúng mà thiền định thành công. Bởi vì đối với người không nhiệt tâm, sự co rút tinh thần là một chướng ngại; người không có chánh tri kiến sẽ bị nhầm lẫn về việc nắm bắt phương pháp đúng và bác bỏ phương pháp sai; và người có chánh niệm bị xao nhãng thì không có khả năng không từ bỏ phương pháp đúng và không nắm bắt phương pháp sai. Đối với một người như vậy, đề mục thiền định không thành công.

AI Translation Nissaya

athavā=Alternatively. ; yasmā=because. ; anātāpinā=for a person without ardor. ; antosaṅkhepo=the shrinking of the mind. ; antarāyakaro=is an obstacle. ; hoti=is. ; asampajāno=a person without clear comprehension. ; upāyapariggahe=in grasping the right method. ; anupāyaparivajjaneva=and in rejecting the wrong method. ; sammuyhati=becomes confused. ; muṭṭhassati=a person with lapsed mindfulness. ; upāyāpariccāge=in not abandoning the right method. ; anupāyāpariggaheca=and in not grasping the wrong method. ; asamatto=is incapable. ; hoti=is. ; tena=because of that. ; assa=for that person. ; taṃkammaṭṭhānaṃ=that meditation subject. ; nasampajjati=does not succeed. ; tasmā=therefore. ; yesaṃ dhammānaṃ=of which qualities—ardor, clear comprehension, and mindfulness. ; ānubhāvena=by the power of which. ; taṃ=that meditation subject. ; sampajjati=succeeds. ; tesaṃ=those qualities of ardor, clear comprehension, and mindfulness. ; dassanatthaṃ=in order to show. ; ātāpī sampajāno satimātiidaṃ=the phrase 'ardent, clearly comprehending, mindful'. ; vuttaṃ=was said. ; iti=thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

athavā=ကား။ ; yasmā=ကြောင့်။ ; anātāpinā=ဝီရိယ မရှိသော ပုဂ္ဂိုလ်သည်။ ; antosaṅkhepo=စိတ်၏ တွန့်ခြင်းသည်။ ; vā=ဦးလေးပျင်းရိခြင်းသည်။ ; antarāyakaro=ပြုတတ်သည်။ ; hoti=၏။ ; asampajāno=ပညာမရှိသော ပုဂ္ဂိုလ်သည်။ ; upāyapariggahe=အကြောင်းဟုတ်သည်ကို သိမ်းဆည်းခြင်း၌ လည်းကောင်း။ ; anupāyaparivajjaneva=အကြောင်းမဟုတ်သည်ကို ကြဉ်ခြင်း၌ လည်းကောင်း။ ; sammuyhati=၏။ ; muṭṭhassati=သတိကင်းသော ပုဂ္ဂိုလ်သည်။ ; upāyāpariccāge=အကြောင်းဟုတ်သည်ကို စွန့်ခြင်း၌လည်းကောင်း။ ; anupāyāpariggaheca=အကြောင်းမဟုတ်သည်ကို သိမ်းဆည်းခြင်း၌ လည်းကောင်း။ ; asamatto=သည်။ ; hoti=၏။ ; tena=ကြောင့်။ ; assa=ထိုပုဂ္ဂိုလ်အား။ ; taṃkammaṭṭhānaṃ=သည်။ ; nasampajjati=မပြည့်စုံ။ ; tasmā=ကြောင့်။ ; yesaṃ dhammānaṃ=အကြင်ဝီရိယ သမ္ပဇညသတိတရားတို့၏။ ; ānubhāvena=ကြောင့်။ ; taṃ=ထိုကမ္မဋ္ဌာန်းသည်။ ; sampajjati=ပြည့်စုံ၏။ ; tesaṃ=ထိုဝီရိယသမ္ပဇညသတိတရားတို့ကို။ ; dassanatthaṃ=ငှါ။ ; ātāpī sampajāno satimātiidaṃ=သတိမာ ဟူသော စကားကို။ ; vuttaṃ=အပ်၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3274 | Chunk: 54

Iti kāyānupassanāsatipaṭṭhānaṃ sampayogaṅgañca dassetvā idāni pahānaṅgaṃ dassetuṃ vineyya loke abhijjhādomanassan ti vuttaṃ.

AI Translation based on Nissaya

Thus, having shown the foundation of mindfulness of contemplation of the body and its factor of association, it is now said, 'having subdued covetousness and displeasure in the world,' in order to show the factor of abandonment.

Vietnamese AI Translation

Như vậy, sau khi đã chỉ ra căn bản niệm quán thân và yếu tố tương ưng của nó, bây giờ được nói, 'sau khi đã chế ngự tham lam và bất mãn trong đời', để chỉ ra yếu tố từ bỏ.

AI Translation Nissaya

iti iminā vuttappakārena=thus, in the manner mentioned. ; kāyānupassanāsatipaṭṭhānaṃ=the foundation of mindfulness of contemplation of the body, also. ; vā=or, the mindfulness that is skilled in contemplating hair, etc., which arise in the personal existence, also. ; assa=of that foundation of mindfulness. ; sampayogañca=and the factor of association, also. ; vā=or, the energy and wisdom that are associated, also. ; dassetvā=having shown. ; idāni=now. ; pahānaṅgaṃ=the factor of abandonment. ; dassetuṃ=in order to show. ; vineyya loke abhijjhādomanassanti=as "having subdued covetousness and displeasure in the world". ; vuttaṃ=it was said. ;

Myanmar Nissaya

iti iminā vuttappakārena=ဖြင့်။ ; kāyānupassanāsatipaṭṭhānaṃ=ကိုလည်းကောင်း။ ; vā=အတ္တဘော၌ ဖြစ်သော ဆံ အစရှိသည်ကို ရှုတတ်သော သတိကိုလည်းကောင်း။ ; assa=ထိုသတိပဋ္ဌန်၏။ ; sampayogañca=ကိုလည်းကောင်း။ ; vā=သမ္ပယုတ်ဖြစ်သော ဝီရိယပညာကိုလည်းကောင်း။ ; dassetāā=ပြပြီး၍။ ; idāni=၌။ ; pahānaṅgaṃ=အင်္ဂါကို။ ; dassetuṃ=ငှါ။ ; vineyyaloke abhijjhādomanassanti=ဟူ၍။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3275 | Chunk: 55

Tattha vineyyāti tadaṅgavinayena vā vikkhambhanavinayena vā vinayitvā.

AI Translation based on Nissaya

Therein, 'vineyya' means having subdued either by the subduing by substitution of opposites or by the subduing by suppression.

Vietnamese AI Translation

Trong đó, 'vineyya' có nghĩa là đã chế ngự bằng cách thay thế các đối lập hoặc bằng cách đàn áp.

AI Translation Nissaya

tattha=Therein, in the passage beginning with 'vineyya loke'. ; vineyyāti=the word 'vineyya'. ; tadaṅgavinayena vā=either by the subduing by substitution of opposites. ; vikkhambhanavinayena vā=or by the subduing by suppression. ; (samucchedavinayenavā=or by the subduing by cutting off.). ; vinayitvā=having subdued. ;

Myanmar Nissaya

tattha=ထိုဝိနေယျ လောကေ အစရှိသော ပါဌ်၌။ ; vineyyāti=ကား။ ; tadaṅgavinayenavā=တဒင်္ဂဝိနည်းဖြင့် လည်းကောင်း။ ; vikkhambhanavinayenavā=လည်းကောင်း။ ; (samucchedavinayenavā=ဖြင့်လည်းကောင်း။) ; vinayitvā=ပယ်ဖျောက်၍။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3276 | Chunk: 55

Loketi yvāyaṃ kāyo pubbe pariggahito, sveva idha lujjanapalujjanaṭṭhena loko nāma.

AI Translation based on Nissaya

As for 'loke' (in the world), whatever body was previously comprehended, that very body is here called the 'world' (loka) in the sense of 'breaking up and perishing'.

Vietnamese AI Translation

Còn về 'loke' (trong đời), bất cứ thân nào đã được thấu hiểu trước đó, chính thân đó ở đây được gọi là 'thế gian' (loka) theo nghĩa 'tan rã và hoại diệt'.

AI Translation Nissaya

loketi=As for 'loke'. ; yvāyaṃ kāyo=whatever body, consisting of hair etc. ; pubbe=previously. ; pariggahito=was comprehended. ; sveva kāyo=that very body. ; idha=here. ; lujjanapalujjanaṭṭhena=in the sense of breaking up and perishing. ; loko nāma=is called 'world' (loka). ;

Myanmar Nissaya

loketi=ကား။ ; yvāyaṃ kāyo yeñā akaṃ kāyā=အကြင် ဆံ အစရှိသော ကာယကို။ ; pubbe=၌။ ; pariggahito=သိမ်းဆည်းအပ်၏။ ; sveva kāyo=လျှင်။ ; idha=ဤအရာ၌။ ; lujjana palujjanaṭṭhena=ပျက်တတ်သော အနက်ကြောင့်။ ; lokonāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3277 | Chunk: 55

Tasmiṃ loke abhijjhaṃ domanassañca pajahitvāti attho.

AI Translation based on Nissaya

The meaning is: having abandoned covetousness and displeasure in that world of hair, etc.

Vietnamese AI Translation

Ý nghĩa là: đã từ bỏ tham lam và bất mãn trong thế giới của lông tóc, v.v.

AI Translation Nissaya

tasmiṃ loke=in that world, consisting of hair, etc. ; abhijjhaṃ=covetousness, also. ; domanassañca=and displeasure, also. ; pajahitvā=having abandoned. ; iti attho=this is the meaning. ;

Myanmar Nissaya

tasmiṃ loke=ထိုအဆံ အစရှိသော လောက၌။ ; abhijjhaṃ=ကိုလည်းကောင်း။ ; domanassañca=ကိုလည်းကောင်း။ ; pajahitvā=၍။ ; itiattho=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3278 | Chunk: 55

Yasmā panassa na kāyamatteyeva abhijjhādomanassaṃ pahīyati, vedanādīsupi pahīyatiyeva, tasmā ‘‘pañcapi upādānakkhandhā loko’’ ti ( vibha. 362) vibhaṅge vuttaṃ.

AI Translation based on Nissaya

Moreover, because for this person covetousness and displeasure are not abandoned just with regard to the body alone, but are indeed abandoned also with regard to feelings and so on, therefore it is said in the Vibhaṅga (vibha. 362): 'The five aggregates of clinging are the world.'

Vietnamese AI Translation

Hơn nữa, bởi vì đối với người này tham lam và bất mãn không chỉ bị từ bỏ đối với thân mà thôi, mà thật sự cũng bị từ bỏ đối với thọ và v.v., do đó trong Vibhaṅga (vibha. 362) có nói: 'Ngũ uẩn bám víu là thế gian.'

AI Translation Nissaya

pana=Moreover. ; yasmā=because. ; assa anena puggalena=for this person. ; kāyamatteyeva=only in the physical body, consisting of hair, etc. ; abhijjhādomanassaṃ=covetousness and displeasure. ; na pahīyati=are not abandoned. ; vedanādīsu pi=also in feelings, etc. ; (abhijjhādomanassaṃ=covetousness and displeasure). ; pahīyati yeva=they are indeed abandoned. ; tasmā=therefore. ; pañca pi upādānakkhandhā=the five aggregates of clinging. ; loko ti=are the world. ; vibhaṅge=in the Vibhaṅga. ; vuttaṃ=it is said. ;

Myanmar Nissaya

pana=ထိုမှ တပါး။ ; yasmā=ကြောင့်။ ; assa anena puggalena=သည်။ ; kāyamatteyeva=ဆံ အစရှိသော ရူပကာယ၌ သာလျှင်။ ; abhijjhādomanassaṃ=ကို။ ; napahīyati=ပယ်အပ်သည်မဟုတ်သေး။ ; vedanādīsupi=တို့၌လည်း။ ; (abhijjhādomanassaṃ=ကို။) ; pahīyatiyeva=တည်း။ ; tasmā=ကြောင့်။ ; pañcapi upādānakkhandhā=တို့ကို။ ; lokoti=ဟူ၍။ ; vibhaṅge=သတိပဋ္ဌာနဝိဘင်းပါဠိ၌။ ; vuttaṃ=သတည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3279 | Chunk: 55

Lokasaṅkhātattāyeva tesaṃ dhammānaṃ atthuddhāravasenetaṃ vuttanti veditabbaṃ.

AI Translation based on Nissaya

It should be understood that this word 'loka' was stated by way of extracting the meaning, precisely because those phenomena [the five aggregates] are designated as 'world'.

Vietnamese AI Translation

Cần phải hiểu rằng từ 'loka' này đã được trình bày bằng cách rút ra ý nghĩa, chính xác bởi vì những hiện tượng đó [ngũ uẩn] được gọi là 'thế gian'.

AI Translation Nissaya

tesaṃ dhammānaṃ=of those five aggregates of clinging. ; lokasaṅkhātattāyeva=just because of being designated as 'world'. ; tesaṃ dhammānaṃ=of those five aggregates of clinging. ; (This term should be considered before and after). ; atthuddhāravasena=by way of extracting the meaning. ; etaṃ=this word 'loka'. ; (vibhaṅge=in the Vibhaṅga). ; vuttaṃ=was said. ; iti=thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

tesaṃ dhammānaṃ=ထိုငါးပါးသော ဥပါဒါနက္ခန္ဓာတို့၏။ ; lokasaṅkhāratattāyeva=လောကဟူ၍ ဆိုအပ်သည်၏ အဖြစ်ကြောင့်သာလျှင်။ ; tesaṃdhammānaṃ=ထိုငါးပါးသော ဥပါဒါနက္ခန္ဓာတို့၏။ ; (ဤပုဒ်ကို ရှေ့နောက်လိုက်ပါ။) ; atthuddhāravasena=အနက်ကို ထုတ်သည်၏ အစွမ်းဖြင့်။ ; etaṃ=ဤလောကဟူသော စကားကို။ ; (vibhaṅge=၌။) ; vuttaṃ=၏။ ; iti=ဤသို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3280 | Chunk: 55

Yaṃ panāha –

AI Translation based on Nissaya

But as to what was said:

Vietnamese AI Translation

Còn về những gì đã được nói:

AI Translation Nissaya

pana=Further, let me state a special point. ;

Myanmar Nissaya

pana=ဆိုဖွယ်အထူးကို ဆိုဦးအံ့။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3281 | Chunk: 55

‘‘tattha katamo loko ( vibha. 538), sveva kāyo loko’’ ti ayamevettha attho.

AI Translation based on Nissaya

This very meaning should be understood here from the statement (vibha .538), 'Therein, what is the world? That very body is the world.'

Vietnamese AI Translation

Chính ý nghĩa này nên được hiểu ở đây từ lời tuyên bố (vibha .538), 'Trong đó, thế gian là gì? Chính thân đó là thế gian.'

AI Translation Nissaya

tattha katamo... lokoti=as "Therein, what is the world?...". ; yaṃ vacanaṃ=whatever statement. ; āha=was said. ; ettha=Herein, in this passage beginning with 'tattha katamo'. ; ayameva attho=this very meaning. ; veditabbo=should be understood. ;

Myanmar Nissaya

tattha katamo.la. lokoti=ဟူ၍။ ; yaṃvacanaṃ=ကို။ ; āha=၏။ ; ettha=ဤတတ္ထ ကတမော အစရှိသော ပါဌ်၌။ ; ayameva attho=ဤအနက်ကိုသာလျှင်။ ; veditabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3282 | Chunk: 55

Abhijjhādomanassanti ca samāsetvā vuttaṃ.

AI Translation based on Nissaya

And 'abhijjhādomanassam' is stated as a compound.

Vietnamese AI Translation

Và 'abhijjhādomanassam' được trình bày như một từ ghép.

AI Translation Nissaya

abhijjhādomanassanti=And as 'abhijjhādomanassam'. ; samāsetvā=having abbreviated. ; vā=or having formed a compound. ; vuttaṃ=it was said. ;

Myanmar Nissaya

abhijjhādomanassanti=ဟူ၍လည်း။ ; samāsetvā=အကျဉ်းရုံး၍။ ; vā=သမာသ်စပ်၍။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3283 | Chunk: 55

Saṃyuttaṅguttarapāṭhantaresu pana visuṃ katvā paṭhanti.

AI Translation based on Nissaya

But in other recensions of the Saṃyutta and Aṅguttara Nikāyas, they recite them separately.

Vietnamese AI Translation

Nhưng trong các bản đọc khác của Tương Ưng và Tăng Chi Bộ Kinh, họ đọc chúng riêng biệt.

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3284 | Chunk: 55

Sā pana abhijjhāyanti patthayanti etāya, sayaṃ vā abhijjhāyati, abhijjhāyanamattameva vā esāti abhijjhā.

AI Translation based on Nissaya

As for that covetousness (abhijjhā): one covets with it, or it itself covets, or it is simply the state of coveting; thus it is 'abhijjhā'.

Vietnamese AI Translation

Còn về tham lam (abhijjhā) đó: người ta tham lam với nó, hoặc chính nó tham lam, hoặc nó đơn giản là trạng thái tham lam; do đó nó là 'abhijjhā'.

AI Translation Nissaya

vā=As for 'abhijjhā'. ; sayaṃ=craving, which is called 'self'. ; abhijjhāyati=covets. ; iti tasmā=therefore. ; abhijjhā=it is called 'abhijjhā' (covetousness). ; vā=Alternatively. ; esā=this craving. ; abhijjhāyamattameva=is merely coveting. ; iti tasmā=therefore. ; abhijjhā=it is called 'abhijjhā'. ;

Myanmar Nissaya

vā=ကား။ ; sayaṃ=မိမိဟု ဆိုအပ်သော လောဘသည်။ ; abhijjhāyati=တောင့်တတတ်၏။ ; iti tasmā=ကြောင့်။ ; abhijjhā=မည်၏။ ; vā=ကား။ ; esā=ဤတဏှာသည်။ ; abhijjhāyamattameva=တောင့်တခြင်းမျှသာလျှင်တည်း။ ; ititasmā=ကြောင့်။ ; abhijjhā=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3285 | Chunk: 55

Yasmā panettha abhijjhāgahaṇena kāmacchando, domanassagahaṇena byāpādo saṅgahaṃ gacchati, tasmā nīvaraṇapariyāpannabalavadhammadvayadassanena nīvaraṇappahānaṃ vuttaṃ hotīti veditabbaṃ.

AI Translation based on Nissaya

Furthermore, it should be understood that because here, by the taking up of 'covetousness' sensual desire is included, and by the taking up of 'displeasure' ill will is included, therefore, by indicating this pair of powerful states that are comprised in the hindrances, the abandonment of the hindrances is said to occur.

Vietnamese AI Translation

Hơn nữa, cần phải hiểu rằng ở đây, bằng cách đề cập đến 'tham lam' thì dục ái được bao gồm, và bằng cách đề cập đến 'bất mãn' thì sân hận được bao gồm, do đó, bằng cách chỉ ra cặp trạng thái mạnh mẽ này vốn được bao gồm trong các triền cái, sự từ bỏ các triền cái được nói là xảy ra.

AI Translation Nissaya

pana=Further, let me state a special point. ; ettha=Herein, among these two, covetousness and displeasure. ; yasmā=because. ; abhijjhāgahaṇena=by the term 'abhijjhā'. ; kāmacchando=sensual desire. ; saṅgahaṃ=to inclusion. ; gacchati=goes. ; domanassagahaṇena=by the term 'domanassa'. ; byāpādo=ill will. ; saṅgahaṃ=to inclusion. ; gacchati=goes. ; tasmā=therefore. ; nīvaraṇapariyāpannabalavadhammadvayadassanena=by showing the pair of powerful states included in the hindrances. ; nīvaraṇappahānaṃ=the abandonment of the hindrances. ; vuttaṃ=is said. ; hoti=to be. ; iti=thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

pana=ဆိုဖွယ်အထူးကို ဆိုဦးအံ့။ ; ettha=ဤအဘိဇ္ဈာ ဒေါမနဿနှစ်ပါးတို့တွင်။ ; yasmā=ကြောင့်။ ; abhijjhāgahaṇena=အဘိဇ္ဈာသဒ္ဒါဖြင့်။ ; kāmacchando=သည်။ ; saṅgahaṃ=သို့။ ; gacchati=၏။ ; domanassagahaṇena=ဖြင့်။ ; byāpādo=သည်။ ; saṅgahaṃ=သို့။ ; gacchati=ရောက်၏။ ; tasmā=ကြောင့်။ ; nīvaraṇapariyāpannabalavadhammadvayadassanena=နီဝရဏ၌ အကျုံးဝင်သော အားရှိသော တရားနှစ်ပါးအပေါင်းကို ပြသဖြင့်။ ; nīvaraṇappahānaṃ=ကို။ ; vuttaṃ=သည်။ ; hoti=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3286 | Chunk: 55

Visesena [M1.164] panettha abhijjhāvinayena kāyasampattimūlakassa anurodhassa, domanassavinayena kāyavipattimūlakassa virodhassa, abhijjhāvinayena ca kāye abhiratiyā, domanassavinayena kāyabhāvanāya [P1.177] anabhiratiyā, abhijjhāvinayena kāye abhūtānaṃ subhasukhabhāvādīnaṃ pakkhepassa, domanassavinayena kāye bhūtānaṃ asubhāsukhabhāvādīnaṃ apanayanassa pahānaṃ vuttaṃ.

AI Translation based on Nissaya

Specifically [M1.164] herein, by the subduing of covetousness, the abandonment of compliance rooted in the body's perfection is stated; by the subduing of displeasure, the abandonment of opposition rooted in the body's imperfection is stated. And by the subduing of covetousness, the abandonment of delight in the body is stated; by the subduing of displeasure, the abandonment of non-delight in the development of the body [P1.177] is stated. By the subduing of covetousness, the abandonment of projecting unreal qualities of beauty, pleasure, etc., onto the body is stated; by the subduing of displeasure, the abandonment of removing the real qualities of non-beauty, non-pleasure, etc., from the body is stated.

Vietnamese AI Translation

Cụ thể [M1.164] trong đây, bằng cách chế ngự tham lam, sự từ bỏ sự thuận theo bắt nguồn từ sự hoàn hảo của thân được trình bày; bằng cách chế ngự bất mãn, sự từ bỏ sự phản đối bắt nguồn từ sự không hoàn hảo của thân được trình bày. Và bằng cách chế ngự tham lam, sự từ bỏ sự hoan hỷ trong thân được trình bày; bằng cách chế ngự bất mãn, sự từ bỏ sự không hoan hỷ trong sự phát triển của thân [P1.177] được trình bày. Bằng cách chế ngự tham lam, sự từ bỏ việc phóng chiếu các phẩm chất không có thật như sắc đẹp, khoái lạc, v.v., lên thân được trình bày; bằng cách chế ngự bất mãn, sự từ bỏ việc loại bỏ các phẩm chất có thật như không đẹp, không khoái lạc, v.v., khỏi thân được trình bày.

AI Translation Nissaya

pana=To speak of the specifics. ; ettha=Herein, in the abandonment of covetousness and displeasure. ; kāyasampattimūlakassa=which has the perfection of the body, such as hair, etc., as its root. ; anurodhassa=of compliance. ; vā=or, of craving and attachment. ; pahānaṃ=the abandonment. ; vuttaṃ=is spoken of. ; domanassavinayena=by subduing displeasure. ; kāyavipattimūlakassa=which has the imperfection of the body, such as hair, etc., as its root. ; virodhassa=of opposition. ; vā=or, of mental unhappiness. ; pahānaṃ=the abandonment. ; vuttaṃ=is spoken of. ; ca=Furthermore. ; abhijjhāvinayena=by subduing covetousness. ; kāye=in the body, consisting of hair, etc. ; abhiratiyā=of extreme delight. ; pahānaṃ=the abandonment. ; vuttaṃ=is spoken of. ; domanassavinayena=by subduing displeasure. ; kāyabhāvanāya=in the development of contemplation of the body. ; anabhiratiyā=of non-delight. ; pahānaṃ=the abandonment. ; vuttaṃ=is spoken of. ; abhijjhāvinayena=by subduing covetousness. ; kāye=in the body. ; abhūtānaṃ=of what is not real. ; subhasukhabhāvādīnaṃ=of the nature of beauty, pleasure, etc. ; pakkhepassa=of the unwholesome state that tends to project. ; pahānaṃ=the abandonment. ; vuttaṃ=is spoken of. ; domanassavinayena=by subduing displeasure. ; kāye=in the body. ; bhūtānaṃ=of what is real. ; asubhāsukhabhāvādīnaṃ=of the nature of non-beauty, non-pleasure, etc. ; apanayanassa=of the unwholesome state that tends to remove. ; pahānaṃ=the abandonment. ; vuttaṃ=is spoken of. ;

Myanmar Nissaya

pana=ဝိသေသကို ဆိုအံ့။ ; ettha=ဤအဘိဇ္ဈာဒေါမနဿကို ပယ်ရာ၌။ ; kāyasampattimūlakassa=ဆံ အစရှိသော ကာယ၏ ပြည့်စုံခြင်းလျှင် အကြောင်းရင်းရှိသော။ ; anurodhassa=မဆန့်ကျင်ခြင်းကို။ ; vā=တပ်ခြင်းတဏှာကို။ ; pahānaṃ=ပယ်ခြင်းကို။ ; vuttaṃ=၏။ ; domanassavinayena=ကို ပယ်သဖြင့်။ ; kāyavipattamūlakassa=ဆံ အစရှိသော ကိုယ်၏ ပျက်စီးခြင်းလျှင် အကြောင်းရင်းရှိသော။ ; virodhassa=ဆန့်ကျင်ခြင်းကို။ ; vā=နှစ်လုံးမသာယာခြင်းကို။ ; pahānaṃ=ကို။ ; vuttaṃ=၏။ ; ca=ထို့မှတပါး။ ; abhijjhāvinayena=ဖြင့်။ ; kāye=ဆံ အစရှိသော ကာယ၌။ ; abhiratiyā=အလွန်မွေ့လျော်ခြင်းကို။ ; pahānaṃ=ကို။ ; vuttaṃ=၏။ ; domanassavinayena=ဖြင့်။ ; kāyabhāvanāya=ကာယာနုပဿနာကို ပွားခြင်း၌။ ; anabhiratiyā=မမွေ့လျော်ခြင်းကို။ ; pahānaṃ=ကို။ ; vuttaṃ=၏။ ; abhijjhāvinayena=ဖြင့်။ ; kāye=၌။ ; abhūtānaṃ=ထင်ရှားမရှိကုန်သော။ ; subhasukhabhāvādīnaṃ=သုဘ သဘော သုခသဘော အစရှိသည်တို့ကို။ ; pakkhepassa=ထည့်သွင်းတတ်သော အကုသိုလ်တရားကို။ ; pahānaṃ=ကို။ ; vuttaṃ=၏။ ; domanassavinayena=ဖြင့်။ ; kāye=၌။ ; bhūtānaṃ=ထင်ရှားရှိကုန်သော။ ; asubhāsukhabhāvādīnaṃ=အသုဘသဘော အသုဘသဘော အစရှိသည်တို့ကို။ ; apanayanassa=ပယ်တတ်သော အကုသိုလ်တရားကို။ ; pahānaṃ=ကို။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3287 | Chunk: 55

Tena yogāvacarassa yogānubhāvo yogasamatthatā ca dīpitā hoti.

AI Translation based on Nissaya

By that, the power of the yogi's practice and his competence in the practice are explained.

Vietnamese AI Translation

Bằng cách đó, sức mạnh của sự thực hành của hành giả và năng lực của người ấy trong sự thực hành được giải thích.

AI Translation Nissaya

tena=By that word 'abhijjhādomanassa', which indicates the abandonment of compliance, etc. ; yogāvacarassa=of the yogi practitioner. ; yogānubhāvo=the power of the spiritual endeavor, i.e., of diligence, also. ; yogasamatthatā ca=and the state of being a person capable of the spiritual endeavor, also. ; dīpitā=is explained. ; hoti=it is. ;

Myanmar Nissaya

tena=ထိုအနုရောဓအစရှိသည်ကို ပယ်ခြင်းကို ပြကြောင်းဖြစ်သော အဘိဇ္ဈာဒေါမနဿ သဒ္ဒါဖြင့်။ ; yogāvacarassa=ယောဂါဝစရ ပုဂ္ဂိုလ်၏။ ; yogānubhāvo=အားထုတ်ခင်း ဝီရိယ၏ အစွမ်းသတ္တိကို လည်းကောင်း။ ; yogasamatthatāca=အားထုတ်ခြင်းငှါ စွမ်းနိုင်သော ပုဂ္ဂိုလ်၏ အဖြစ်ကိုလည်းကောင်း။ ; dīpitā=ပြအပ်သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3288 | Chunk: 55

Yogānubhāvo hi esa, yadayaṃ anurodhavirodhavippamutto aratiratisaho abhūtapakkhepabhūtāpanayanavirahito ca hoti.

AI Translation based on Nissaya

For this is the power of the practice, namely that one is free from compliance and opposition, tolerant of delight and non-delight, and free from projecting the unreal and removing the real.

Vietnamese AI Translation

Vì đây là sức mạnh của sự thực hành, cụ thể là người ta thoát khỏi sự thuận theo và phản đối, chịu đựng được sự hoan hỷ và không hoan hỷ, và thoát khỏi việc phóng chiếu cái không có thật và loại bỏ cái có thật.

AI Translation Nissaya

hi vitthāremi=I shall elaborate. ; yaṃ yena kāraṇena=for which reason. ; ayaṃ anurodhavirodhavippamutto=this freedom from compliance and opposition. ; ayaṃ aratiratisaho=this tolerance of non-delight and delight. ; ayaṃ bhūtapakkhepabhūtāpanayana virahito ca=and this freedom from projecting the unreal, such as beauty and pleasure, and from removing the real, such as non-beauty and non-pleasure. ; hoti=is. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; yaṃ yena kāraṇena=အကြင်အကြောင်းဖြင့်။ ; ayaṃ anurodhavirodhavippamutto=ဤမဆန့်ကျင်ခြင်းမှ လွတ်ခြင်း ဆန့်ကျင်ခြင်းမှ လွတ်ခြင်းလည်းကောင်း။ ; ayaṃ aratiratisaho=ဤမမွေ့လျော်ခြင်း မွေ့လျော်ခြင်း ကိုသည်းခံနိုင်ခြင်းသည်လည်းကောင်း။ ; ayaṃ bhūtapakkhepabhūtāpanayana virahitoca=ဤသုဘ သုခအစရှိသော ထင်ရှားမရှိသော သဘောကို ထည့်သွင်းခြင်း၊ အသုဘ အသုခ အစရှိသော ထင်ရှားသော သဘောကို ပယ်ခြင်းမှ ကင်းခြင်းသည် လည်းကောင်း။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3289 | Chunk: 55

Anurodhavirodhavippamutto cesa aratiratisaho abhūtaṃ apakkhipanto bhūtañca anapanento yogasamattho hotīti.

AI Translation based on Nissaya

And being free from compliance and opposition, tolerant of delight and non-delight, not projecting the unreal and not removing the real, one becomes competent in the practice.

Vietnamese AI Translation

Và khi thoát khỏi sự thuận theo và phản đối, chịu đựng được sự hoan hỷ và không hoan hỷ, không phóng chiếu cái không có thật và không loại bỏ cái có thật, người ta trở nên có năng lực trong sự thực hành.

AI Translation Nissaya

esa eso=This whole thing. ; yogānubhāvo=is the power of the diligent effort. ; ca=I will now elaborate on the term 'yogasamattha'. ; esa esso yogāvacaro=This practitioner. ; anurodhavirodhavippamutto=is free from compliance and opposition. ; aratiratisaho=can endure non-delight and delight. ; abhūtaṃ=the unreal, such as beauty and pleasure. ; apakkhipanto=not projecting. ; bhūtañca=and the real, such as non-beauty and non-pleasure. ; anapanento=not removing. ; hutvā=being. ; yogasamattho=is capable of the practice. ; hoti=is. ; iti=thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

esa eso=ဤလုံးစုံသည်။ ; yogānubhāvo=အားထုတ်ခြင်း လုံလ၏ အစွမ်းသတ္တိတည်း။ ; ca=ယောဂသမတ္ထဿ ဟူသော ပုဒ်၏ အကျယ်ကို ဆိုအံ့။ ; esa esso yogāvacaro=သည်။ ; anurovirodhavippamutto=မဆန့်ကျင်ခြင်း ဆန့်ကျင်ခြင်းမှ လွတ်သည်။ ; aratiratisaho=မမွေ့လျော်ခြင်း မွေ့လျော်ခင်း ကို သည်းခံနိုင်သည်။ ; abhūtaṃ=ထင်ရှားမရှိသော သုဘ သုခ အစရှိသည်ကို။ ; apakkhipanto=မထည့် မသွင်းသည်။ ; bhūtañca=ထင်ရှားရှိသော အသုဘ အသုခ အစရှိသည်ကိုလည်း။ ; anapanento=ဖဲကျဉ်ခြင်း မရှိသည်။ ; hutvā=၍။ ; yogasamattho=အားထုတ်ခြင်းငှါ စွမ်းနိုင်သည်။ ; hoti=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3290 | Chunk: 55

Aparo [V1.150] nayo –

AI Translation based on Nissaya

Another method [V1.150]:

Vietnamese AI Translation

Một phương pháp khác [V1.150]:

AI Translation Nissaya

aparo=Another. ; nayo=method. ; (mayā=I. ; vuccate=will explain.). ;

Myanmar Nissaya

aparo=တပါးသော။ ; nayo=ကို။ ; (mayā=သည်။ ; vuccate=အံ့။) ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3291 | Chunk: 55

‘‘kāye kāyānupassī’’ ti ettha anupassanāya kammaṭṭhānaṃ vuttaṃ.

AI Translation based on Nissaya

Herein, in 'contemplating the body in the body', the meditation subject is stated by way of contemplation.

Vietnamese AI Translation

Trong đây, trong 'quán thân trong thân', đề mục thiền định được trình bày theo phương cách quán sát.

AI Translation Nissaya

kāye kāyānupassīti ettha=in this phrase 'kāye kāyānupassī'. ; (labbhamānāya=being obtained). ; anupassanāya=by the volition associated with contemplation. ; kammaṭṭhānaṃ=the meditation subject. ; vuttaṃ=is stated. ;

Myanmar Nissaya

kāye kāyā nupassīti ettha=နုပဿီဟူသော ဤပုဒ်၌။ ; (labbhamānaya=ရအပ်သော)။ ; anupassanāya=အနုပဿနာနှင့် ယှဉ်သော စေတနာဖြင့်။ ; kammaṭṭhānaṃ=ကို။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3292 | Chunk: 55

‘‘Viharatī’’ ti ettha vuttavihārena kammaṭṭhānikassa kāyapariharaṇaṃ.

AI Translation based on Nissaya

In 'dwells', the maintenance of the body of the meditator is stated by means of the aforesaid modes of abiding.

Vietnamese AI Translation

Trong 'an trú', sự duy trì thân của hành giả được trình bày bằng các phương thức an trú đã nói trên.

AI Translation Nissaya

viharatīti ettha=in this word 'viharati' (dwells). ; vuttavihārena=by the aforementioned mode of abiding (in the postures). ; kammaṭṭhānikassa=of the person who practices the meditation subject. ; kāyapariharaṇaṃ=the maintenance of the body. ; vuttaṃ=is stated. ;

Myanmar Nissaya

viharatītiettha=ဟူသော ဤပုဒ်၌။ ; vuttavihārane=ဆိုအပ်သော ဣရိယမထဝိဟာရဖြင့်။ ; kammaṭṭhānikassa=ကမ္မဋ္ဌာန်းကို အားထုတ်ခြင်းရှိသော ပုဂ္ဂိုလ်၏။ ; kāyapariharaṇaṃ=ကိုယ်ကို ရွက်ဆောင်ခြင်းကို။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3293 | Chunk: 55

‘‘Ātāpī’’ tiādīsu ātāpena sammappadhānaṃ, satisampajaññena sabbatthakakammaṭṭhānaṃ, kammaṭṭhānapariharaṇūpāyo vā.

AI Translation based on Nissaya

In 'ardent' and so on, by 'ardor' the right exertion is stated; by 'mindfulness' and 'clear comprehension', the meditation subject for all situations, or the means for maintaining the meditation subject, is stated.

Vietnamese AI Translation

Trong 'nhiệt tâm' và v.v., bởi 'nhiệt tâm' thì chánh tinh tấn được trình bày; bởi 'chánh niệm' và 'chánh tri kiến', đề mục thiền định cho mọi tình huống, hoặc phương tiện để duy trì đề mục thiền định, được trình bày.

AI Translation Nissaya

ātāpītiādīsu=in the words beginning with 'ātāpī' (ardent). ; ātāpena=by the word 'ātāpa' (ardor). ; sammappadhānaṃ=the right exertion, which is diligent energy. ; vuttaṃ=is stated. ; satisampajaññena=by the words 'sati' (mindfulness) and 'sampajañña' (clear comprehension). ; sabbatthakakammaṭṭhānaṃ=the meditation subject for all situations. ; vā=or, the meditation subject for all situations, which is the fourfold protection. ; vuttaṃ=is stated. ; vā=Alternatively. ; kammaṭṭhānapariharaṇūpāyo=the means of maintaining the meditation subject. ; vutto=is stated. ;

Myanmar Nissaya

ātāpītiādīsu=ပုဒ်တို့တွင်။ ; ātāpena=အာတာပ သဒ္ဒါဖြင့်။ ; sammappadhānaṃ=သမ္မပ္ပဓာန်ကိစ္စ တပ်သော ဝီရိယကို။ ; vuttaṃ=၏။ ; satipampajaññena=သတိပမ္ပဇညသဒ္ဒါဖြင့်။ ; sabbatthaka kammaṭṭhānaṃ=သဗ္ဗတ္ထကကမ္မဋ္ဌာန်းကို။ ; vā=စတုရာရက္ခတရားတည်းဟူသော သဗ္ဗတ္ထကကမ္မဋ္ဌာန်းကို။ ; vuttaṃ=၏။ ; vā=ကား။ ; kammaṭṭhānapariharahupāyo=ကမ္မဋ္ဌာန်းကို ဆောင်ခင်း၏ အကြောင်းကို။ ; vutto=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3294 | Chunk: 55

Satiyā vā kāyānupassanāvasena paṭiladdhasamatho, sampajaññena vipassanā, abhijjhādomanassavinayena bhāvanāphalaṃ vuttanti veditabbaṃ.

AI Translation based on Nissaya

Alternatively, it should be understood that by mindfulness, the calm attained through contemplation of the body is stated; by clear comprehension, insight is stated; and by subduing covetousness and displeasure, the fruit of the development is stated.

Vietnamese AI Translation

Hoặc cách khác, cần phải hiểu rằng bởi chánh niệm, sự tĩnh lặng đạt được qua quán thân được trình bày; bởi chánh tri kiến, tuệ quán được trình bày; và bởi chế ngự tham lam và bất mãn, quả của sự phát triển được trình bày.

AI Translation Nissaya

vā=Alternatively. ; satiyā=by mindfulness. ; kāyānupassanāvasena=by way of contemplation of the body. ; paṭiladdhasamatho=the calm that has been attained. ; vutto=is stated. ; sampajaññena=by clear comprehension. ; vipassanā=insight. ; vuttā=is stated. ; abhijjhādomanassavinayena=by the subduing of covetousness and displeasure. ; bhāvanāphalaṃ=the fruit of development. ; vuttaṃ=is stated. ; iti=thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

vā=ကား။ ; satiyā=ဖြင့်။ ; kāyānupassanāvasena=ကာယာနုပဿနာအစွမ်းဖြင့်။ ; paṭiladdhasamatho=ရအပ်သော သမထကို။ ; vutto=၏။ ; sampajaññena=သမ္ပဇညဖြင့်။ ; vipassanā=ကို။ ; vuttā=၏။ ; abhijjhādomanassavinayena=အဘိဇ္ဈာဒေါမနဿကို ပယ်ဖျောက်ခြင်းဖြင့်။ ; bhāvanāphalaṃ=ကို။ ; vuttaṃ=၏။ ; iti=ဤသို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3295 | Chunk: 55

Vedanāsu vedanānupassītiādīsu ca vedanādīnaṃ puna vacane payojanaṃ kāyānupassanāyaṃ vuttanayeneva yathāyogaṃ yojetvā veditabbaṃ.

AI Translation based on Nissaya

And in 'contemplating feelings in feelings' and so on, the purpose of repeating the words 'feelings', etc., should be understood by applying, as is appropriate, the same method stated for the contemplation of the body.

Vietnamese AI Translation

Và trong 'quán thọ trong thọ' và v.v., mục đích của việc lặp lại các từ 'thọ', v.v., nên được hiểu bằng cách áp dụng, tùy theo trường hợp, phương pháp tương tự đã nói cho quán thân.

AI Translation Nissaya

vedanāsu vedanānupassītiādīsu ca=Also in the passages beginning with 'vedanāsu vedanānupassī' (contemplating feelings in feelings). ; vedanādīnaṃ=of feelings, etc. ; vā=or, of feelings, mind, and dhammas. ; vacane=in the teaching. ; payojanaṃ=the purpose. ; kāyānupassanāyaṃ=in the contemplation of the body. ; vuttanayeneva=by the very method that was stated. ; (Take the meaning of 'vuttanayeneva' from the statement beginning 'kāyeti ca vatvāpi puna kāyānupassanāti dutiyaṃ kāyaggahaṇaṃ asammisato...'). ; yathāyogaṃ=appropriately. ; yojetvā=having applied.‌ ; veditabbaṃ=should be understood. ;

Myanmar Nissaya

vedanāsu vedanānupassītiādīsuca=ရှိသော ပါဌ်တို့၌လည်း။ ; vedanādīnaṃ=တို့ကို။ ; vā=ဝေဒနာ စိတ္တ ဓမ္မတို့ကို။ ; vacane=ဟောခြင်း၌။ ; payojanaṃ=အကျိုးကို။ ; kāyānupassanāyaṃ=၌။ ; vuttanayeneva=ဖြင့်သာလျှင်။ ; (ဝုတ္တနယေနေဝ ၏ အရကို ကာယေတိ စ ဝတွာပိ ပုနကာယာနုပဿနာတိ ဒုတိယံ ကာယဂ္ဂဟဏံ အသမ္မိဿတော အစရှိသော စကားကို ယူပါ။) ; yathāyogaṃ=စွာ။ ; yojetvā=၍။‌ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3296 | Chunk: 55

Ayaṃ pana asādhāraṇattho – sukhādīsu anekappabhedāsu vedanāsu visuṃ visuṃ aniccādito ekekavedanānupassīti, sarāgādike soḷasappabhede citte visuṃ visuṃ aniccādito ekekacittānupassīti, kāyavedanācittāni ṭhapetvā sesatebhūmakadhammesu visuṃ visuṃ aniccādito ekekadhammānupassīti, satipaṭṭhānasuttante ( dī. ni. 2.382; ma. ni. 1.115) vuttanayena nīvaraṇādidhammānupassīti vā.

AI Translation based on Nissaya

This, however, is the specific meaning: among the many kinds of feelings such as pleasant, etc., one contemplates each single feeling severally by way of impermanence, etc.; or among the sixteen kinds of mind-states beginning with one accompanied by greed, one contemplates each single mind-state severally by way of impermanence, etc.; or, setting aside body, feelings, and mind, in the remaining phenomena of the three planes, one contemplates each single phenomenon severally by way of impermanence, etc.; or, by the method taught in the Satipaṭṭhāna Sutta (D.ii.290; M.i.55), one contemplates phenomena such as the hindrances.

Vietnamese AI Translation

Tuy nhiên, đây là ý nghĩa cụ thể: trong số nhiều loại thọ như lạc, v.v., người ta quán từng thọ một cách riêng biệt theo phương cách vô thường, v.v.; hoặc trong số mười sáu loại tâm bắt đầu với tâm có tham, người ta quán từng tâm một cách riêng biệt theo phương cách vô thường, v.v.; hoặc, gác lại thân, thọ, và tâm, trong các pháp còn lại của ba cõi, người ta quán từng pháp một cách riêng biệt theo phương cách vô thường, v.v.; hoặc, bằng phương pháp được dạy trong Satipaṭṭhāna Sutta (D.ii.290; M.i.55), người ta quán các pháp như triền cái.

AI Translation Nissaya

pana=Furthermore. ; ayaṃ=this which will be stated. ; asādhāraṇattho=is the specific meaning. ; sukhādīsu=among feelings of pleasure etc., which are worldly. ; anekappabhedāsu=which have many divisions. ; vedanāsu=in feelings. ; visuṃ visuṃ=severally. ; aniccādito=by way of impermanence, etc. ; ekekavedanānupassī=contemplating each single feeling. ; iti vā=thus, also. ; sarāgādike=beginning with that accompanied by greed. ; soḷasappabhede=which has sixteen divisions. ; citte=in the mind. ; (The sixteen are: mind with greed, without greed, with hate, without hate, with delusion, without delusion, contracted, distracted, developed, undeveloped, with a superior, without a superior, concentrated, unconcentrated, liberated, unliberated.). ; visuṃ visuṃ=severally. ; aniccādito=by way of impermanence, etc. ; ekekacittānupassī=contemplating each single mind-state. ; iti vā=thus, also. ; kāyavedanācittāni=body, feelings, and mind. ; ṭhapetvā=having set aside. ; sesatebhūmakadhammesu=in the remaining phenomena of the three planes. ; visuṃ visuṃ=severally. ; aniccādito=by way of impermanence, etc. ; ekekadhammānupassī=contemplating each single phenomenon. ; iti vā=thus, also. ; satipaṭṭhānasuttante=in the Satipaṭṭhāna Sutta. ; vuttanayena=by the method taught. ; nīvaraṇādidhammānupassī=contemplating phenomena such as the hindrances. ; iti vā=thus, also. ; asādhāraṇattho=the specific meaning. ; veditabbo=should be understood. ;

Myanmar Nissaya

pana=ထိုမှတပါး။ ; ayaṃ=ဤဆိုလတ္တံ့သည်ကား။ ; asādhāraṇattho=မဆက်ဆံသော အနက်သည်။ ; sukhādīsu=လောကီသုခ ဝေဒနာအစရှိကုန်သော။ ; anekappabhedāsu=များစွာသော အပြားရှိကုန်သော။ ; vedanādīsu=တို့၌။ ; pisuṃvisuṃ=အသီးအသီး။ ; aniccādito=အနိစ္စအစရှိသော အားဖြင့်။ ; ekekavedanānupassī=တပါးတပါးသော ဝေဒနာကို ရှုလေ့ရှိသည်ဖြစ်၍။ ; itivā=ဤသို့လည်းကောင်း။ ; sarāgādike=သရာဂအစရှိသော။ ; soḷasappabhede=တစ်ဆယ့်ခြောက်ပါး အပြားရှိသော။ ; citte=၌။ ; (သောဠသ ဟူသည်ကား၊ သရာဂစိတတ၊ ဝီတရာဂ၊ သဒေါသ၊ ဝီတဒေါသ၊ သမောဟ၊ ဝီမောဟ၊ သံခိတ္တ၊ ဝိက္ခိတ္တ၊ မဟဂ္ဂတ၊ အမဟဂ္ဂတ၊ ဥတ္တရ၊ အနုတ္တရ၊ သမာဟိတ၊ အသမာဟိတ၊ ဝိမုတ္တ၊ အဝီမုတ္တစိတ္တ ဟူသည်တည်း။) ; visuṃvisuṃ=သီ။ ; aniccādito=အားဖြင့်။ ; ekekacittānupassī=တပါးတပါးသော စိတ်ကို ရှုလေ့ရှိသည်ဖြစ်၍။ ; itivā=ဤသို့လည်းကောင်း။ ; kāyavedanā cittāni=တို့ကို။ ; ṭhapetvā=၍။ ; sesatebhūmakadhammesu=ကြွင်းသော တေဘူမကတရားတို့၌။ ; visuṃvisuṃ=အသီး အသီး။ ; aniccādito=အားဖြင့်။ ; ekekadhammānupassī=တစ်ပါးတစ်ပါးသော တရားကို ရှုလေ့ရှိသည်ဖြစ်၍။ ; itivā=ကောင်း။ ; satipaṭṭhānasuttante=သုတ်၌။ ; vuttanayena=ဟောတော်မူအပ်သော နည်းဖြင့်။ ; nīvaraṇādidhammānupassī=ဖြစ်၍။ ; itivā=ကောင်း။ ; asādhāraṇatto=မဆက်ဆံသော အနက်ကို။ ; veditabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3297 | Chunk: 55

Ettha ca ‘‘kāye’’ ti ekavacanaṃ sarīrassa ekattā, ‘‘citte’’ ti ekavacanaṃ cittassa sabhāvabhedābhāvato jātiggahaṇena katanti veditabbaṃ.

AI Translation based on Nissaya

And here it should be understood that the singular 'kāye' (in the body) is used because of the oneness of the physical frame, being taken as a category. The singular 'citte' (in the mind) is used because of the sameness of the mind's intrinsic nature, there being no difference in its nature of cognizing an object, being taken as a category.

Vietnamese AI Translation

Và ở đây cần phải hiểu rằng từ số ít 'kāye' (trong thân) được dùng vì sự nhất thể của thể chất, được lấy làm một thể loại. Từ số ít 'citte' (trong tâm) được dùng vì sự đồng nhất của bản chất nội tại của tâm, không có sự khác biệt trong bản chất nhận thức đối tượng của nó, được lấy làm một thể loại.

AI Translation Nissaya

ca=Now I will speak on the meaning of the case endings. ; ettha=Herein, in the passage beginning with 'kāye kāyānupassī'. ; kāyeti=the word 'kāye'. ; ekavacanaṃ=the use of the singular. ; sarīrassa=of the body. ; ekattā=because of its oneness. ; jātiggahaṇena=by taking the category (jāti). ; vā=or by taking the genus. ; kataṃ=is done. ; citteti=the word 'citte'. ; ekavacanaṃ=the use of the singular. ; cittassa=of the mind. ; sabhāvabhedābhāvato=because of the lack of difference in its intrinsic nature of cognizing an object. ; vā=with no difference. ; ekattā=because of its sameness. ; jātiggahaṇena=by taking the category. ; kataṃ=is done. ; iti=thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

ca=ဝိဘကျတ္ထကို ဆိုဦးအံ့။ ; ettha=ဤကာယေကာယာနုပဿီ အစရှိသော ပါဌ်၌။ ; kāyeti=ဟူ၍။ ; ekavacanaṃ=ဧကဝုစ်အားဖြင့် ဆိုခြင်းကို။ ; sarīrassa=ကိုယ်၏။ ; ekattā=တပါးတည်း၏အဖြစ်ကြောင့်။ ; jātiggahaṇena=ဇာတိ သဒ္ဒါဖြင့်။ ; vā=ဇာတ်ကို ယူသဖြင့်။ ; kataṃ=ပြုအပ်၏။ ; citteti=ဟူ၍။ ; ekavacanaṃ=ကို။ ; cittassa=၏။ ; sabhāvabhedābhāvato=အာရမ္မဏ ဝိဇာနန သဘော၏အပြားမရှိခြင်းကြောင့်။ ; vā=အပြားမရှိသောအားဖြင့်။ ; ekattā=တူသည်၏ အဖြစ်ကြောင့်။ ; jātiggahaṇena=ဖြင့်။ ; kataṃ=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3298 | Chunk: 55

Yathā ca vedanādayo anupassitabbā, tathā anupassanto vedanāsu vedanānupassī, citte cittānupassī, dhammesu dhammānupassīti veditabbo.

AI Translation based on Nissaya

And it should be known that just as feelings and so on are to be contemplated, so one who contemplates feelings in feelings is a 'contemplator of feelings'; one who contemplates the mind in the mind is a 'contemplator of the mind'; and one who contemplates phenomena in phenomena is a 'contemplator of phenomena'.

Vietnamese AI Translation

Và cần phải biết rằng cũng như thọ và v.v. cần phải được quán, thì người quán thọ trong thọ là 'người quán thọ'; người quán tâm trong tâm là 'người quán tâm'; và người quán pháp trong pháp là 'người quán pháp'.

AI Translation Nissaya

ca=Furthermore. ; yathā=in whichever way. ; vedanādayo=feelings and so on. ; anupassitabbā yathā=should be contemplated. ; tathā=in that same way. ; vedanāsu=in feelings. ; anupassanto=one who contemplates. ; vedanānupassī=is a contemplator of feelings. ; citte cittānupassī=is a contemplator of mind. ; dhammesu dhammānupassī=is a contemplator of phenomena. ; iti=thus. ; veditabbo=it should be known. ;

Myanmar Nissaya

ca=ဆက်။ ; yathā=အကြင်အခြင်းအရာအားဖြင့်။ ; vedanādayo=အစရှိသည်တို့ကို။ ; anupassitabbāyathā=ရှုအပ်သကဲ့သို့။ ; tathā=တူ။ ; vedanāsu=တို့၌။ ; anupassanto=သည်။ ; vedanānupassī=မည်၏။ ; citte cittānupassī=မည်၏။ ; dhammesu dhammānupassī=မည်၏။ ; iti=ဤသို့။ ; veditabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3299 | Chunk: 55

Kathaṃ tāva vedanā anupassitabbā ?

AI Translation based on Nissaya

To begin with, how are feelings to be contemplated?

Vietnamese AI Translation

Trước hết, thọ cần phải được quán như thế nào?

AI Translation Nissaya

kathaṃ=How then. ; tāva=firstly. ; vedanā=feelings. ; anupassitabbā=should be contemplated? ;

Myanmar Nissaya

kathaṃ=သို့လျှင်။ ; tāva=လက်မွန်။ ; vedanā=ကို။ ; anupassitabbā=ရှုအပ်သနည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3300 | Chunk: 55

Sukhā [M1.165] tāva vedanā dukkhato, dukkhā vedanā sallato, adukkhamasukhā vedanā aniccato anupassitabbā.

AI Translation based on Nissaya

First [M1.165], a pleasant feeling should be contemplated as suffering, a painful feeling as a dart, and a neither-painful-nor-pleasant feeling as impermanent.

Vietnamese AI Translation

Trước hết [M1.165], một lạc thọ nên được quán là khổ, một khổ thọ như một mũi tên, và một bất khổ bất lạc thọ như vô thường.

AI Translation Nissaya

tāva=Firstly. ; sukhā=so-called pleasant. ; vedanā=feeling. ; dukkhato=as suffering. ; anupassitabbā=should be contemplated. ; dukkhā=so-called painful. ; vedanā=feeling. ; sallato=as a dart. ; anupassitabbā=should be contemplated. ; adukkhamasukhā=so-called neither-painful-nor-pleasant. ; vedanā=feeling. ; aniccato=as impermanent. ; anupassitabbā=should be contemplated. ;

Myanmar Nissaya

tāva=စွာ။ ; sukhā=သုခ ဟုဆိုအပ်သော။ ; vedanā=ကို။ ; dukkhato=အားဖြင့်။ ; anupassitabbā=၏။ ; dukkhā=ဒုက္ခ ဟု ဆိုအပ်သော။ ; vedanā=ကို။ ; sallato=ငြောင့်အားဖြင့်။ ; anupassitabbā=၏။ ; adukkhamasukhā=ဥပေက္ခာဟု ဆိုအပ်သော။ ; vedanā=ကို။ ; aniccato=အားဖြင့်။ ; anupassitabbā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3301 | Chunk: 55

Yathāha –

AI Translation based on Nissaya

As it is said:

Vietnamese AI Translation

Như đã nói:

AI Translation Nissaya

yathāha=As it is said. ;

Myanmar Nissaya

yathāha=ဟူမူကား။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3302 | Chunk: 55

‘‘Yo [P1.178] sukhaṃ dukkhato adda, dukkhamaddakkhi sallato;

AI Translation based on Nissaya

'He who saw pleasure as suffering, and saw pain as a dart; [P1.178]

Vietnamese AI Translation

'Người nào thấy lạc là khổ, và thấy khổ như một mũi tên; [P1.178]

AI Translation Nissaya

yo sukhaṃ... la...=He who sees pleasure... etc. ;

Myanmar Nissaya

yo sukhaṃ.la.= ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3303 | Chunk: 55

Sa ve sammaddaso bhikkhu, parijānāti vedanā’’ ti. ( saṃ. ni. 4.253);

AI Translation based on Nissaya

That monk indeed, who sees rightly, fully understands feelings.' (S.iv.204)

Vietnamese AI Translation

Vị Tỳ khưu đó thật vậy, người thấy đúng đắn, thấu hiểu hoàn toàn các thọ.' (S.iv.204)

AI Translation Nissaya

vedanāti=as 'vedanā'. ; āha=it was said. ; Meaning of the verse: ; yo=Whichever noble disciple. ; sukhaṃ=pleasant feeling. ; dukkhato=as suffering. ; adda=saw. ; vā=saw. ; dukkhaṃ=painful feeling. ; sallato=as a dart. ; addakkhi=contemplated. ; adukkhamasukhaṃ=neither-painful-nor-pleasant feeling. ; santaṃ=is peaceful. ; naṃ=that peaceful neither-painful-nor-pleasant feeling. ; aniccato=as impermanent. ; addakkhi=contemplated. ; sammaddaso=who sees rightly. ; vā=having seen rightly. ; sa so bhikkhu=that noble disciple, the monk. ; ve=truly. ; vedanā=feelings. ; parijānāti=fully understands. ;

Myanmar Nissaya

vedanāti=ဟူ၍။ ; āha=၏။ ; ဂါထာအနက်။ ။ ; yo=အကြင်အရိယာဖြစ်သော တပည့်သည်။ ; sukhaṃ=သုခဝေဒနာကို။ ; dukkhato=ဒုက္ခအားဖြင့်။ ; adda=မြင်၏။ ; vā=မြင်၏။ ; dukkhaṃ=ကို။ ; sallato=ငြောင့်အားဖြင့်။ ; adakkhi=ရှု၏။ ; adukkhamasukhaṃ=ဥပေက္ခာ ဝေဒနာသည်။ ; santaṃ=ငြိမ်သက်၏။ ; naṃ=ထိုငြိမ်သက်သော ဥပေက္ခေါဝေဒနာကို။ ; aniccato=အားဖြင့်။ ; adakkhi=ရှု၏။ ; sammadaso=ကောင်းစွာ ရှုတတ်သော။ ; vā=ကောင်းစွာရှု၍ ပြီးသော။ ; sa so bhikkhu=ထိုအရိယာသာဝကဖြစ်သော ရဟန်းသည်။ ; ve=စင်စစ်။ ; vedanā=တို့ကို။ ; parijānāti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3304 | Chunk: 55

Sabbā eva cetā dukkhatopi anupassitabbā.

AI Translation based on Nissaya

And all of them should be contemplated as suffering.

Vietnamese AI Translation

Và tất cả chúng nên được quán là khổ.

AI Translation Nissaya

ca=Furthermore. ; sabbā eva=all. ; etā=these three kinds of feelings. ; dukkhato pi=as suffering also. ; anupassitabbā=should be contemplated. ;

Myanmar Nissaya

ca=ထိုမှတပါး။ ; sabbāeva=သော။ ; etā=ထိုသုံးပါးသော ဝေဒနာတို့ကို။ ; dukkhatopi=အားဖြင့်လည်း။ ; anupassitabbā=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3305 | Chunk: 55

Vuttañhetaṃ ‘‘yaṃkiñci vedayitaṃ, sabbaṃ taṃ dukkhasminti vadāmī’’ ti ( saṃ. ni. 4.259).

AI Translation based on Nissaya

For this has been said: 'Whatever is felt, I say that it is all included in suffering.' (S.iv.216)

Vietnamese AI Translation

Vì điều này đã được nói: 'Bất cứ gì được cảm thọ, Ta nói rằng tất cả đều bao gồm trong khổ.' (S.iv.216)

AI Translation Nissaya

hi saccaṃ=Truly. ; yaṃ kiñci... vadāmīti=the statement 'whatever is felt... I say'. ; etaṃ vacanaṃ=this statement. ; vuttaṃ=was said. ; (S.iv.216). ; yaṃ kiñci=Whatever. ; vedayitaṃ=is felt. ; atthi=is. ; sabbaṃ=all. ; taṃ=that feeling. ; dukkhasmiṃ=in suffering. ; antogadhaṃ=is included. ; iti=thus. ; vadāmi=I say. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; yaṃ kiñci.la. vadāmīti=ဟူသော။ ; etaṃ vacanaṃ=ကို။ ; vuttaṃ=၏။ ; (သံ ၂။ ၄၁၇)။ ; yaṃ kiñci=အလုံးစုံသော ။ ; vedayitaṃ=ဝေဒနာသည်။ ; atthi=၏။ ; sabbaṃ=သော။ ; taṃ=ထိုဝေဒနာသည်။ ; dukkhasmiṃ=ဒုက္ခ၌။ ; antogadhaṃ=အကျုံးဝင်၏။ ; iti=သို့။ ; vadāmi=ဟောတော်မူ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3306 | Chunk: 55

Sukhadukkhatopi ca anupassitabbā.

AI Translation based on Nissaya

And they should also be contemplated as pleasant and painful.

Vietnamese AI Translation

Và chúng cũng nên được quán là lạc và khổ.

AI Translation Nissaya

ca=Furthermore. ; sukhadukkhato pi=as pleasant and painful also. ; anupassitabbā=they should be contemplated. ;

Myanmar Nissaya

ca=ထိုမှ တပါး။ ; sukhadukkhatopi=သုခဝေဒနာ ဒုက္ခဝေဒနာအားဖြင့်လည်း။ ; anupassitabbā=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3307 | Chunk: 55

Yathāha –

AI Translation based on Nissaya

As it is said:

Vietnamese AI Translation

Như đã nói:

AI Translation Nissaya

yathāha=As the Buddha said, how did he say it? ;

Myanmar Nissaya

yathāha=ဘုရားအဘယ်ကဲံသို့ ဟောတော်မူပါသနည်း ဟူမူူကား။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3308 | Chunk: 55

‘‘sukhā vedanā ṭhitisukhā vipariṇāmadukkhā.

AI Translation based on Nissaya

'Pleasant feeling is pleasant when it persists and painful when it changes.

Vietnamese AI Translation

'Lạc thọ là lạc khi nó tồn tại và là khổ khi nó biến đổi.

AI Translation Nissaya

sukhā kho... la...=Pleasant feeling is indeed... etc. ;

Myanmar Nissaya

sukhā kho.la.= ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3309 | Chunk: 55

Adukkhamasukhā vedanā ñāṇasukhā aññāṇadukkhā’’ ti ( ma. ni. 1.465).

AI Translation based on Nissaya

Neither-painful-nor-pleasant feeling is pleasant when known and painful when not known.' (M.i.303)

Vietnamese AI Translation

Bất khổ bất lạc thọ là lạc khi được biết và là khổ khi không được biết.' (M.i.303)

AI Translation Nissaya

aññāṇadukkhāti=as 'painful when not known'. ; āha=he said. ; (M.i.303). ; āvuso=Friend Visākha, lay-follower Visākha. ; sukhā=Pleasant. ; vedanā=feeling. ; ṭhitisukhā=is pleasant when it persists. ; vipariṇāmadukkhā=is painful when it changes. ; dukkhā=Painful. ; vedanā=feeling. ; ṭhitidukkhā=is painful when it persists. ; vipariṇāmasukhā=is pleasant when it changes. ; adukkhamasukhā=Neither-painful-nor-pleasant. ; vedanā=feeling. ; ñāṇasukhā=is pleasant when known. ; aññāṇadukkhā=is painful when not known. ;

Myanmar Nissaya

aññāṇadukkhāti=ဟူ၍။ ; āha=၏။ ; (မ- ၁။ ၃၇၇)။ ; āvuso=ဝိသာခ၊ ဒါယကာ ဝိသာခ။ ; sukhā=ဖြစ်သော။ ; vedanā=သည်။ ; ṭhitisukhā=တည်သော အခါ၌ ချမ်းသာ၏။ ; vipariṇāmadukkhā=ဖောက်ပြန်သော အခါဆင်းရဲ၏။ ; dukkhā=ဒုက္ခဖြစ်သော။ ; vedanā=သည်။ ; ṭhitidukkhā=၏။ ; vipariṇāmasukhā=၏။ ; adukkhamasukhā=သော။ ; vedanā=သည်။ ; ñāṇasukhā=သိခြင်း၌ ချမ်းသာ၏။ ; aññāṇadukkhā=မသိခြင်း၌ ဆင်းရဲ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3310 | Chunk: 55

Apica aniccādisattaanupassanāvasenāpi anupassitabbā.

AI Translation based on Nissaya

Moreover, they should be contemplated by way of the seven contemplations, beginning with that of impermanence.

Vietnamese AI Translation

Hơn nữa, chúng nên được quán bằng bảy pháp quán, bắt đầu với vô thường.

AI Translation Nissaya

api ca (aparo=Another. ; nayo=method. ; mayā=by me. ; vuccate=will be explained.). ; aniccādisattaanupassanāvasenāpi=also by way of the seven contemplations beginning with the contemplation of impermanence. ; etā vedanā=these feelings. ; anupassitabbā=should be contemplated. ; (The seven are: one contemplates as impermanent, not as permanent; as suffering, not as pleasure; as non-self, not as self; one becomes dispassionate, one does not delight; one becomes detached, one does not become attached; one brings to cessation, one does not cause to arise; one relinquishes, one does not grasp. Thus it is.). ;

Myanmar Nissaya

apica (aparo=သော။ ; nayo=ကို။ ; mayā=သည်။ ; vuccate=အံ့။) ; aniccādisattaanupassanāvasenapi=အနိစ္စာနုပဿနာအစရှိသော ခုနစ်ပါးသော အနုပဿနာ တို့၏ အစွမ်းဖြင့်လည်း။ ; etā cetanā=တို့ကို။ ; anupassitabbā=ကုန်၏။ ; (ခုနစ်ပါးဟူသည် အနိစ္စတော အနုပဿတိ၊ နော နိစ္စတော။ ဒုက္ခတော အနုပဿတိ နော သုခတော။ အနတ္တတော အနုပဿတိ၊ နော အတ္တတော၊ နိဗ္ဗိန္ဒတိ နော နန္ဒတိ၊ ဝိရဇ္ဇတိ နောရဇ္ဇတိ၊ နိရောဓေတိ နော သမုပ္ပါဒေတိ၊ ပဋိပဇ္ဇတိ၊ နောအာဒိယတိ၊ ဤသို့တည်း။) ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3311 | Chunk: 55

Cittadhammesupi cittaṃ tāva ārammaṇādhipatisahajātabhūmikammavipākakiriyādinānattabhedānaṃ aniccādisattaanupassanānaṃ [V1.151] sarāgādisoḷasabhedānañca vasena anupassitabbaṃ, dhammā salakkhaṇasāmaññalakkhaṇānaṃ suññatādhammassa aniccādisattaanupassanānaṃ santāsantādīnañca vasena anupassitabbā.

AI Translation based on Nissaya

Regarding mind and phenomena, the mind should first be contemplated by way of its various distinctions such as object, dominant factor, co-nascence, plane, kamma, result, and functional action; and by way of the seven contemplations beginning with impermanence; and by way of the sixteen distinctions beginning with mind accompanied by greed. Phenomena should be contemplated by way of their specific and general characteristics, by way of the nature of emptiness, by way of the seven contemplations beginning with impermanence, and by way of presence, absence, and so on.

Vietnamese AI Translation

Về tâm và pháp, tâm trước hết nên được quán bằng cách phân biệt theo các khía cạnh khác nhau như đối tượng, nhân duyên chính, đồng sanh, cõi, nghiệp, quả, và hành động chức năng; và bằng bảy pháp quán bắt đầu với vô thường; và bằng mười sáu phân biệt bắt đầu với tâm có tham. Các pháp nên được quán bằng cách phân biệt theo các đặc tính riêng biệt và chung, bằng tính không, bằng bảy pháp quán bắt đầu với vô thường, và bằng cách có mặt, không có mặt, v.v.

AI Translation Nissaya

cittadhammesupi=Among mind and phenomena also. ; cittaṃ=the mind. ; tāva=firstly. ; (mayā=I. ; vuccate=will explain.). ; ārammaṇādhipatisahajātabhūmikammavipākakiriyādinānattabhedānaṃ=of the various distinctions of object such as the sphere of forms, etc., of dominance such as will, etc., of co-nascence such as knowledge, etc., of plane such as the sense-sphere, etc., of kamma such as wholesome and unwholesome, etc., of result, functional, etc., and also. ; aniccādisattaanupassanānaṃ=of the seven contemplations beginning with the contemplation of impermanence, and also. ; sarāgādisoḷasabhedānañca=of the sixteen distinctions beginning with mind accompanied by greed, and also. ; vasena=by way of. ; anupassitabbaṃ=should be contemplated. ; dhammā=phenomena, such as the hindrances. ; salakkhaṇasāmaññalakkhaṇānaṃ=of their own characteristics such as touching and hardness, etc., and of the general characteristics such as impermanence, etc., and also. ; suññatādhammassa=of the nature of emptiness, which is void of a being or a soul, as it comes in the section on emptiness, and also. ; aniccādisattaanupassanānañca=of the seven contemplations beginning with the contemplation of impermanence, and also. ; santāsantādīnañca=of being present and not being present, etc., and also. ; vasena=by way of. ; anupassitabbā=should be contemplated. ;

Myanmar Nissaya

cittadhammesupi=တို့တွင်လည်း။ ; cittaṃ=ကို။ ; tāva=စွာ။ ; (mayā=သည်။ ; vuccate=အံ့။) ; ārammaṇādhipatisahajātabhūmikammavipākakiriyādinā nattabhedānaṃ=ရူပါယတန အစရှိသော အာရုံ, ဆန္ဒအစရှိသော အဓိပတိ, ဉာဏ အစရှိသော သဟဇာတ, ကာမာဝစရ အစရှိသော ဘုံ, ကုသိုလ် အကုသိုလ် အစရှိသောကံ, ဝိပါက်ကိရိယာ အစရှိသော အထူးထူးအပြားပြားတို့၏ လည်းကောင်း။ ; aniccādisattaanupassanānaṃ=အနိစ္စာနုပဿနာအစရှိသော ခုနစ်ပါးသော အနုပဿနာတို့၏ လည်းကောင်း။ ; sarāgādisoḷasabhedānañca=သရာဂစိတ် အစရှိသော တစ်ဆယ့်ခြောက်ပါးသော အပြားတို့၏ လည်းကောင်း။ ; vasena=ဖြင့်။ ; anupassitabbaṃ=ရှုအပ် သတည်း။ ; dhammā=နီဝရဏ အစရှိသော တရားတို့ကို။ ; salakkhaṇa sāmaññalakkhaṇānaṃ=ဖုသန ကက္ခဠ အစရှိသော မိမိတို့၏ လက္ခဏာ, အနိစ္စ အစရှိသော သာမညလက္ခဏာတို့၏ လည်းကောင်း။ ; suññatādhammassa=သုညတဝါရ၌လာသော သတ္တဇီဝမှ ဆိတ်သော သဘော၏ လည်းကောင်း။ ; aniccādisattaanupassanānañṇa=အနိစ္စနုပဿနာအစရှိသော ခုနစ်ပါးသော အနုပဿာတို့၏ လည်းကောင်း။ ; santāsantādīnañca=ထင်ရှားရှိခြင်း ထင်ရှားမရှိခြင်း အစရှိသည်တို့၏ လည်းကောင်း။ ; vasena=ဖြင့်။ ; anupassitabbā=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3312 | Chunk: 55

Kāmañcettha yassa kāyasaṅkhāte loke abhijjhādomanassaṃ pahīnaṃ, tassa vedanādilokesupi taṃ pahīnameva, nānāpuggalavasena pana nānākkhaṇikasatipaṭṭhānabhāvanāvasena ca sabbattha vuttaṃ.

AI Translation based on Nissaya

And although for whomever covetousness and displeasure have been abandoned in the world designated as the body, for them it is indeed also abandoned in the worlds of feeling and so on, nevertheless it is stated for all of them on account of different individuals and on account of the development of the foundations of mindfulness in different moments.

Vietnamese AI Translation

Và mặc dù đối với bất cứ ai mà tham lam và bất mãn đã bị từ bỏ trong thế giới được gọi là thân, thì đối với họ, nó thật sự cũng bị từ bỏ trong thế giới của thọ và v.v., tuy nhiên nó được trình bày cho tất cả chúng là do những cá nhân khác nhau và do sự phát triển của các căn bản niệm trong các sát na khác nhau.

AI Translation Nissaya

ca=Further, let me state a special point. ; ettha=Herein, in this Establishment of Mindfulness. ; yassa puggalassa=for which person. ; vā=or, that person. ; kāyasaṅkhāte=called the body. ; loke=in the world, which is the aggregates of clinging. ; abhijjhādomanassaṃ=covetousness and displeasure. ; pahīnaṃ=are abandoned. ; tassa puggalassa=for that person. ; vā=or, that person. ; vedanādilokesupi=also in the worlds of feeling, etc. ; taṃ=that covetousness and displeasure. ; pahīnam eva=are indeed abandoned. ; kāmaṃ hoti=it may be so. ; pana tathāpi=However, even if it is so. ; nānāpuggalavasena=by way of different individuals and also. ; nānākkhaṇikasatipaṭṭhānabhāvanāvasena ca=by way of developing the establishment of mindfulness with different moments, and also. ; sabbattha=in all cases of body, feeling, mind, and phenomena. ; vuttaṃ=it was taught. ;

Myanmar Nissaya

ca=ဆိုဖွယ်အထူးကို ဆိုဦးအံ့။ ; ettha=ဤသတိပဋ္ဌာန်၌။ ; yassa puggalassa=အား။ ; vā=သည်။ ; kāyasaṅkhāte=ဟု ဆိုအပ်သော။ ; loke=ဥပါပါနက္ခန္ဓာ တည်းဟူသော လောက၌။ ; abhijjhādomanassaṃ=ကို။ ; pahīnaṃ=ပယ်အပ်၏။ ; tassa puggalassa=အား။ ; vā=သည်။ ; vedanādilokesupi=တို့၌လည်း။ ; taṃ=ထိုအဘိဇ္ဈာဒေါမနဿကို။ ; pahīnameva=ပယ်အပ်သည်သာလျှင်။ ; kāmaṃhoti=ရှင့်။ ; pana tathāpi=ယင်းသို့ တပဲဖြစ်လင့်ကစား။ ; nānāpuggalavasena=အထူးထူးသော ပုဂ္ဂိုလ်၏ အစွမ်းအားဖြင့်လည်ကောင်း။ ; nānākkhaṇikasatipaṭṭhānabhāvanāvasenaca=အထူးထူးသော ခဏရှိသော သတိပဋ္ဌာန်ကို ပွားသည်၏ အစွမ်းဖြင့်လည်းကောင်း။ ; sabbattha=အလုံးစုံသော ကာယ ဝေဒနာ စိတ္တဓမ္မတို့၌။ ; vuttaṃ=ဟောတော်မူအပ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3313 | Chunk: 55

Yato vā ekattha pahīnaṃ, sesesupi pahīnaṃ hoti.

AI Translation based on Nissaya

Or, because when it is abandoned in one, it is also abandoned in the others.

Vietnamese AI Translation

Hoặc, bởi vì khi nó bị từ bỏ trong một cái, nó cũng bị từ bỏ trong các cái khác.

AI Translation Nissaya

vā=The method is. ; yato yasmā kāraṇā=because. ; ekattha=in a single object, such as the body. ; pahīnaṃ=the abandoned covetousness and displeasure. ; sesesupi=in the remaining objects such as feeling, etc., also. ; pahīnaṃ=is abandoned. ; hoti=it is. ;

Myanmar Nissaya

vā=နည်းကား။ ; yato yasmā kāraṇā=အကြင့်ကြောင့်။ ; ekattha=တစ်ခုတည်းသော ကာယ အစရှိသော အာရုံ၌။ ; pahīnaṃ=ပယ်အပ်သော အဘိဇ္ဈာဒေါမနဿကို။ ; sesesupi=ကြွင်းသော ဝေဒနာအစရှိသည်တို့၌လည်း။ ; pahīnaṃ=ပယ်အပ်၏။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3314 | Chunk: 55

Tenevassa tattha pahānadassanatthampi evaṃ vuttanti veditabbaṃ.

AI Translation based on Nissaya

For that very reason, it should be understood that this was said in order to show its abandonment in the others as well.

Vietnamese AI Translation

Chính vì lý do đó, cần phải hiểu rằng điều này đã được nói để chỉ ra sự từ bỏ của nó trong các cái khác nữa.

AI Translation Nissaya

teneva=For that very reason. ; assa=of these two, covetousness and displeasure. ; tattha=in those remaining objects of feeling, mind, and phenomena. ; pahānadassanatthampi=also for the purpose of seeing the abandonment. ; evaṃ=thus. ; vuttaṃ=it was said. ; iti=thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

teneva=သာလျှင်။ ; assa=ထိုနှစ်ပါးသော အဘိဇ္ဈာဒေါမနဿကို။ ; tattha=ထိုကြွင်းသော ဝေဒနာ စိတ္တ ဓမ္မတို့၌။ ; pahānadassanatthampi=ပယ်ခြင်းကို ရှုခြင်းငှါလည်း။ ; evaṃ=ဤသို့။ ; vuttaṃ=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3315 | Chunk: 55

Iti ime cattāro satipaṭṭhānā pubbabhāge nānācittesu labbhanti.

AI Translation based on Nissaya

Thus, in the preliminary stage, these four foundations of mindfulness are obtained in different mind-moments.

Vietnamese AI Translation

Như vậy, trong giai đoạn sơ khởi, bốn căn bản niệm này được đạt được trong các sát na tâm khác nhau.

AI Translation Nissaya

iti iminā vuttappakārena=in this manner stated. ; cattāro=the four. ; ime satipaṭṭhānā=these foundations of mindfulness. ; pubbabhāge=in the preliminary phase of the path. ; nānācittesu=in different mind-moments. ; labbhanti=are obtained. ;

Myanmar Nissaya

iti iminā vuttappakārena=အားဖြင့်။ ; cattāro=ကုန်သော။ ; ime satipaṭṭhānā=တို့ကို။ ; pubbabhāge=မဂ်၏ ရှေ့အဖို့၌။ ; nānācittesu=သော စိတ္တက္ခဏတို့၌။ ; labbhanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3316 | Chunk: 55

Aññeneva hi cittena kāyaṃ pariggaṇhāti, aññena vedanaṃ, aññena cittaṃ, aññena dhamme pariggaṇhāti.

AI Translation based on Nissaya

For one comprehends the body with one mind, feeling with another, the mind with another, and phenomena with another.

Vietnamese AI Translation

Vì người ta thấu hiểu thân bằng một tâm, thọ bằng một tâm khác, tâm bằng một tâm khác, và pháp bằng một tâm khác.

AI Translation Nissaya

hi saccaṃ=Truly. ; aññeneva=with a different. ; cittena=mind. ; kāyaṃ=the body, consisting of hair, etc. ; pariggaṇhāti=one comprehends. ; aññena=with another. ; cittena=mind. ; vedanaṃ=feeling. ; pariggaṇhāti=one comprehends. ; aññena=with another. ; cittena=mind. ; cittaṃ=the mind. ; pariggaṇhāti=one comprehends. ; aññena=with another. ; cittena=mind. ; dhamme=phenomena, such as the hindrances. ; pariggaṇhāti=one comprehends. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; aññeneva=တပါးသာလျှင်ဖြစ်သော။ ; cittena=ဖြင့်။ ; kāyaṃ=ဆံ အစရှိသော ကာယကို။ ; pariggaṇhāti=သိမ်းဆည်း၏။ ; aññena=သော။ ; cittena=ဖြင့်။ ; vedanaṃ=ဝေဒနာကို။ ; pariggaṇhāti=၏။ ; aññena=သော။ ; cittena=ဖြင့်။ ; cittaṃ=ကို။ ; pariggaṇhāti=၏။ ; aññena=သော။ ; cittena=ဖြင့်။ ; dhamme=နီဝရဏ အစရှိသော တရားတို့ကို။ ; pariggaṇhāti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3317 | Chunk: 55

Lokuttaramaggakkhaṇe pana ekacitteyeva labbhanti.

AI Translation based on Nissaya

But at the moment of the supramundane path, they are obtained in a single mind-moment.

Vietnamese AI Translation

Nhưng tại sát na siêu thế đạo, chúng được đạt được trong một sát na tâm duy nhất.

AI Translation Nissaya

pana=I will speak of the supramundane. ; lokuttaramaggakkhaṇe=at the moment of the supramundane path. ; ekacitteyeva=in a single mind-moment only. ; labbhanti=they are obtained. ;

Myanmar Nissaya

pana=လောကုတ္တတရာကို ဆိုအံ့။ ; lokuttaramaggakkhaṇe=၌။ ; ekacitteyeva=တစ်ခုသော စိတ္တက္ခဏ၌သာလျှင်။ ; labbhanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3318 | Chunk: 55

Ādito hi kāyaṃ pariggaṇhitvā āgatassa vipassanāsampayuttā sati kāyānupassanā nāma, tāya satiyā samannāgato puggalo kāyānupassī nāma.

AI Translation based on Nissaya

For when, from the outset, a person has come to comprehend the body, the mindfulness associated with insight is called 'contemplation of the body,' and the person endowed with that mindfulness is called a 'contemplator of the body.'

Vietnamese AI Translation

Bởi vì khi, ngay từ đầu, một người đã thấu hiểu thân, thì chánh niệm tương ưng với tuệ quán được gọi là 'quán thân', và người được trang bị chánh niệm đó được gọi là 'người quán thân'.

AI Translation Nissaya

hi vitthāremi=I will elaborate. ; ādito=From the beginning of practicing the meditation subject. ; kāyaṃ=the body, consisting of hair, etc. ; pariggaṇhitvā=having comprehended. ; (naṃ=it. ; ussukkāpetvā=having striven.). ; āgatassa=of the person who has come. ; vipassanāsampayuttā=associated with insight. ; sati=mindfulness. ; kāyānupassanā nāma=is called contemplation of the body. ; tāya satiyā=with that mindfulness. ; samannāgato=endowed. ; puggalo=the person. ; kāyānupassī nāma=is called a contemplator of the body. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; ādito=အစစွာသော ကမ္မဋ္ဌာန်းကို စီးဖြန်းသည်မှ။ ; kāyaṃ=ဆံ အစရှိသော ကာယကို။ ; pariggaṇhitvā=၍။ ; (naṃ=ကို။ ; usuṇṇāpetvā=ကြိုးပမ်း၍။) ; āgatassa=လာသော ပုဂ္ဂိုလ်၏။ ; vipassanāsampayuttā=နှင့်ယှဉ်သော။ ; sati=သည်။ ; kāyānupassanā nāma=မည်၏။ ; tāya satiyā=နှင့်။ ; samannāgato=သော။ ; puggalo=သည်။ ; kāyānupassīnāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3319 | Chunk: 55

Vipassanaṃ ussukkāpetvā ariyamaggaṃ pattassa maggakkhaṇe maggasampayuttā sati kāyānupassanā nāma, tāya satiyā samannāgato puggalo kāyānupassī nāma.

AI Translation based on Nissaya

When a person, having striven for insight, has attained the noble path, at the moment of the path the mindfulness associated with the path is called 'contemplation of the body,' and the person endowed with that mindfulness is called a 'contemplator of the body.'

Vietnamese AI Translation

Khi một người, đã tinh tấn tuệ quán, đã đạt được Thánh đạo, thì tại sát na đạo, chánh niệm tương ưng với đạo được gọi là 'quán thân', và người được trang bị chánh niệm đó được gọi là 'người quán thân'.

AI Translation Nissaya

vipassanaṃ=insight. ; ussukkāpetvā=having striven for. ; ariyamaggaṃ=the noble path. ; pattassa=of the person who has attained. ; maggakkhaṇe=at the moment of the path. ; maggasampayuttā=associated with the path. ; sati=mindfulness. ; kāyānupassanā nāma=is called contemplation of the body. ; tāya satiyā=with that mindfulness. ; samannāgato=endowed. ; puggalo=the person. ; kāyānupassī nāma=is called a contemplator of the body. ;

Myanmar Nissaya

vipassanaṃ=ကို။ ; ussukkāpetvā=၍။ ; ariyamaggaṃ=ကို။ ; pattassa=ပုဂ္ဂိုလ်၏။ ; maggakkhaṇe=၌။ ; maggasampayuttā=သော။ ; sati=သည်။ ; kāyānupassanā nāma=မည်၏။ ; tāyasatiyā=နှင့်။ ; samannāgato=သော။ ; puggalo=သည်။ ; kāyānupassī nāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3320 | Chunk: 55

Vedanaṃ pariggaṇhitvā cittaṃ pariggaṇhitvā dhamme pariggaṇhitvā āgatassa vipassanāsampayuttā sati [M1.166] dhammānupassanā [P1.179] nāma, tāya satiyā samannāgato puggalo dhammānupassī nāma.

AI Translation based on Nissaya

When a person has come to comprehend feeling, to comprehend the mind, and to comprehend phenomena, the mindfulness associated with insight [M1.166] is called 'contemplation of phenomena,' [P1.179] and the person endowed with that mindfulness is called a 'contemplator of phenomena.'

Vietnamese AI Translation

Khi một người đã thấu hiểu thọ, đã thấu hiểu tâm, và đã thấu hiểu pháp, thì chánh niệm tương ưng với tuệ quán [M1.166] được gọi là 'quán pháp' [P1.179], và người được trang bị chánh niệm đó được gọi là 'người quán pháp'.

AI Translation Nissaya

vedanaṃ=feeling. ; pariggaṇhitvā=having comprehended. ; cittaṃ=the mind. ; pariggaṇhitvā=having comprehended. ; dhamme=phenomena, such as the hindrances. ; pariggaṇhitvā=having comprehended. ; āgatassa=of the person who has come. ; vipassanāsampayuttā=associated with insight. ; sati=mindfulness. ; dhammānupassanā nāma=is called contemplation of phenomena. ; tāya satiyā=with that mindfulness. ; samannāgato=endowed. ; puggalo=the person. ; dhammānupassī nāma=is called a contemplator of phenomena. ;

Myanmar Nissaya

vedanaṃ=ကို။ ; pariggaṇhitvā=၍။ ; cittaṃ=ကို။ ; pariggaṇhitvā=၍။ ; dhamme=နီဝရဏ အစရှိသော တရားတို့ကို။ ; pariggaṇhitvā=၍။ ; āgatassa=လာသော ပုဂ္ဂိုလ်၏။ ; vipassanāsampayuttā=သော။ ; sati=သည်။ ; dhammānupassanānāma=မည်၏။ ; tāya satiyā=နှင့်။ ; samannāgato=သော။ ; puggalo=သည်။ ; dhammānupassīnāma=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3321 | Chunk: 55

Vipassanaṃ ussukkāpetvā ariyamaggaṃ pattassa maggakkhaṇe maggasampayuttā sati dhammānupassanā nāma, tāya satiyā samannāgato puggalo dhammānupassī nāma.

AI Translation based on Nissaya

When a person, having striven for insight, has attained the noble path, at the moment of the path the mindfulness associated with the path is called 'contemplation of phenomena,' and the person endowed with that mindfulness is called a 'contemplator of phenomena.'

Vietnamese AI Translation

Khi một người, đã tinh tấn tuệ quán, đã đạt được Thánh đạo, thì tại sát na đạo, chánh niệm tương ưng với đạo được gọi là 'quán pháp', và người được trang bị chánh niệm đó được gọi là 'người quán pháp'.

AI Translation Nissaya

vipassanaṃ=insight. ; ussukkāpetvā=having striven for. ; ariyamaggaṃ=the noble path. ; pattassa=of the person who has attained. ; maggakkhaṇe=at the moment of the path. ; maggasampayuttā=associated with the path. ; sati=mindfulness. ; dhammānupassanā nāma=is called contemplation of phenomena. ; tāya satiyā=with that mindfulness. ; samannāgato=endowed. ; puggalo=the person. ; dhammānupassanā nāma=is called a contemplator of phenomena. ;

Myanmar Nissaya

vipassanaṃ=ကို။ ; ussukkāpetvā=၍။ ; ariyamaggaṃ=သို့။ ; pattassa=ပုဂ္ဂိုလ်၏။ ; maggakkhaṇe=၌။ ; maggasampayuttā=သော။ ; sati=သည်။ ; dhammānupassanā nāma=မည်၏။ ; tāya satiyā=နှင့်။ ; samannāgato=သော။ ; puggalo=သည်။ ; dhammānupassanāma=မည်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3322 | Chunk: 55

Evaṃ tāva desanā puggale tiṭṭhati.

AI Translation based on Nissaya

Thus, to begin with, the teaching is established in terms of the person.

Vietnamese AI Translation

Như vậy, trước hết, giáo lý được thiết lập theo phương diện cá nhân.

AI Translation Nissaya

evaṃ=in this way. ; tāva=firstly. ; desanā=the teaching. ; puggale=in the person. ; tiṭṭhati=is established. ;

Myanmar Nissaya

evaṃ=သောနည်းဖြင့်။ ; tāva=လက်မွန်မဆွ။ ; desanā=သည်။ ; puggale=၌။ ; tiṭṭhati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3323 | Chunk: 55

Kāye pana ‘‘subhan’’ ti vipallāsappahānā kāyapariggāhikā sati maggena samijjhatīti kāyānupassanā nāma.

AI Translation based on Nissaya

In terms of phenomena, however, because the mindfulness that comprehends the body, which abandons the perversion of perceiving the body as 'beautiful,' is accomplished by the path, it is called 'contemplation of the body.'

Vietnamese AI Translation

Tuy nhiên, theo phương diện pháp, bởi vì chánh niệm thấu hiểu thân, vốn từ bỏ sự điên đảo tri giác thân là 'đẹp', được thành tựu bởi đạo, nên nó được gọi là 'quán thân'.

AI Translation Nissaya

pana=Now I will speak from the perspective of the Dhamma. ; kāye=in the body, consisting of hair, etc. ; subhan ti vipallāsappahānā=which abandons the perversion of perceiving as 'beautiful'. ; kāyapariggāhikā=which comprehends the body, consisting of hair, etc. ; sati=mindfulness. ; maggena=by the path. ; samijjhati=is accomplished. ; vā=is fulfilled. ; iti tasmā=therefore. ; kāyānupassanā nāma=it is called contemplation of the body. ;

Myanmar Nissaya

pana=ဓမ္မဒိဋ္ဌာန်ကို ဆိုဦးအံ့။ ; kāye=ဆံအစရှိသော ကာယ၌။ ; subhantivipallāsappahānā=တင့်တယ်၏ ဟူ၍ နှလုံးသွင်းခြင်းတည်းဟူသော ဖောက်ပြန်ခြင်းကို ပယ်တတ်သော။ ; kāyapariggāhitā=ဆံ အစရှိသော ကာယကို သိမ်းဆည်းတတ်သော။ ; sati=သည်။ ; maggena=ဖြင့်။ ; samijjhati=ပြည့်စုံ၏။ ; vā=ပြီီး၏။ ; iti tasmā=ကြောင့်။ ; kāyānupassanānāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3324 | Chunk: 55

Vedanāya ‘‘sukhā’’ ti vipallāsappahānā vedanāpariggāhikā sati maggena samijjhatīti vedanānupassanā nāma.

AI Translation based on Nissaya

Because the mindfulness that comprehends feeling, which abandons the perversion of perceiving feeling as 'pleasant,' is accomplished by the path, it is called 'contemplation of feeling.'

Vietnamese AI Translation

Bởi vì chánh niệm thấu hiểu thọ, vốn từ bỏ sự điên đảo tri giác thọ là 'lạc', được thành tựu bởi đạo, nên nó được gọi là 'quán thọ'.

AI Translation Nissaya

vedanāya=in feeling. ; sukhā ti vipallāsappahānā=which abandons the perversion of perceiving as 'pleasant'. ; vedanāpariggāhikā=which comprehends feeling. ; sati=mindfulness. ; maggena=by the path. ; samijjhati=is accomplished. ; iti tasmā=therefore. ; vedanānupassanā nāma=it is called contemplation of feeling. ;

Myanmar Nissaya

vedanāya=၌။ ; sukhātivipallāsappahanā=ကိုပယ်တတ်သော။ ; vedanāpariggāhikā=တတ်သော။ ; sati=သည်။ ; maggena=ဖြင့်။ ; samijjhati=၏။ ; iti tasmā=ကြောင့်။ ; vedanānupassanānāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3325 | Chunk: 55

Citte ‘‘niccan’’ ti vipallāsappahānā cittapariggāhikā sati maggena samijjhatīti cittānupassanā nāma.

AI Translation based on Nissaya

Because the mindfulness that comprehends the mind, which abandons the perversion of perceiving the mind as 'permanent,' is accomplished by the path, it is called 'contemplation of the mind.'

Vietnamese AI Translation

Bởi vì chánh niệm thấu hiểu tâm, vốn từ bỏ sự điên đảo tri giác tâm là 'thường', được thành tựu bởi đạo, nên nó được gọi là 'quán tâm'.

AI Translation Nissaya

citte=in the mind. ; niccan ti vipallāsappahānā=which abandons the perversion of perceiving as 'permanent'. ; cittapariggāhikā=which comprehends the mind. ; sati=mindfulness. ; maggena=by the path. ; samijjhati=is accomplished. ; iti tasmā=therefore. ; cittānupassanā nāma=it is called contemplation of the mind. ;

Myanmar Nissaya

citte=၌။ ; niccanti vipallāsappahānā=ပယ်တတ်သေ။ ; cittapariggāhikā=တတ်သော။ ; sati=သည်။ ; maggena=ဖြင့်။ ; samijjhati=၏။ ; iti tasmā=ကြောင့်။ ; cittānupassanānāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3326 | Chunk: 55

Dhammesu ‘‘attā’’ ti vipallāsappahānā dhammapariggāhikā sati maggena samijjhatīti dhammānupassanā nāma.

AI Translation based on Nissaya

Because the mindfulness that comprehends phenomena, which abandons the perversion of perceiving phenomena as 'self,' is accomplished by the path, it is called 'contemplation of phenomena.'

Vietnamese AI Translation

Bởi vì chánh niệm thấu hiểu pháp, vốn từ bỏ sự điên đảo tri giác pháp là 'ngã', được thành tựu bởi đạo, nên nó được gọi là 'quán pháp'.

AI Translation Nissaya

dhammesu=in phenomena such as the hindrances. ; attā ti vipallāsappahānā=which abandons the perversion of perceiving as 'self'. ; dhammapariggāhikā=which comprehends phenomena such as the hindrances. ; sati=mindfulness. ; maggena=by the path. ; vā=because. ; samijjhati=is accomplished. ; iti tasmā=therefore. ; dhammānupassanā nāma=it is called contemplation of phenomena. ;

Myanmar Nissaya

dhammesu=နီဝရဏ အစရှိသော တရားတို့၌။ ; attā tivipallāsappahānā=ပယ်တတ်သော။ ; dhammapariggāhikā=နီဝရဏအစရှိသော တရားတို့ကို သိမ်းဆည်းတတ်သော။ ; sati=သည်။ ; maggena=ဖြင့်။ ; vā=ကြောင့်။ ; samijjhati=၏။ ; iti tasmā=ကြောင့်။ ; dhammānupassanānāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3327 | Chunk: 55

Iti ekāva maggasampayuttā sati catukiccasādhakattena cattāri nāmāni labhati.

AI Translation based on Nissaya

Thus, one single path-associated mindfulness obtains four names by virtue of accomplishing four functions.

Vietnamese AI Translation

Như vậy, một chánh niệm duy nhất tương ưng với đạo đạt được bốn tên gọi nhờ thành tựu bốn chức năng.

AI Translation Nissaya

iti evaṃ iminā vuttanayena=Thus, in this way stated. ; ekā eva=one single. ; maggasampayuttā=path-associated. ; sati=mindfulness. ; catukiccasādhakattena=by accomplishing four functions. ; cattāri=four. ; nāmāni=names. ; labhati=obtains. ;

Myanmar Nissaya

iti evaṃ iminā vuttanayena=ဖြင့်။ ; ekāva=တစ်ပါးတည်းသာလျှင်ဖြစ်သော။ ; maggasampayuttā=သော။ ; sati=သည်။ ; catukiccasādhakattena=လေးပါးသော ကိစ္စကို ပြီးစေတတ်၏ အဖြစ်ကြောင့်။ ; cattāri=ကုန်သော။ ; nāmāni=တို့ကို။ ; labhati=ရ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3328 | Chunk: 55

Tena vuttaṃ ‘‘lokuttaramaggakkhaṇe pana ekacitteyeva labbhantī’’ ti.

AI Translation based on Nissaya

For that reason it was said by me, 'but at the moment of the supramundane path, they are obtained in a single mind-moment.'

Vietnamese AI Translation

Chính vì lý do đó, tôi đã nói, 'nhưng tại sát na siêu thế đạo, chúng được đạt được trong một sát na tâm duy nhất.'

AI Translation Nissaya

tena=For that reason. ; lokuttaramaggakkhaṇe pana ekacitteyeva labbhantīti=as 'but at the moment of the supramundane path, they are obtained in a single mind-moment'. ; mayā=by me, the teacher Mahānāma. ; vuttaṃ=it was said. ;

Myanmar Nissaya

tena=ကြောင့်။ ; lokuttaramaggakkhaṇe pana ekacitteyeva labbhantīti=ဟူ၍။ ; mayā=ငါ မဟာနာမ်ဆရာသည်။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3329 | Chunk: 55

Sammāsamādhiniddese vivicceva kāmehīti kāmehi viviccitvā vinā hutvā apakkamitvā.

AI Translation based on Nissaya

In the explanation of Right Concentration, 'vivicceva kāmehi' means having secluded oneself from sensual pleasures, being without them, having departed from them.

Vietnamese AI Translation

Trong phần giải thích về Chánh Định, 'vivicceva kāmehi' có nghĩa là đã ly dục khỏi các dục lạc, không có chúng, đã rời bỏ chúng.

AI Translation Nissaya

sammāsamādhiniddese=In the explanation of Right Concentration. ; (attho=the meaning. ; evaṃ=thus. ; veditabbo=should be understood.). ; vivicceva kāme hīti=As for 'vivicceva kāmehi'. ; kāmehi=from sensual pleasures of the object and defilement. ; vivicitvā=having secluded oneself. ; vinā=being without. ; hutvā=being. ; apakkamitvā=having departed. ;

Myanmar Nissaya

sammāsamādhiniddese=၌။ ; (attho=ကို။ ; evaṃ=ဖြင့်။ ; veditabbo=၏။) ; vivicceva kāme hīti=ကား။ ; kāmehi=ဝတ္ထုကာမ ကိသေလာကာမတို့မှ။ ; vivicitvā=ဆိတ်၍။ ; vinā=ကင်းသည်။ ; hutvā=၍။ ; apakkamitvā=ဖဲကြဉ်၍။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3330 | Chunk: 55

Yo panāyamettha evakāro, so niyamatthoti veditabbo.

AI Translation based on Nissaya

The particle 'eva' here should be understood to have the sense of determination.

Vietnamese AI Translation

Tiểu từ 'eva' ở đây nên được hiểu có nghĩa là xác định.

AI Translation Nissaya

pana=I will explain the meaning of the particle 'eva'. ; ettha=Herein, in the word 'vivicceva'. ; yo ayaṃ evakāro=whatever particle 'eva'. ; vā=whatever character 'eva' has. ; atthi=is. ; so evakāro=that particle 'eva'. ; niyamattho=has the meaning of determination. ; vā=has the meaning of certainty. ; iti=thus. ; veditabbo=it should be understood. ;

Myanmar Nissaya

pana=ဧဝ သဒ္ဒါ၏ အနက်ကိုဆိုအံ့။ ; ettha=ဤဝိဝိစ္စေတဟူသော ပုဒ်၌။ ; yo ayaṃ evakāro=အကြင် ဧဝ သဒ္ဒါသည်။ ; vā=အကြင်သို့ သဘောရှိသော ဤ ဧဝ အက္ခရာသည်။ ; atthi=၏။ ; so evakāro=သည်။ ; niyamattho=မှတ်ခြင်းအနက်ရှိ၏။ ; vā=မြဲခြင်းအနက်ရှိ၏။ ; iti=သို့။ ; veditabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3331 | Chunk: 55

Yasmā ca niyamattho, tasmā paṭhamajjhānaṃ upasampajja viharaṇasamaye avijjamānānampi kāmānaṃ tassa paṭhamajjhānassa paṭipakkhabhāvaṃ kāmapariccāgeneva cassa adhigamaṃ dīpeti.

AI Translation based on Nissaya

And because it has the sense of determination, it shows that even though sensual pleasures are absent at the time of abiding having attained the first jhāna, they are the opponents of that first jhāna, and that its attainment comes only through the relinquishing of sensual pleasures.

Vietnamese AI Translation

Và bởi vì nó có nghĩa là xác định, nó chỉ ra rằng mặc dù các dục lạc không có mặt vào thời điểm an trú đã đạt được sơ thiền, chúng là đối thủ của sơ thiền đó, và sự đạt được nó chỉ đến thông qua sự từ bỏ các dục lạc.

AI Translation Nissaya

ca=Furthermore. ; yasmā=because. ; niyamattho=it has the meaning of determination or certainty. ; tasmā=therefore. ; paṭhamajjhānaṃ=the first jhāna. ; vā=or to it. ; upasampajja=having fully attained. ; vā=having reached. ; viharaṇasamaye=at the time of dwelling. ; avijjamānānam pi=even though they are not present. ; kāmānaṃ=of sensual pleasures of the object and defilement. ; tassa paṭhamajjhānassa=of that first jhāna. ; paṭipakkhabhāvaṃ=the state of being the opponent, also. ; kāmapariccāgena eva=only by the relinquishment of the two kinds of sensual pleasures. ; assa=that first jhāna. ; adhigamañca=and its attainment, also. ; dīpeti=it shows. ;

Myanmar Nissaya

ca=ဆက်။ ; yasmā=ကြောင့်။ ; niyamattho=မှတ်ခြင်းမြဲခြင်း အနက်ရှိ၏။ ; tasmā=ကြောင့်။ ; paṭhamajjhānaṃ=ကို။ ; vā=သို့။ ; upasampajja=ပြည့်စုံစေ၍။ ; vā=ရောက်၍။ ; viharaṇasamaye=နေသောအခါ၌။ ; avijjamānampi=ထင်ရှားမရှိသည် လည်းဖြစ်ကုန်သော။ ; kāmānaṃ=ဝတ္ထုကာမ ကိလေသာကာမတို့၏။ ; tassa paṭhamajjhānassa=၏။ ; paṭipakkhabhāvaṃ=ဆန့်ကျင်သည်၏ အဖြစ်ကိုလည်းကောင်း။ ; kāmapariccāgeneva=နှစ်ပါးသော ကာမတို့ကို စွန့်သဖြင့် သာလျှင်။ ; assa=ထိုပဌမဈာန်ကို။ ; adhigamañca=ရခြင်းကိုလည်းကောင်း။ ; dīpeti=ပြ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3332 | Chunk: 55

Kathaṃ ?

AI Translation based on Nissaya

How so?

Vietnamese AI Translation

Như thế nào?

AI Translation Nissaya

kathaṃ dīpeti=How does it show this?. ;

Myanmar Nissaya

kathaṃ dīpeti=ကား။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3333 | Chunk: 55

‘‘Vivicceva kāmehī’’ ti evañhi niyame kayiramāne idaṃ paññāyati – nūnimassa jhānassa kāmā paṭipakkhabhūtā, yesu sati [V1.152] idaṃ na pavattati, andhakāre sati padīpobhāso viya, tesaṃ pariccāgeneva cassa adhigamo hoti orimatīrapariccāgena pārimatīrassa viya.

AI Translation based on Nissaya

Indeed, when the specification is made thus, "Secluded only from sensual pleasures," this becomes apparent: surely, sensual pleasures are the opponents of this jhāna. When they are present, this jhāna does not arise, just as the light of a lamp does not appear in darkness. And its attainment comes only through their abandonment, just as the far shore is reached only by abandoning the near shore.

Vietnamese AI Translation

Thật vậy, khi sự xác định được thực hiện như vậy, “Ly dục chỉ từ các dục lạc,” điều này trở nên rõ ràng: chắc chắn, các dục lạc là đối thủ của thiền này. Khi chúng có mặt, thiền này không sanh khởi, cũng như ánh sáng của một ngọn đèn không xuất hiện trong bóng tối. Và sự đạt được nó chỉ đến thông qua sự từ bỏ của chúng, cũng như bờ bên kia chỉ được đến bằng cách từ bỏ bờ bên này.

AI Translation Nissaya

hi vitthāremi=Indeed. ; viviccevakāmehīti=as "secluded from sensual pleasures". ; evaṃ=Thus. ; niyame=the specification with the word 'eva'. ; kayiramāne=when it is made. ; idaṃ atthajātaṃ=this meaning. ; paññāyati=becomes apparent. ; kiṃ paññāyati=What becomes apparent? ; nūnu=Surely. ; kāmā=sensual pleasures. ; imassa jhānassa=of this first jhāna. ; paṭipakkhabhūtā=are antagonistic. ; vā=or, are of an opposing nature. ; anvakāre=In darkness. ; sati=when there is. ; padīpobhāso=the light of a lamp. ; napavattati viya=just as it does not arise. ; yesu=When which sensual pleasures. ; sati santesu=are present. ; idaṃ=this first jhāna. ; napavattati=does not arise. ; ca=And, apart from the meaning of opposition, I will speak of the meaning of attainment through abandonment. ; orimatīrapariccāgena=by abandoning the near shore. ; vā=only by abandoning. ; pārimatīrassa=the far shore. ; adhigamo=is attained. ; hotiviya=just as it is. ; tesaṃ=those sensual pleasures. ; pariccāgeneva=only by abandoning. ; assa=this first jhāna. ; adhigamo=is attained. ; hoti=is. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; viviccevakāmehīti=ဟူ၍။ ; evaṃ=သို့။ ; niyame=ဧဝ သဒ္ဒါဖြင့် မြဲစေခြင်းကို။ ; kayiramāne=သော်။ ; idaṃ atthajātaṃ=သည်။ ; paññāyati=ထင်၏။ ; kiṃ paññāyati=ကား။ ; nūnu=စင်စစ်။ ; kāmā=တို့သည်။ ; imassa jhānassa=ဤပဌမဈာန်၏။ ; paṭipakkhabhūtā=ကုန်သော။ ; vā=ဆန့်ကျင်ဘက်အားဖြင့် ဖြစ်ကုန်၏။ ; anvakāre=အမိုက်တိုက်သည်။ ; sati=သော်။ ; padīpobhāso=သည်။ ; napavattati viya=မဖြစ်သကဲ့သို့။ ; yesu=အကြင် ကာမတို့သည်. ; sati santesu=ကုန်သော်။ ; idaṃ=ဤပဌမဈာန်သည်။ ; napavattati=မဖြစ်။ ; ca=ပဋိပက္ခအနက်မှ တပါး ပရိစ္စာဂါဓိဂမအနက်ကို ဆိုအံ့။ ; orimatīrapariccāgena=ဤမှာ ဘက်ကမ်းကို စွန့်သဖြင့်။ ; vā=စွန့်မှသာလျှင်။ ; pārimatīrassa=ထိုမှာဘက်ကမ်းကို။ ; adhigamo=ရခြင်းသည်။ ; hotiviya=ကဲ့သို့။ ; tesaṃ=ထိုကာမတို့ကို။ ; pariccāgeneva=စွန့်မှသာလျှင်။ ; assa=ထိုပဌမဈာန်ကို။ ; adhigamo=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3334 | Chunk: 56

Tasmā niyamaṃ karotīti.

AI Translation based on Nissaya

Therefore, he makes the specification. Thus it is shown.

Vietnamese AI Translation

Do đó, Ngài thực hiện sự xác định. Như vậy điều đó được chỉ ra.

AI Translation Nissaya

tasmā=Therefore. ; niyamaṃ=the specification with the word 'eva'. ; karoti=he makes. ; iti=Thus. ; dīpeti=he explains. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; niyamaṃ=ဧဝ သဒ္ဒါဖြင့် ပြီးစေခြင်းကို။ ; karoti=၏။ ; iti=ဤသို့။ ; dīpeti=ပြ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3335 | Chunk: 56

Tattha siyā, kasmā panesa pubbapadeyeva vutto, na uttarapade, kiṃ akusalehi dhammehi aviviccāpi jhānaṃ upasampajja vihareyyāti ?

AI Translation based on Nissaya

Regarding this, a question might arise: Why, then, is this 'eva' (only) stated in the preceding phrase and not in the following one? Could one, even without being secluded from unwholesome states, attain and dwell in jhāna?

Vietnamese AI Translation

Về vấn đề này, một câu hỏi có thể nảy sinh: Tại sao, vậy thì, từ 'eva' (chỉ) này được nêu trong cụm từ trước mà không phải trong cụm từ sau? Liệu một người, ngay cả khi không ly các pháp bất thiện, có thể chứng đắc và an trú trong thiền na (jhāna) không?

AI Translation Nissaya

tattha=Regarding that phrase "vivicceva kāmehi". ; (kassaci=of a certain. ; codatassa=questioner. ; codanā=a question). ; siyā=may arise. ; kiṃsiyā=What might it be? ; kasmāpana=Why then. ; esa eso evakāro=is this word 'eva'. ; pubbapadeyeva=stated only in the preceding phrase, 'vivicca'. ; vutto=spoken? ; uttarapade=In the following phrase 'vivicca akusalehi'. ; navutto=is it not spoken? ; akusalehi=from unwholesome. ; dhammehi=states. ; aviviccāpi=even without being secluded. ; vā=or without being secluded. ; jhānaṃ=the first jhāna. ; upasampajja=having attained. ; vā=or having entered jhāna. ; vihareyyakiṃ=could one dwell? ; iti=Thus. ; (kassaci=of a certain. ; codakassa=questioner. ; codanā=a question). ; siyā=might arise. ;

Myanmar Nissaya

tattha=ထိုဝိဝိစ္ဏေဝ ကာမေဟိ ဟူသော ပုဒ်၌။ ; (kassaci=တစ်စုံတစ်ယောက်သော။ ; codatassa=၏။ ; codanā=ခြင်းတို့သည်။) ; siyā=၏။ ; kiṃsiyā=ဟူမူကား။ ; kasmāpana=အတီသို့ ဟူ၍သာလျှင်။ ; esa eso evakāro=ကို။ ; pubbapadeyeva=ရှေ့ဖြစ်သော ဝိဝိစ္စ ဟူသော ပုဒ်၌သာလျှင်။ ; vutto=သနည်း။ ; uttarapade=နောက်ဖြစ်သော ဝိဝိစ္စ အကုသလေဟိ ဟူသော ပုဒ်၌။ ; navutto=သနည်း။ ; akusalehi=ကုန်သော။ ; dhammehi=တို့မှ။ ; aviviccāpi=မဆိတ်မူ၍လည်း။ ; vā=မဆိပ်ဘဲလည်း။ ; jhānaṃ=ပဌမဈာန်ကို။ ; upasampajja=စေ၍။ ; vā=ဈာန်ဝင်စား၍။ ; vihareyyakiṃ=နေရာသလော။ ; iti=သို့။ ; (kassaci=သော။ ; codakassa=၏။ ; codanā=ခြင်းသည်။) ; siyā=ဖြစ်ရာ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3336 | Chunk: 56

Na kho panetaṃ evaṃ daṭṭhabbaṃ.

AI Translation based on Nissaya

Indeed, this should not be seen in that way.

Vietnamese AI Translation

Thực vậy, điều này không nên được nhìn nhận theo cách đó.

AI Translation Nissaya

kho pana=Indeed. ; etaṃ atthaṃ=this matter. ; evaṃ=in the way the questioner has stated. ; nadaṭṭhabbaṃ=should not be seen. ;

Myanmar Nissaya

kho pana=စင်စစ်။ ; etaṃ atthaṃ=ကို။ ; evaṃ=ဤသို့ စောဒကဆရာဆိုတိုင်း။ ; nadaṭṭhabbaṃ=အပ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3337 | Chunk: 56

Taṃnissaraṇato hi pubbapade esa vutto.

AI Translation based on Nissaya

Indeed, it is stated in the preceding phrase because this is the escape from them.

Vietnamese AI Translation

Thực vậy, nó được nêu trong cụm từ trước bởi vì đây là sự thoát ly khỏi chúng.

AI Translation Nissaya

hi saccaṃ=Truly. ; taṃ nissaraṇato=because it is the escape and the cause of escape from those sensual pleasures. ; (Mūlaṭīkā). ; vā=or, because it is the abandonment and the cause of abandonment of those sensual pleasures. ; (Visuddhimagga-ṭīkā). ; pubbapade=in the preceding phrase 'vivicca'. ; esa eso evakāro=this word 'eva'. ; vutto=is stated. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; taṃ nissaraṇato=ထိုကာမတို့သည် ထွက်မြောက်ရာ ထွက်မြောက်ကြောင်း၏ အဖြစ်ကြောင့်။ ; (မူလဋီကာ)။ ; vā=ထိုကာမတို့ကို ပယ်ရာပယ်ကြောင်း၏ အဖြစ်ကြောင့်။ ; (ဝိသုဒ္ဓိမဂ် ဋီကာ)။ ; pubbapade=ရှေ့ဖြစ်သော ဝိဝိစ္စ ဟူသော ပုဒ်၌။ ; esa eso evakāro=ကို။ ; vutto=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3338 | Chunk: 56

Kāmadhātusamatikkamanato hi kāmarāgapaṭipakkhato ca idaṃ jhānaṃ kāmānameva nissaraṇaṃ.

AI Translation based on Nissaya

For this jhāna is the escape from sensual pleasures alone, both because it transcends the sense-sphere realm and because it is the opponent of sensual lust.

Vietnamese AI Translation

Vì thiền na này là sự thoát ly khỏi riêng các dục lạc, cả vì nó vượt qua cõi dục giới và vì nó là đối nghịch của dục ái.

AI Translation Nissaya

kāmadhātusamatikkamanato=because of transcending the sense-sphere realm, and. ; kāmarāgapaṭipakkhatoca=because of being the opponent of sensual lust. ; idaṃ jhānaṃ=this jhāna. ; kāmānameva=of sensual pleasures alone. ; vā=from them alone. ; nissaraṇaṃ=is the escape. ; (vā)=is the escape. ; hoti=is. ;

Myanmar Nissaya

kāmadhātusamatikkamanato=ကာမဓာတ်ကို လွန်မြောက်ခြင်းကြောင့် လည်းကောင်း။ ; kāmarāgapaṭipakkhatoca=ကာမရာဂ၏ ဆန့်ကျင်ဘက်၏ အဖြစ်ကြောင့်လည်းကောင်း။ ; idaṃ jhānaṃ=ဤပဌမဈာန်သည်။ ; kāmānameva=တို့၏သာလျှင်။ ; vā=တို့မှ သာလျှင်။ ; nissaraṇaṃ=ထွက်မြောက်ရသည်။ ; (vā)=ထွက်မြောက်ခြင်းသည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3339 | Chunk: 56

Yathāha –

AI Translation based on Nissaya

As it is said:

Vietnamese AI Translation

Như có lời dạy rằng:

AI Translation Nissaya

yathāha=As it is said. ;

Myanmar Nissaya

yathāha=ကား။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3340 | Chunk: 56

‘‘kāmānametaṃ nissaraṇaṃ yadidaṃ nekkhamman’’ ti [P1.180] ( itivu. 72).

AI Translation based on Nissaya

“This escape from sensual pleasures, that is, renunciation” (Itivuttaka 72).

Vietnamese AI Translation

“Sự thoát ly khỏi các dục lạc này, đó là, sự xuất ly” (Itivuttaka 72).

AI Translation Nissaya

kamānametaṃ nissaraṇaṃ yadidaṃ nekkhammanti=as "This escape from sensual pleasures, that is, renunciation". ; āha=he said. ; (This Paṭisambhidāmagga Pāḷi.) ; yadidaṃ yaṃ idaṃ nekkhammaṃ=Whatever jhāna. ; atthi=there is. ; etaṃ=that jhāna. ; kāmānaṃ=of sensual objects and sensual defilements. ; nissaraṇaṃ=is the escape. ;

Myanmar Nissaya

kamānametaṃ nissaraṇaṃ yadidaṃ nekkhammanti=ဟူ၍။ ; āha=၏။ ; (ဤပဋိသမ္ဘိဒါမဂ်ပါဠိ။) ; yadidaṃ yaṃ idaṃ nekkhammaṃ=အကြင်ဈာန်သည်။ ; atthi=၏။ ; etaṃ=ထိုဈာန်သည်။ ; kāmānaṃ=ဝတ္ထုကာမ ကိသေလာကာမတို့၏။ ; nissaraṇaṃ=ရာတည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3341 | Chunk: 56

Uttarapadepi pana yathā ‘‘idheva, bhikkhave, samaṇo, idha dutiyo samaṇo’’ ti ( ma. ni. 1.139; a. ni. 4.241) ettha evakāro ānetvā vuccati, evaṃ vattabbo.

AI Translation based on Nissaya

But just as in the passage, “Here only, monks, is a contemplative; here a second contemplative” (M I 139; A II 241), the word 'eva' is brought forward and applied, so too should it be applied to the following phrase.

Vietnamese AI Translation

Nhưng cũng giống như trong đoạn kinh, “Chỉ ở đây, này các Tỳ khưu, có một vị sa môn; ở đây có vị sa môn thứ hai” (M I 139; A II 241), từ 'eva' được đưa ra phía trước và áp dụng, thì nó cũng nên được áp dụng cho cụm từ theo sau.

AI Translation Nissaya

pana tathāpi=However, even if it is taught only in the preceding phrase. ; uttaradepi=in the following phrase 'vivicca' as well. ; idheva bhikkhave.la. samaṇoti ettha=in the Cūḷasīhanāda Sutta of the Mūlapaṇṇāsa (M 1.139). ; vavakāro=the word 'eva'. ; ānetvā=bringing it to the following phrase. ; vuccatiyathā=as it is said. ; evaṃtathā=in the same way. ; (ānetvā=having brought it. ; vattabbo=it should be stated). ; bhikkhave=Monks. ; idheva=here alone. ; samaṇo=the monk who is a stream-enterer. ; atthi=is found. ; idhaidheva=here alone. ; dutiyo=the second. ; samaṇo=monk who is a once-returner. ; atthi=is found. ;

Myanmar Nissaya

pana tathāpi=ထိုသို့ ရှေ့ပုဒ်၌ပင် ဟောလျှင်မူလည်း။ ; uttarapadepi=နောက်ဖြစ်သော ဝိဝိစ္စဟူသော ပုဒ်၌လည်း။ ; idheva bhikkhave.la. samaṇoti ettha=ဟူသော မူလပဏ္ဏာသ၊ စူဠသီဟနာဒသုတ်(မ-၁။ ၉၂။)၌။ ; vavakāro=ကို။ ; ānetvā=နောက်ပုဒ်သို့ဆောင်၍။ ; vuccatiyathā=သို့။ ; evaṃtathā=အတူ။ ; (ānetvā=၍။ ; vattabbo=၏။) ; bhikkhave=တို့။ ; idheva=၌သာလျှင်။ ; samaṇo=သောတာပန်ဖြစ်သော ရဟန်းသည်။ ; atthi=၏။ ; idhaidheva=၌သာလျှင်။ ; dutiyo=သော။ ; samaṇo=သကဒါဂါမ်ဖြစ်သော ရဟန်းသည်။ ; atthi=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3342 | Chunk: 56

Na hi sakkā ito aññehipi nīvaraṇasaṅkhātehi akusalehi dhammehi avivicca jhānaṃ upasampajja viharituṃ.

AI Translation based on Nissaya

For it is not possible to attain and dwell in jhāna without being secluded from these other unwholesome states known as the hindrances.

Vietnamese AI Translation

Vì không thể nào chứng đắc và an trú trong thiền na mà không ly các pháp bất thiện khác được gọi là các triền cái.

AI Translation Nissaya

hi saccaṃ=Truly. ; ito=from these sensual objects and sensual defilements. ; aññehipi=which are different. ; nīvaraṇasaṅkhātehi=called the hindrances. ; akusalehi=which are unwholesome. ; dhammehi=from states. ; avivicca=without being secluded. ; jhānaṃ=the jhāna. ; upasampajja=having fully attained. ; viharituṃ=to dwell. ; nasakkā=is not possible. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; ito=ဤဝတ္ထုကာမ ကိသော ကာမမှ။ ; aññehipi=တပါးလည်းဖြစ်ကုန်သော။ ; nīvaraṇasaṅkhātehi=ဟု ဆိုအပ်ကု်သော။ ; akusalehi=ကုန်သော။ ; dhammehi=တို့မှ။ ; avivicca=မဆိတ်မူ၍။ ; jhānaṃ=ကို။ ; upasampajja=ပြည့်စုံစေ၍။ ; viharituṃ=နေခြင်းငှါ။ ; nasakkā=မတက်ကောင်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3343 | Chunk: 56

Tasmā ‘‘vivicceva kāmehi vivicceva akusalehi [M1.167] dhammehī’’ ti evaṃ padadvayepi esa daṭṭhabbo.

AI Translation based on Nissaya

Therefore, this 'eva' should be understood as applying to both phrases: “Secluded only from sensual pleasures, secluded only from unwholesome states.”

Vietnamese AI Translation

Do đó, từ 'eva' này nên được hiểu là áp dụng cho cả hai cụm từ: “Ly chỉ khỏi các dục lạc, ly chỉ khỏi các pháp bất thiện.”

AI Translation Nissaya

tasmā=Therefore. ; vivicceva kāmehi vivicceva akusalehi dhammehiti=as "secluded only from sensual pleasures, secluded only from unwholesome states". ; evaṃ=thus. ; padadvayepi=in both phrases. ; esa eso evakāro=this word 'eva'. ; daṭṭhabbo=should be understood. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; vivicceva kāmehi vivicceva akusalehi dhammehiti=ဟူ၍။ ; evaṃ=သို့။ ; padadvayepi=၌လည်း။ ; esa eso evakāro=ကို။ ; daṭṭhabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3344 | Chunk: 56

Padadvayepi ca kiñcāpi viviccāti iminā sādhāraṇavacanena tadaṅgavikkhambhanasamucchedapaṭippassaddhinissaraṇavivekā cittakāyaupadhivivekā ca saṅgahaṃ gacchanti, tathāpi pubbabhāge kāyavivekacittavivekavikkhambhanavivekā daṭṭhabbā, lokuttaramaggakkhaṇe kāyavivekacittavivekasamucchedavivekapaṭippassaddhivivekanissaraṇavivekā.

AI Translation based on Nissaya

Furthermore, although in both phrases, by this common term 'vivicca' (secluded), the seclusions by substitution, suppression, cutting off, tranquilization, and escape are included, as well as seclusion of mind, body, and the substrates, nevertheless, in the preliminary stage, seclusion of body, mind, and by suppression should be understood. At the moment of the supramundane path, seclusion of body, mind, by cutting off, by tranquilization, and by escape should be understood.

Vietnamese AI Translation

Hơn nữa, mặc dù trong cả hai cụm từ, qua thuật ngữ chung 'vivicca' (ly), các sự ly bằng cách thay thế, đè nén, cắt đứt, khinh an, và thoát ly đều được bao gồm, cũng như sự ly của tâm, thân, và các nền tảng, tuy nhiên, ở giai đoạn sơ khởi, sự ly của thân, tâm, và bằng cách đè nén nên được hiểu. Vào thời điểm của đạo siêu thế, sự ly của thân, tâm, bằng cách cắt đứt, bằng cách khinh an, và bằng cách thoát ly nên được hiểu.

AI Translation Nissaya

ca=Furthermore. ; padadvayepi=in both phrases. ; viviccāti=by the word. ; iminā sādhāraṇavacanena='vivicca' (secluded). ; tadaṅgavikkhambhanasamucchedapaṭippassaddhinissaraṇavivekā=seclusion by substitution of opposite qualities, by suppression, by cutting off, by tranquilization, and by escape, as well as. ; vā=and. ; cittakāyaupadhivivekāca=seclusion of mind, seclusion of body, and seclusion from the substrates of existence, as well as. ; vā=and. ; saṅgahaṃ=to inclusion. ; kiñcāpi gacchanti=although they go. ; tathāpi=nevertheless. ; pubbabhāge=in the preliminary stage. ; kāyavivekacitta vivekavikkhambhanavivekā=seclusion of body, seclusion of mind, and seclusion by suppression. ; daṭṭhabbā=should be understood. ; lokuttaramaggakkhaṇe=at the moment of the supramundane path. ; kāyaviveka cittaviveka samucchedaviveka paṭippassaddhiviveka nissaraṇa vivekā=seclusion of body, seclusion of mind, seclusion by cutting off, seclusion by tranquilization, and seclusion by escape. ; daṭṭhabbā=should be understood. ;

Myanmar Nissaya

ca=ဆက်၍ဆိုဦးအံ။ ; padadvayepi=၌လည်း။ ; viviccāti=ဟူသော။ ; iminā sādhāraṇavacanena=သဒ္ဒါဖြင့်။ ; tadaṅgavikkhambhanasamucchedapaṭippassaddhinissaraṇavivekā=ဝိဝေကတို့သည်လည်းကောင်း။ ; vā=တို့ကိုလည်းကောင်း။ ; cittakāyaupadhivivekāca=စိတ္တဝိဝေက ကာဝိဝိဝေက ဥပဓိဝိဝေကတို့သည်လည်းကောင်း။ ; vā=တို့ကိုလည်းကောင်း။ ; saṅgahaṃ=ခြင်းသို့။ ; kiñcāpi gacchanti=အကယ်၍ကားရောက်ကုန်၏ရှင့်။ ; tathāpi=သော်လည်း။ ; pubbabhāge=မဂ်၏ ရှေ့အဖို့၌။ ; kāyavivekacitta vivekavikkhambhanavivekā=တို့ကို။ ; daṭṭhabbā=ကုန်၏။ ; lokuttaramaggakkhaṇe=၌။ ; kāyaviveka cittaviveka samucchedaviveka paṭippassaddhiviveka nissaraṇa vivekā=တို့ကို။ ; daṭṭhabbā=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3345 | Chunk: 56

Kāmehīti iminā pana padena ye ca mahāniddese ‘‘katame vatthukāmā manāpikā rūpā’’ tiādinā ( mahāni. 1) nayena vatthukāmā vuttā, ye ca tattheva vibhaṅge ca ‘‘chando kāmo, rāgo kāmo, chandarāgo kāmo, saṅkappo kāmo, rāgo kāmo, saṅkapparāgo kāmo’’ ti ( mahāni. 1; vibha. 564) evaṃ kilesakāmā vuttā, te sabbepi saṅgahitā icceva daṭṭhabbā.

AI Translation based on Nissaya

By the term 'kāmehi' (from sensual pleasures), it should be understood that both the sensual objects (vatthukāmā) spoken of in the Mahāniddesa by the method starting, “What are the sensual objects? Agreeable forms…” (Mahāniddesa 1), and the sensual defilements (kilesakāmā) spoken of in that same text and in the Vibhaṅga as, “Desire is a sensual pleasure, lust is a sensual pleasure, desire-lust is a sensual pleasure, thought is a sensual pleasure, lust is a sensual pleasure, thought-lust is a sensual pleasure” (Mahāniddesa 1; Vibhaṅga 564), are all included.

Vietnamese AI Translation

Qua thuật ngữ 'kāmehi' (khỏi các dục lạc), nên hiểu rằng cả các dục đối tượng (vatthukāmā) được nói đến trong Mahāniddesa theo phương pháp bắt đầu, “Các dục đối tượng là gì? Các sắc khả ái…” (Mahāniddesa 1), và các dục phiền não (kilesakāmā) được nói đến trong cùng văn bản đó và trong Vibhaṅga là, “Dục là một dục lạc, ái là một dục lạc, dục-ái là một dục lạc, tư duy là một dục lạc, ái là một dục lạc, tư duy-ái là một dục lạc” (Mahāniddesa 1; Vibhaṅga 564), tất cả đều được bao gồm.

AI Translation Nissaya

pana=Now, apart from the explanation of the word 'vivicca', I will explain the word 'kāmehi'. ; kāmehīti iminā padena=by this word 'kāmehi'. ; mahāniddese=in the Mahāniddesa. ; katame vatthukāmā manāpikā rūpādi ādinā=with this beginning, "What are the sensual objects? Agreeable forms," etc.. ; nayena=by this method. ; ye vatthukāmā=those sensual objects. ; vuttā=were spoken of by the Elder, the General of the Dhamma. ; tatthevaca=and in that same Mahāniddesa Pāḷi. ; vibhaṅgeca=and in the Jhāna Vibhaṅga Pāḷi. ; chando kāmo.la. saṅkapparāgo kāmoti=as "Desire is a sensual pleasure... thought-lust is a sensual pleasure". ; evaṃ=thus. ; yeca kilesakāmā=those sensual defilements. ; vuttā=were spoken of. ; chando=Weak lust. ; kāmo=is called sensual pleasure. ; rāgo=Weak lust. ; kāmo=is called sensual pleasure. ; chandarāgo=Very strong lust. ; kāmo=is called sensual pleasure. ; saṅkappo=Lust that thinks about sensual objects. ; kāmo=is called sensual pleasure. ; rāgo=Strong lust. ; kāmo=is called sensual pleasure. ; saṅkapparāgo=Very strong lust that thinks about sensual objects. ; kāmo=is called sensual pleasure. ; iti evaṃ=Thus. ; kilasakāmā=the sensual defilements. ; vuttā=were spoken of. ; te sabbepi=all those sensual objects and sensual defilements. ; saṅgahitā=are included. ; icṇeva itieva=it should be understood thus. ; daṭṭhabbā=it should be seen. ;

Myanmar Nissaya

pana=ဝိဝိစ္စ ဟူသော ပုဒ်၏ အဖွင့် မှ တပါး ကာမေဟိ ဟူသော ပုဒ်၏ အဖွင့်ကို ဆိုအံံ။ ; kāmehīti iminā padena=ဖြင့်။ ; mahāniddese=၌။ ; katame vatthukāmā manāpikā rūpādi ādinā=ဤသို့ အစရှိသော။ ; nayena=ဖြင့်။ ; ye vatthukāmā=တို့ကိုလည်း။ ; vuttā=ဓမ္မသေနာပတိ မထေရ်သည် ဟောအပ်ကုန်၏။ ; tatthevaca=ထိုမဟာနိဒ္ဒေသပါဠိ၌ပင်လျှင်လည်းကောင်း။ ; vibhaṅgeca=ဈာနဝိဘင်းပါဠိ၌ လည်းကောင်း။ ; chando kāmo.la. saṅkapparāgo kāmoti=ဟူ၍။ ; evaṃ=သို့။ ; yeca kilesakāmā=တို့ကိုလည်း။ ; vuttā=ကုန်၏။ ; chando=အားနည်းသော ရာဂသည်။ ; kāmo=မည်၏။ ; rāgo=အားနည်းသော ရာဂသည်။ ; kāmo=ကာမည်၏။ ; chandarāgo=အလွန်အားကြီးသော ရာဂသည်။ ; kāmo=ကာမမည်၏။ ; saṅkappo=ဝတ္ထုကာမကို ကြံအောက့်မေ့တတ်သော ရာဂသည်။ ; kāmo=မည်၏။ ; rāgo=အားရှိသော ရားသည်။ ; kāmo=မည်၏။ ; saṅkapparāgo=ဝတ္ထုကာမကို ကြံအောက်မေ့တတ်သော အလွန်အားရှိသော ရာဂသည်။ ; kāmo=မည်၏။ ; iti evaṃ=သို့။ ; kilasakāmā=တို့ကို။ ; vuttā=ကုန်ပြီ။ ; te sabbepi=ထို ဥဿုံသော ဝတ္ထုကာမ ကိလေသာကာမတို့ကိုလည်း။ ; saṅgahitā=ကုန်၏။ ; icṇeva itieva=ဤသို့သာလျှင်။ ; daṭṭhabbā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3346 | Chunk: 56

Evañhi sati vivicceva kāmehīti vatthukāmehipi viviccevāti attho yujjati.

AI Translation based on Nissaya

Indeed, when this is so, the meaning of the phrase 'vivicceva kāmehi' as 'secluded only from sensual objects' is appropriate.

Vietnamese AI Translation

Thực vậy, khi đã như vậy, ý nghĩa của cụm từ 'vivicceva kāmehi' là 'ly chỉ khỏi các dục đối tượng' là thích hợp.

AI Translation Nissaya

hi=Now I will state the reason. ; evaṃ=Thus they are included. ; sati santesu=When it is so. ; vivicceva kāmehīti=of the phrase 'vivicceva kāmehi'. ; vatthukāmahipi=also from sensual objects. ; vivicceva=secluded only. ; itiayaṃ attho=this meaning. ; yujjati=is suitable. ;

Myanmar Nissaya

hi=အကျိုးကို ဆိုဦးအံ့။ ; evaṃ=အသို့ သင်္ဂြိုဟ်အပ်ကုန်သည်။ ; sati santesu=သော်။ ; vivicceva kāmehīti=ဝိဝိစ္စေဝ ကာမေဟိ ဟူသော ပုဒ်၏။ ; vatthukāmahipi=တို့မှလည်း။ ; vivicceva=သာလျှင်။ ; itiayaṃ attho=ဤသို့သော အနက်သည်။ ; yujjati=သင့်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3347 | Chunk: 56

Tena kāyaviveko vutto hoti.

AI Translation based on Nissaya

By that, seclusion of body is spoken of.

Vietnamese AI Translation

Qua đó, sự ly của thân được nói đến.

AI Translation Nissaya

tena=By that seclusion from sensual objects. ; kāyaviveko=seclusion of body. ; vutto=is spoken of. ; hoti=it is. ;

Myanmar Nissaya

tena=ထိုဝတ္ထုကာမမှ ဆိတ်ခြင်းကြောင့်။ ; kāyaviveko=ကို။ ; vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3348 | Chunk: 56

Vivicca akusalehi dhammehīti kilesakāmehi sabbākusalehi vā viviccāti attho yujjati.

AI Translation based on Nissaya

The meaning of 'Vivicca akusalehi dhammehi' (secluded from unwholesome states) as 'secluded from sensual defilements' or 'from all unwholesome states' is appropriate.

Vietnamese AI Translation

Ý nghĩa của 'Vivicca akusalehi dhammehi' (ly khỏi các pháp bất thiện) là 'ly khỏi các dục phiền não' hoặc 'khỏi tất cả các pháp bất thiện' là thích hợp.

AI Translation Nissaya

vivicca akusalehi dhammehīti=Of the phrase 'vivicca akusalehi dhammehi'. ; kilesakāmehi=from sensual defilements. ; vā=or. ; sabbākusalehi=from all unwholesome things. ; vivicca=having been secluded. ; itiayaṃ attho=this meaning. ; yujjati=is suitable. ;

Myanmar Nissaya

vivicca akusalehi dhammehīti=ဟူသော ပုဒ်၏။ ; kilesakāmehi=တို့မှ။ ; vā=ကား။ ; sabbākusalehi=ဥဿုံသော အကိုသုလ်တို့မှ။ ; vivicca=၍။ ; itiayaṃ attho=သည်။ ; yujjati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3349 | Chunk: 56

Tena cittaviveko vutto hoti.

AI Translation based on Nissaya

By that, seclusion of mind is spoken of.

Vietnamese AI Translation

Qua đó, sự ly của tâm được nói đến.

AI Translation Nissaya

tena=By that seclusion from sensual defilements and all unwholesome things. ; cittaviveko=seclusion of mind. ; vā=or. ; vutto=is spoken of. ; hoti=it is. ;

Myanmar Nissaya

tena=ထိုကိလေသာ ကာမ အလုံးစုံသော အကုသိုလ်တို့မှ ဆိတ်ခြင်းကြောင့်။ ; cittaviveko=သည်။ ; vā=ကို။ ; vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3350 | Chunk: 56

Purimena cettha vatthukāmehi vivekavacanato eva kāmasukhapariccāgo, dutiyena kilesakāmehi vivekavacanato nekkhammasukhapariggaho vibhāvito hoti.

AI Translation based on Nissaya

Herein, by the former, which speaks of seclusion from sensual objects, the abandonment of sensual pleasure is clarified. By the latter, which speaks of seclusion from sensual defilements, the embracing of the pleasure of renunciation is clarified.

Vietnamese AI Translation

Ở đây, qua vế trước, nói về sự ly khỏi các dục đối tượng, sự từ bỏ dục lạc được làm rõ. Qua vế sau, nói về sự ly khỏi các dục phiền não, sự ôm giữ lạc của sự xuất ly được làm rõ.

AI Translation Nissaya

ca=I shall now state a specific point. ; ettha=Among these two types of seclusion. ; purimena=by the former, the seclusion from sensual pleasures. ; vatthukāmehi=from sensual objects. ; vivekavacanatoeva=only because of speaking of seclusion. ; kāmasukhapariccāgo=the abandonment of pleasure arising from sensual objects. ; vibhāvito=is made clear. ; hoti=it is. ; dutiyena=By the second, the seclusion of mind. ; kilesakāmehi=from sensual defilements. ; vivekavacanato=because of speaking of seclusion. ; nekkhammasukhapariggaho=the embracing of the pleasure of renunciation. ; vibhāvito=is made clear. ; hoti=it is. ;

Myanmar Nissaya

ca=ဆိုဖွယ်အထူးကို မိန့်ဆိုဦးအံ့။ ; ettha=ဤနှစ်ပါးသော ဝိဝေကတို့တွင်။ ; purimena=ရှေ့ဖြစ်သော ကာမဝိဝေကဖြင့်။ ; vatthukāmehi=တို့မှ။ ; vivekavacanatoeva=ဆိတ်ခြင်းကို ဟောတော်မူခြင်းကြောင့်သာလျှင်။ ; kāmasukhapariccāgo=ဝတ္ထုကာမ၌ ဖြစ်သော သုခကို စွန့်ခြင်းကို။ ; vibhāvito=ထင်စွာ ပြအပ်သည်။ ; hoti=၏။ ; dutiyena=နှစ်ခုမြောက်သော စိတ္တဝိဝေကဖြင့်။ ; kilesakāmehi=တို့မှ။ ; vivekavacanato=ဆိတ်ခြင်းကို ဟောတော်မူခြင်းကြောင့်။ ; nekkhammasukhapariggaho=ဈာန်ချမ်းသာကို သိမ်းဆည်းခြင်းကို။ ; vibhāvito=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3351 | Chunk: 56

Evaṃ vatthukāmakilesakāmavivekavacanatoyeva ca etesaṃ paṭhamena saṃkilesavatthuppahānaṃ, dutiyena saṃkilesappahānaṃ.

AI Translation based on Nissaya

And thus, precisely by speaking of seclusion from sensual objects and sensual defilements, through the first phrase the abandoning of the basis of defilements is clarified, and through the second, the abandoning of the defilements themselves.

Vietnamese AI Translation

Và như vậy, chính xác bằng cách nói về sự ly khỏi các dục đối tượng và dục phiền não, qua cụm từ thứ nhất, sự từ bỏ nền tảng của các phiền não được làm rõ, và qua cụm từ thứ hai, sự từ bỏ chính các phiền não.

AI Translation Nissaya

ca=Furthermore. ; evaṃ=Thus. ; vatthukāmā kilesakāma vivekavacanatoyeva=only by speaking of seclusion from sensual objects and sensual defilements. ; etesaṃ=among those two phrases. ; paṭhamena=by the first. ; viviccevakāmehi=with the phrase 'vivicceva kāmehi'. ; (Visuddhimagga-ṭīkā.) ; tanaññaḥ=. ; etesaṃ=among those two, bodily seclusion and mental seclusion. ; paṭhamena=by the first, bodily seclusion. ; (Ganthi). ; saṃkilesavatthuppahānaṃ=the abandoning of the basis of defilements. ; vibhāvitaṃ=is made clear. ; hoti=it is. ; dutiyena=by the second. ; vivicca=with the phrase 'akusalehi dhammehi'. ; saṃkilesappahānaṃ=the abandoning of the defilements. ; vibhāvitaṃ=is made clear. ; hoti=it is. ;

Myanmar Nissaya

ca=ဆက်၍ ဆိုဦးအံ့။ ; evaṃ=သို့။ ; vatthukāmā kilesakāma vivekavacanatoyeva=ဝတ္ထုကာမ ကိလေသာကာမတို့မှ ဆိတ်ခြင်းကို ဟောတော်မူခြင်းကြောင့် သာလျှင့်။ ; etesaṃ=ထိုနှစ်ပါးသော ပုဒ်တို့တွင်။ ; paṭhamena=ရှေးဖြစ်သော။ ; viviccevakāmehi=ဟူသော ပုဒ်ဖြင့်။ ; (ဝိသုဒ္ဓိမဂ်ဋီကာ။) ; tanaññaḥ= ; etesaṃ=ထိုနှစ်ပါးသော ကာယဝိဝေက စိတ္တဝိဝေက တို့တွင်။ ; paṭhamena=ရှေးဖြစ်သော ကာယဝိဝေကဖြင့်။ ; (ဂဏ္ဌိ)။ ; saṃkilesavatthuppahānaṃ=ကိလေသာ တို့ကို အကြောင်းအားဖြင့် ပယ်ခြင်းကို။ ; vibhāvitaṃ=ထင်စွာ ပြအပ်သည်။ ; hoti=၏။ ; dutiyena=နှစ်ခုမြောက်သော။ ; vivicca=အကုသလေဟိ ဓမ္မေဟိ ဟူသော ပုဒ်ဖြ့်။ ; saṃkilesappahānaṃ=ကိလေသာကိုပယ်ခြင်းကို။ ; vibhāvitaṃ=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3352 | Chunk: 56

Paṭhamena lolabhāvassa hetupariccāgo, dutiyena bālabhāvassa.

AI Translation based on Nissaya

By the first, the abandonment of the cause of the state of fickleness (i.e., greed) is clarified; by the second, that of the state of foolishness (i.e., delusion).

Vietnamese AI Translation

Qua vế đầu, sự từ bỏ nguyên nhân của trạng thái hay thay đổi (tức là, tham) được làm rõ; qua vế sau, là của trạng thái ngu muội (tức là, si).

AI Translation Nissaya

paṭhamena=By the first. ; lolabhāvassa=of greed, which is the state of a fickle person. ; hetupariccāgo=the abandoning of the cause, which is sensual objects. ; vibhāvito=is made clear. ; ‌‌hoti=it is. ; dutiyena=By the second. ; bālabhāvassa=of delusion, which is the state of a foolish person. ; hetupariccāgo=the abandoning of its cause, namely, inappropriate attention and all unwholesome states. ; vibhāvito=is made clear. ; hoti=it is. ;

Myanmar Nissaya

paṭhamena=ဖြင့်။ ; lolabhāvassa=လျှပ်ပေါ်သော သူ၏အဖြစ်တည်းဟူသော လောဘ၏။ ; hetupariccāgo=အကြောင်းဖြစ်သော ဝတ္ထုကာမကို စွန့်ခြင်းကို။ ; vibhāvito=သည်။ ; ‌‌hoti=၏။ ; dutiyena=ဖြင့်။ ; bālabhāvassa=မိုက်သောသူ၏ အဖြစ်တည်းဟူသော မောဟ၏။ ; hetupariccāgo=အကြောင်းဖြစ်သော အယောနိသော မနသိကာရ၊ ဥဿုံသော အကုသိုလ်တို့ကို စွန့်ခြင်းကို။ ; vibhāvito=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3353 | Chunk: 56

Paṭhamena ca payogasuddhi, dutiyena āsayaposanaṃ vibhāvitaṃ hotīti viññātabbaṃ.

AI Translation based on Nissaya

It should also be understood that by the first, purity of action is clarified, and by the second, the purification of intention.

Vietnamese AI Translation

Cũng nên hiểu rằng qua vế đầu, sự trong sạch của hành động được làm rõ, và qua vế sau, sự thanh lọc của ý định.

AI Translation Nissaya

ca=Furthermore. ; paṭhamena=by the first. ; payogasuddhi=the purity of bodily and verbal action. ; vibhāvitā=is made clear. ; hoti=it is. ; dutiyena=by the second. ; āsayaposanaṃ=the purification of intention. ; vibhāvitaṃ=is made clear. ; hoti=it is. ; iti=Thus. ; viññātabbaṃ=it should be understood. ;

Myanmar Nissaya

ca=ထိုမှတစ်ပါး။ ; paṭhamena=ဖြင့်။ ; payogasuddhi=ကာယပယောဂ ဝစီပယောဂ၏ စင်ကြယ်ခြင်းကို။ ; vibhāvitā=သည်။ ; hoti= ; dutiyena=ဖြင့်။ ; āsayaposanaṃ=အလို၏ ဖြူစင်ခြင်းကို။ ; vibhāvitaṃ=သည်။ ; hoti=၏။ ; iti=သို့။ ; viññātabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3354 | Chunk: 56

Esa tāva nayo kāmehīti ettha vuttakāmesu vatthukāmapakkhe.

AI Translation based on Nissaya

This, so far, is the method regarding the aspect of sensual objects among the sensual pleasures mentioned in the word 'kāmehi'.

Vietnamese AI Translation

Cho đến đây, đó là phương pháp liên quan đến khía cạnh dục đối tượng trong số các dục lạc được đề cập trong từ 'kāmehi'.

AI Translation Nissaya

tāva=First of all. ; esa eso nayo=this method. ; kāmehīti ettha=in the word 'kāmehi'. ; vuttakāmesu=among the sensual pleasures mentioned. ; vatthukāmapakkhe=in the aspect of sensual objects. ; (pavatto=which is. ; nayo=the method.) ;

Myanmar Nissaya

tāva=လက်မွန်။ ; esa eso nayo=သည်။ ; kāmehīti ettha=၌။ ; vuttakāmesu=တို့တွင်။ ; vatthukāmapakkhe=အဖို့၌။ ; (pavatto=သော။ ; nayo=တည်း။) ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3355 | Chunk: 56

Kilesakāmapakkhe [V1.153] pana chandoti ca rāgoti ca evamādīhi anekabhedo kāmacchandova kāmoti adhippeto.

AI Translation based on Nissaya

In the aspect of sensual defilements, however, it is sensual desire, which is of many kinds such as ‘desire’ and ‘lust,’ that is intended by the word ‘sensual pleasure’.

Vietnamese AI Translation

Tuy nhiên, về khía cạnh dục phiền não, chính là dục tham, có nhiều loại như ‘dục’ và ‘ái,’ được nhắm đến bởi từ ‘dục lạc’.

AI Translation Nissaya

pana=Now I will speak of the defilements of sensual pleasure. ; kiselakāmapakkhe=In the aspect of sensual defilements. ; chandātica=as desire and. ; rāgotica=as lust. ; evamādīhi=by such as these. ; anekabhedā=having many divisions. ; kāmacchandova=sensual desire alone. ; kāmoti=as 'sensual pleasure'. ; adhippeto=is intended. ;

Myanmar Nissaya

pana=ကိလေသာကာမကို ဆိုအံ့။ ; kiselakāmapakkhe=၌။ ; chandātica=ဆန္ဒဟူ၍လည်းကောင်း။ ; rāgotica=လည်းကောင်း။ ; evamādīhi=ဤသို့ အစရှိသည်ဖြင့်။ ; anekabhedā=များသော အပြားရှိသော။ ; kāmacchandova=ကိသာလျှင်။ ; kāmoti=ဟူ၍။ ; adhippeto=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3356 | Chunk: 56

So ca akusalapariyāpannopi samāno ‘‘tattha katame kāmā, chando kāmo’’ tiādinā ( vibha. 564) nayena vibhaṅge upari jhānaṅgapaṭipakkhato [P1.181] visuṃ vutto, kilesakāmattā vā purimapade vutto, akusalapariyāpannattā dutiyapade.

AI Translation based on Nissaya

And although it is included in the unwholesome, it is mentioned separately in the Vibhaṅga, by the method starting, “Therein, what are the sensual pleasures? Desire is a sensual pleasure” (Vibhaṅga 564), because it is an opponent of the higher jhāna factors. Or, it is mentioned in the first phrase because it is a sensual defilement, and in the second phrase because it is included among the unwholesome states.

Vietnamese AI Translation

Và mặc dù nó được bao gồm trong các pháp bất thiện, nó được đề cập riêng trong Vibhaṅga, theo phương pháp bắt đầu, “Trong đó, các dục lạc là gì? Dục là một dục lạc” (Vibhaṅga 564), bởi vì nó là một đối nghịch của các thiền chi cao hơn. Hoặc, nó được đề cập trong cụm từ đầu tiên vì nó là một dục phiền não, và trong cụm từ thứ hai vì nó được bao gồm trong các pháp bất thiện.

AI Translation Nissaya

so ca kāmo=And that sensual pleasure. ; vā=also. ; akusalapariyāpanno=is included in the unwholesome. ; samānopi=even though it is. ; tattha katame kāmā chando kāmoti ādinā=beginning with "Therein, what are the sensual pleasures? Desire is a sensual pleasure". ; nayena=by this method. ; vibhaṅge=in the Jhāna Vibhaṅga. ; uparijhānaṅgapaṭipakkhato=because it is the opponent of the higher jhāna factors. ; visuṃ=separately. ; vutto=it is mentioned. ; vā=Or rather. ; kisekāmattā=because of being a sensual defilement. ; purimapade=in the first phrase. ; vutto=it is mentioned. ; vutto=it is mentioned. ; akusalapariyāpannattā=because it is included in the unwholesome. ; dutiyapade=in the second phrase. ; vutto=it is mentioned. ;

Myanmar Nissaya

so ca kāmo=သည်လည်း။ ; vā=ကိုလည်း။ ; akusalapariyāpanno=စင်သည်။ ; samānopi=မူလည်း။ ; tattha katame kāmā chando kāmoti ādinā=သော။ ; nayena=ဖြင့်။ ; vibhaṅge=ဈာနဝိဘင်း၌။ ; uparijhānaṅgapaṭipakkhato=အထက်ဖြစ်သော ဈာနအင်္ဂါတို့၏ ဆန့်ကျင်ဘက် ဖြစ်ခြင်းကြောင့်။ ; visuṃ=အသီ။ ; vutto=၏။ ; vā=ကား။ ; kisekāmattā=ကိလေသာကာမ ဖြစ်သည်၏ အဖြစ်ကြောင့်။ ; purimapade=၌။ ; vutto=၏။ ; vutto=၏။ ; akusalapariyāpannattā=ကြောင့်။ ; dutiyapade=၌။ ; vutto=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3357 | Chunk: 56

Anekabhedato cassa kāmatoti avatvā kāmehīti vuttaṃ.

AI Translation based on Nissaya

And because it has many divisions, it is said as 'kāmehi' (from sensual pleasures, plural) rather than 'kāmato' (from sensual pleasure, ablative singular).

Vietnamese AI Translation

Và vì nó có nhiều phân loại, nó được nói là 'kāmehi' (khỏi các dục lạc, số nhiều) thay vì 'kāmato' (khỏi dục lạc, cách ly giác số ít).

AI Translation Nissaya

ca=I shall now mention an external point. ; assa=Of that sensual pleasure. ; anekabhedato=because of its many divisions. ; kāmatoti=as 'kāmato'. ; avatvā=without speaking with the '-to' suffix. ; kāmehīti=as 'kāmehi'. ; vuttaṃ=it is taught with the plural instrumental meaning. ; iti=Thus. ; vuttaṃ=it is said. ;

Myanmar Nissaya

ca=ဗာဟိရတ္တကို ဆိုဦးအံ့။ ; assa=ထိုကာမ၏။ ; anekabhedato=များသော အပြားရှိခြင်းကြောင့်။ ; kāmatoti=ဟူ၍။ ; avatvā=တော ပစ္စယန္တအားဖြင့် မဟောမူ၍။ ; kāmehīti=ဟူ၍။ ; vuttaṃ=ဟိ ဝစနတ္ထအားဖြင့် ဟောတော်မူ၏။ ; iti=သို့။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3358 | Chunk: 56

Aññesampi [M1.168] ca dhammānaṃ akusalabhāve vijjamāne ‘‘tattha katame akusalā dhammā, kāmacchando’’ tiādinā ( vibha. 564) nayena vibhaṅge upari jhānaṅgapaccanīkapaṭipakkhabhāvadassanato nīvaraṇāneva vuttāni.

AI Translation based on Nissaya

And although other states also have an unwholesome nature, in the Vibhaṅga, by the method starting, “Therein, what are the unwholesome states? Sensual desire…” (Vibhaṅga 564), only the hindrances are mentioned, to show that they are the direct opponents and adversaries of the jhāna factors.

Vietnamese AI Translation

Và mặc dù các trạng thái khác cũng có bản chất bất thiện, trong Vibhaṅga, theo phương pháp bắt đầu, “Trong đó, các pháp bất thiện là gì? Dục tham…” (Vibhaṅga 564), chỉ có các triền cái được đề cập, để cho thấy rằng chúng là những đối nghịch và kẻ thù trực tiếp của các thiền chi.

AI Translation Nissaya

ca=Furthermore. ; aññesampi=apart from sensual defilements. ; dhammānaṃ=of states such as wrong view and conceit. ; akusalabhāve=the state of being unwholesome. ; vijjamāne=although it exists. ; tattha katame akusalā dhammā kāmacchandotiādinā=beginning with "Therein, what are the unwholesome states? Sensual desire". ; nayena=by this method. ; vibhaṅge=in the Jhāna Vibhaṅga Pāḷi. ; upari=above the hindrances. ; jhānaṅgapaccanīkapaṭipakkhabhāvadassanato=because of showing the state of being contrary to the jhāna factors to be mentioned and being the opponent of the hindrances. ; (Ganthi). ; vā=or, because of showing the state of being the opponent of the hindrances which are contrary to the jhāna factors to be mentioned above. ; (Visuddhimagga-ṭīkā). ; nīvaraṇāneva=only the hindrances. ; vuttāni=are spoken of. ; iti=Thus. ; veditabbaṃ=it should be known. ;

Myanmar Nissaya

ca=ဆက်။ ; aññesampi=ကိလေသာကာမမှ တစ်ပါးလည်းဖြစ်ကုန်သော။ ; dhammānaṃ=ဒိဋ္ဌိ မာန အစရှိသော တရားတို့၏။ ; akusalabhāve=၏ အဖြစ်သည်။ ; vijjamāne=ရှိခဲသော်။ ; tattha katame akusalā dhammā kāmacchandotiādinā=သော။ ; nayena=ဖြင့်။ ; vibhaṅge=ဈာနဝိဘင်းပါဠိ၌။ ; upari=နီဝရဏတို့၏ အထက်၌။ ; jhānaṅgapaccanīkapaṭipakkhabhāvadassanato=ဆိုလတ္တံ့သော ဈာန်အင်္ဂါတို့နှင့် ဆန့်ကျင်သည်အဖြစ် ဈာန်အင်္ဂါတို့၏ နီဝရဏ တို့နှင့် ဆန့်ကျင်ဘက်၏ အဖြစ်ကို ပြခြင်းကြောင့်။ ; (ဂဏ္ဌိ)။ ; vā=အထက်၌ ဆိုလတ္တံ့သော ဈာန်အင်္ဂါတို့နှင့် ဆန့်ကျင်ဘက်ဖြစ်သော နီဝရဏတို့၏ ဆန့်ကျင်ဘက်၏ အဖြစ်တို့ ပြခြင်းကြောင့်။ ; (ဝိသုဒ္ဓိမဂ်ဋီကာ)။ ; nīvaraṇāneva=တို့ကိုသာလျှင်။ ; vuttāni=ကုန်၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3359 | Chunk: 56

Nīvaraṇāni hi jhānaṅgapaccanīkāni, tesaṃ jhānaṅgāneva paṭipakkhāni viddhaṃsakāni vināsakānīti vuttaṃ hoti.

AI Translation based on Nissaya

Indeed, the hindrances are the adversaries of the jhāna factors; the jhāna factors alone are their opponents, their destroyers, their annihilators. Thus it is said.

Vietnamese AI Translation

Thực vậy, các triền cái là kẻ thù của các thiền chi; chỉ có các thiền chi là đối nghịch của chúng, là kẻ phá hủy chúng, là kẻ tiêu diệt chúng. Lời dạy là như vậy.

AI Translation Nissaya

hi saccaṃ=Truly. ; nīvaraṇāni=The hindrances. ; jhānaṅgapaccanīkāni=are the adversaries of the jhāna factors. ; honti=They are. ; tesaṃ=Of those hindrances. ; jhānaṅgāneva=the jhāna factors alone. ; paṭipakkhāni=are the opponents. ; viddhaṃsakāni=they are destroyers. ; vināsakāni=they are annihilators. ; honti=They are. ; iti=Thus. ; vuttaṃ vutto=it is said. ; hoti=it is. ;

Myanmar Nissaya

hi saccaṃ=ၑ။ ; nīvaraṇāni=တို့သ်ည။ ; jhānaṅgapaccanīkāni=ဈာန်အင်္ဂါ၏ ဆန့်ကျင်ဘက်တို့သည်။ ; honti=ကုန်၏။ ; tesaṃ=ထိုနီဝရဏတို့၏။ ; jhānaṅgāneva=ဈာန်အင်္ဂါတို့သည်သာလျှင်။ ; paṭipakkhāni=ဆန့်ကျင်ဘက်တို့သည်။ ; viddhaṃsakāni=ဖျက်ဆီးတတ်ကုန်သည်။ ; vināsakāni=ဖျက်ဆီးတတ်ကုန်သည်။ ; honti=ကုန်၏။ ; iti=သို့။ ; vuttaṃ vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3360 | Chunk: 56

Tathā hi ‘‘samādhi kāmacchandassa paṭipakkho, pīti byāpādassa, vitakko thinamiddhassa, sukhaṃ uddhaccakukkuccassa, vicāro vicikicchāyā’’ ti peṭake vuttaṃ.

AI Translation based on Nissaya

For so it is said in the Peṭakopadesa: “Concentration is the opponent of sensual desire, zest of ill will, initial application of sloth and torpor, happiness of restlessness and remorse, and sustained application of doubt.”

Vietnamese AI Translation

Vì có lời dạy trong Peṭakopadesa rằng: “Định là đối nghịch của dục tham, hỷ là của sân, tầm là của hôn trầm thụy miên, lạc là của trạo hối, và tứ là của hoài nghi.”

AI Translation Nissaya

tathāhi tato eva=For that very reason. ; samādhi kāmacchandassa.la. vicikicchāyāti=as "Concentration is the opponent of sensual desire... doubt". ; peṭake=in the Peṭakopadesa scripture. ; vā=or, in the scripture named Peṭakopadesa composed by the Arahants Mahinda and others who belong to the Mahāsaṅghika lineage. ; (Ganthi). ; vā=or, in the Peṭakopadesa scripture compiled by the Elder Mahākaccāna. ; (visuddhimagaṭīkā=Sāratthadīpanī). ; vuttaṃ=it is stated. ; samādhi=The jhāna factor of one-pointedness. ; kamacchandassa=of the hindrance of sensual desire. ; paṭipakkho=is the opponent. ; pīti

=The jhāna factor of zest. ; byāpādassa=of the hindrance of ill will. ; paṭipakkhā=is the opponent. ; vitakko=The jhāna factor of initial application. ; thinamiddhassa=of sloth and torpor. ; paṭipakkho=is the opponent. ; sukhaṃ=The jhāna factor of happiness. ; uddhaccakukkuccassa=of restlessness and remorse. ; paṭimakkhaṃ=is the opponent. ; vicāro=Sustained application. ; vicikicchāya=of doubt. ; paṭipakkho=is the opponent. ;

Myanmar Nissaya

tathāhi tato eva=သာလျှင်။ ; samādhi kāmacchandassa.la. vicikicchāyāti=ဟူ၍။ ; peṭake=ပေဋကောပဒေသ ကျမ်း၌။ ; vā=မဟာသင်္ဃကအနွယ်၌ အကျုံးဝင်သော မဟိန္ဒကအရဟတို့သည် ပြုအပ်သော ပေဋကောပဒေသမည်သော ကျမ်း၌။ ; (ဂဏ္ဌိ)။ ; vā=မဟာကစ္စည်းထေရ်သည် စီရင်အပ်သော ပေဋကောပဒေသကျမ်း၌။ ; (visuddhimagaṭīkā=သာရတ္ထဒီပနီ)။ ; vuttaṃ=၏။ ; samādhi=ဧကဂ္ဂတာဈာနင်သည်။ ; kamacchandassa=ကာမစ္ဆန္ဒနီဝရဏ၏။ ; paṭipakkho=ဆန့်ကျင်ဘက်တည်း။ ; pīti=ပီတိဈာနင်သည်။ ; byāpādassa=ဗျာပါဒနီဝရဏ၏။ ; paṭipakkhā=တည်း။ ; vitakko=ဝိတက်ဈာနင်သည်။ ; thinamiddhassa=၏။ ; paṭipakkho=တည်း။ ; sukhaṃ=သုခဈာနင်သည်။ ; uddhaccakukkuccassa=၏။ ; paṭimakkhaṃ=တည်း။ ; vicāro=သည်။ ; vicikicchāya=၏။ ; paṭipakkho=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3361 | Chunk: 56

Evamettha ‘‘vivicceva kāmehī’’ ti iminā kāmacchandassa vikkhambhanaviveko vutto hoti.

AI Translation based on Nissaya

Thus, herein, by the phrase “secluded only from sensual pleasures,” seclusion by suppression of the hindrance of sensual desire is stated.

Vietnamese AI Translation

Do đó, ở đây, qua cụm từ “ly chỉ khỏi các dục lạc,” sự ly bằng cách đè nén triền cái dục tham được nêu rõ.

AI Translation Nissaya

evaṃ=Thus. ; ettha=among these two phrases. ; vivicceva kāmehīti iminā=by this phrase 'vivicceva kāmehi'. ; kāmacchandassa=of the hindrance of sensual desire. ; vā=or. ; vikkhambhanaviveko=seclusion by suppression. ; vā=seclusion by suppression. ; vutto=is spoken of. ; hoti=it is. ;

Myanmar Nissaya

evaṃ=သို့။ ; ettha=ဤနှစ်ပါးသော ပုဒ်တို့တွင်။ ; vivicceva kāmehīti iminā=ဟူသော ပုဒ်ဖြင့်။ ; kāmacchandassa=ကာမစ္ဆန္ဒနီဝရဏ၏။ ; vā=ကို။ ; vikkhambhanaviveko=ကွာသောအားဖြင့် ဆိတ်ခြင်းကို။ ; vā=ခွာသော အားဖြင့် ဆိတ်ခြင်းကို။ ; vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3362 | Chunk: 56

‘‘Vivicca akusalehi dhammehī’’ ti iminā pañcannampi nīvaraṇānaṃ.

AI Translation based on Nissaya

By the phrase “secluded from unwholesome states,” seclusion from all five hindrances is stated.

Vietnamese AI Translation

Qua cụm từ “ly khỏi các pháp bất thiện,” sự ly khỏi cả năm triền cái được nêu rõ.

AI Translation Nissaya

vivicca akusalehi dhammehīti iminā=By this phrase 'vivicca akusalehi dhammehi'. ; pañcannampi=of all five. ; nīvaraṇānaṃ=hindrances. ; vīkkhambhanaviveko=seclusion by suppression. ; vā=or. ; vutto=is spoken of. ; hoti=it is. ;

Myanmar Nissaya

vivicca akusalehi dhammehīti iminā=ဟူသော ပါဌ်ဖြင့်။ ; pañcannampi=ကုန်သော။ ; nīvaraṇānaṃ=တို့ကို။ ; vīkkhambhanaviveko=ကို။ ; vā=ကို။ ; vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3363 | Chunk: 56

Agahitaggahaṇena pana paṭhamena kāmacchandassa, dutiyena sesanīvaraṇānaṃ.

AI Translation based on Nissaya

Alternatively, taking what has not yet been taken, by the first phrase, seclusion from sensual desire is stated; by the second, seclusion from the remaining hindrances.

Vietnamese AI Translation

Hoặc cách khác, xét đến những gì chưa được đề cập, qua cụm từ đầu tiên, sự ly khỏi dục tham được nêu rõ; qua cụm từ thứ hai, sự ly khỏi các triền cái còn lại.

AI Translation Nissaya

pana=Furthermore. ; aggahitaggahaṇena=by taking up what has not been taken up. ; vā=or, by not taking up what has already been taken up. ; paṭhamena=by the first. ; kāmacchandassa=of sensual desire. ; vikkhambhanaviveko=seclusion by suppression. ; vutto=is spoken of. ; hoti=it is. ; dutiyena=by the second. ; sesanīvaraṇānaṃ=of the remaining hindrances apart from sensual desire. ; vikkhambhanaviveko=seclusion by suppression. ; vutto=is spoken of. ; hoti=it is. ;

Myanmar Nissaya

pana=ထိုမှတပါး။ ; aggahitaggahaṇena=မယူအပ်သည်ကို ယူသဖြင့်။ ; vā=ယူပြီးသည်ကို မယူသဖြင့်။ ; paṭhamena=ဖြင့်။ ; kāmacchandassa=ကို။ ; vikkhambhanaviveko=ကို။ ; vutto=သည်။ ; hoti=၏။ ; dutiyena=ဖြင့်။ ; sesanīvaraṇānaṃ=ကာမစ္ဆန္ဒမှ ကြွင်းသော နီဝရဏတို့ကို။ ; vikkhambhanaviveko=ကို။ ; vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3364 | Chunk: 56

Tathā paṭhamena tīsu akusalamūlesu pañcakāmaguṇabhedavisayassa lobhassa, dutiyena āghātavatthubhedādivisayānaṃ dosamohānaṃ.

AI Translation based on Nissaya

Likewise, among the three unwholesome roots, by the first phrase, the abandoning of greed, whose domain is the five strands of sensual pleasure, is indicated, and by the second, that of hatred and delusion, whose domains are the grounds for resentment and so on.

Vietnamese AI Translation

Tương tự, trong ba gốc bất thiện, qua cụm từ đầu tiên, sự từ bỏ tham, có lãnh vực là năm sợi dây dục lạc, được chỉ ra, và qua cụm từ thứ hai, là sự từ bỏ sân và si, có lãnh vực là các nền tảng cho sự oán giận và vân vân.

AI Translation Nissaya

tathā=Furthermore. ; paṭhamena=by the first. ; tīsu=among the three. ; akusalamūlesu=unwholesome roots. ; pañcakāmaguṇabhedavisayassa=of which the domain is the five strands of sensual pleasure. ; vā=or the object. ; lobhassa=of greed. ; dutiyena=by the second. ; āghātavatthubhedādivisayānaṃ=of which the objects are the nine grounds for resentment and so on. ; dosamohānaṃ=of hatred and delusion. ;

Myanmar Nissaya

tathā=ထိုမှတစ်ပါး။ ; paṭhamena=ဖြင့်။ ; tīsu=ကုန်သော။ ; akusalamūlesu=တို့တွင်။ ; pañcakāmaguṇabhedavisayassa=ငါးပါးသော ကာမဂုဏ် အထူးလျှင် အာရုံရှိသော။ ; vā=အရာရှိသော။ ; lobhassa=ကို။ ; dutiyena=ဖြင့်။ ; āghātavatthubhedādivisayānaṃ=ကိုးပါး အပြားရှိသော အာဃာတဝတ္ထုအထူးစသည်လျှင် အရာရှိကုန်သော။ ; dosamohānaṃ=တို့ကို။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3365 | Chunk: 56

Oghādīsu vā dhammesu paṭhamena kāmoghakāmayogakāmāsavakāmupādānaabhijjhākāyagantha kāmarāgasaññojanānaṃ, dutiyena avasesaoghayogāsavaupādānaganthasaṃyojanānaṃ.

AI Translation based on Nissaya

Or, among such states as the floods, etc., by the first phrase, the abandoning of the flood of sensuality, yoke of sensuality, effluent of sensuality, clinging to sensuality, bodily knot of covetousness, and fetter of sensual lust is indicated; by the second, that of the remaining floods, yokes, effluents, clingings, knots, and fetters.

Vietnamese AI Translation

Hoặc, trong số các trạng thái như bộc lưu, v.v., qua cụm từ đầu tiên, sự từ bỏ dục bộc, dục ách, dục lậu, dục thủ, thân kết tham ái, và kiết sử dục ái được chỉ ra; qua cụm từ thứ hai, là sự từ bỏ các bộc lưu, ách, lậu, thủ, kết, và kiết sử còn lại.

AI Translation Nissaya

vā=Or. ; oghādīsu=among the floods, etc.. ; dhammesu=among the states. ; paṭhamena=by the first. ; kāmoghakāmayogakāmāsavakāmupādāna abhijjhākāyaganthakāmarāga saññojanānaṃ=the flood of sensuality, the yoke of sensuality, the effluent of sensuality, the clinging to sensuality, the bodily knot of covetousness, and the fetter of sensual lust. ; dutiyena=by the second. ; avasesaoghayogāsavaupādānaganthasaṃyojanānaṃ=of the remaining floods, yokes, effluents, clingings, knots, and fetters. ;

Myanmar Nissaya

vā=ကား။ ; oghādīsu=ကုန်သော။ ; dhammesu=တို့တွင်။ ; paṭhamena=ဖြင့်။ ; kāmoghakāmayogakāmāsavakāmupādāna abhijjhākāyaganthakāmarāga saññojanānaṃ=တို့ကို။ ; dutiyena=ဖြင့်။ ; avasesaoghayogāsavaupādānaganthasaṃyojanānaṃ=တို့ကို။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3366 | Chunk: 56

Paṭhamena taṇhāya taṃsampayuttakānañca, dutiyena avijjāya taṃsampayuttakānañca.

AI Translation based on Nissaya

By the first, craving and its associated states are indicated; by the second, ignorance and its associated states.

Vietnamese AI Translation

Qua vế đầu, ái và các trạng thái tương ưng của nó được chỉ ra; qua vế sau, vô minh và các trạng thái tương ưng của nó.

AI Translation Nissaya

paṭhamena=By the first. ; taṇhāya=craving, and. ; taṃsampayuttakānañca=states associated with that craving. ; dutiyena=by the second. ; avijjāya=ignorance, and. ; taṃsampayuttakānañca=states associated with that ignorance. ;

Myanmar Nissaya

paṭhamena=ဖြင့်။ ; taṇhāya=တဏှာကိုလည်းကောင်း။ ; taṃsampayuttakānañca=ထိုတဏှာနှင့် ယှဉ်သော တရားကိုလည်းကောင်း။ ; dutiyena=ဖြင့်။ ; avijjāya=ကိုလည်းကောင်း။ ; taṃsampayuttakānañca=တို့ကိုလည်းကောင်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3367 | Chunk: 56

Apica paṭhamena lobhasampayuttaaṭṭhacittuppādānaṃ, dutiyena sesānaṃ catunnaṃ akusalacittuppādānaṃ vikkhambhanaviveko vutto hotīti veditabbo.

AI Translation based on Nissaya

Furthermore, it should be understood that by the first phrase, seclusion by suppression from the eight types of consciousness associated with greed is stated, and by the second, from the remaining four types of unwholesome consciousness.

Vietnamese AI Translation

Hơn nữa, nên hiểu rằng qua cụm từ đầu tiên, sự ly bằng cách đè nén khỏi tám loại tâm tương ưng với tham được nêu rõ, và qua cụm từ thứ hai, khỏi bốn loại tâm bất thiện còn lại.

AI Translation Nissaya

apica (aparo=Another. ; nayo=method. ; mayā=by me. ; vuccate=will be spoken.) ; paṭhamena=by the first. ; lobhasampayuttaaṭṭhacittuppādānaṃ=of the eight types of consciousness associated with greed. ; dutiyena=by the second. ; sesānaṃ=of the remaining. ; catunnaṃ=four. ; akusalacittuppādānaṃ=unwholesome consciousness rooted in hatred and delusion. ; vā=of them. ; vikkhambhanaviveko=seclusion by suppression. ; vā=or. ; vutto=is spoken of. ; hoti=it is. ; iti=Thus. ; veditabbo=it should be known. ;

Myanmar Nissaya

apica (aparo=သော။ ; nayo=ကို။ ; mayā=သည်။ ; vuccate=အပ်၏။) ; paṭhamena=ဖြင့်။ ; lobhasampayuttaaṭṭhacittuppādānaṃ=တို့ကို။ ; dutiyena=ဖြင့်။ ; sesānaṃ=လောဘမူစိတ်မှ ကြွင်းကုန်သော။ ; catunnaṃ=ကုန်သော။ ; akusalacittuppādānaṃ=ဒေါသမူ မောဟမူ အကုသိုလ်စိတ္တုပ္ပါဒ်တို့ကို။ ; vā=တို့၏။ ; vikkhambhanaviveko=ခြင်းကို။ ; vā=ကို။ ; vutto=သည်။ ; hoti=၏။ ; iti=သို့။ ; veditabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3368 | Chunk: 56

Ettāvatā ca paṭhamassa jhānassa pahānaṅgaṃ dassetvā idāni sampayogaṅgaṃ dassetuṃ savitakkaṃ savicāran tiādi vuttaṃ.

AI Translation based on Nissaya

Having thus shown the factors to be abandoned for the first jhāna, now, to show the associated factors, the passage beginning “With initial application, with sustained application” is stated.

Vietnamese AI Translation

Sau khi đã chỉ ra các chi phần cần từ bỏ đối với sơ thiền, bây giờ, để chỉ ra các chi phần tương ưng, đoạn kinh bắt đầu bằng “Có tầm, có tứ” được nêu ra.

AI Translation Nissaya

ca=Furthermore. ; ettāvatā=by this much, with the sequence of words beginning with 'vivicceva kāmehi'. ; paṭhamassa jhānassa=of the first jhāna. ; mahānaṅgaṃ=the jhāna factors to be abandoned. ; dassetvā=having shown. ; idāni=now. ; sampayogaṅgaṃ=the associated factors. ; dassetuṃ=in order to show. ; savitakkaṃ savicāranti ādi=the passage beginning with 'savitakkaṃ savicāraṃ'. ; vuttaṃ=is said. ;

Myanmar Nissaya

ca=ထိုမှတစ်ပါး။ ; ettāvatā=ဤမျှအတိုင်းအရှည်ရှိသော ဝိဝိစ္စေဝ ကာမေဟိ အစရှိသော စကားအစဉ်ဖြင့်။ ; paṭhamassa jhānassa=၏။ ; mahānaṅgaṃ=ပယ်အပ်သော ဈာနင်ကို။ ; dassetvā=ပြီး၍။ ; idāni=၌။ ; sampayogaṅgaṃ=ကို။ ; dassetuṃ=ငှါ။ ; savitakkaṃ savicāranti ādi=ကို။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3369 | Chunk: 56

Tattha ārammaṇe cittassa abhiniropanalakkhaṇo vitakko.

AI Translation based on Nissaya

Therein, ‘initial application’ has the characteristic of directing the mind onto the object.

Vietnamese AI Translation

Trong đó, ‘tầm’ có đặc tính là hướng tâm đến đối tượng.

AI Translation Nissaya

tattha=In that phrase. ; (attho=The meaning. ; evaṃ=thus. ; veditabbo=should be understood.) ; ārammaṇe=onto the object. ; cittassa=the mind co-arisen with it. ; abhiniropanalakkhaṇo=the state which has the characteristic of directing towards. ; vitakko=is called initial application. ;

Myanmar Nissaya

tattha=ဟူသော ပုဒ်၌။ ; (attho=ကို။ ; evaṃ=သို့။ ; veditabbo=၏။) ; ārammaṇe=၌။ ; cittassa=မိမိနှင့်တကွဖြစ်သော စိတ်ကို။ ; abhiniropanalakkhaṇo=ရှေ့ရှုတင်ခြင်း လက္ခဏာရှိသော တရားသည်။ ; vitakko=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3370 | Chunk: 56

Ārammaṇānumajjanalakkhaṇo vicāro.

AI Translation based on Nissaya

‘Sustained application’ has the characteristic of continued examination of the object.

Vietnamese AI Translation

‘Tứ’ có đặc tính là tiếp tục khảo sát đối tượng.

AI Translation Nissaya

ārammaṇānumajjanalakkhaṇo=The state which has the characteristic of repeatedly examining the object. ; vicāro=is called sustained application. ;

Myanmar Nissaya

ārammaṇānumajjanalakkhaṇo=အာရုံကို တလုံလဲလဲ သုံးသပ်ခြင်း လက္ခဏာရှိသော တရားသည်။ ; vicāro=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3371 | Chunk: 56

Santepi ca nesaṃ katthaci avippayoge oḷārikaṭṭhena pubbaṅgamaṭṭhena ca ghaṇḍābhighāto viya cetaso paṭhamābhinipāto vitakko, sukhumaṭṭhena anumajjanasabhāvena ca ghaṇḍānuravo viya anuppabandho vicāro.

AI Translation based on Nissaya

And though they are in some cases unseparated, initial application is the mind’s first impact, being gross and occurring first, like the striking of a bell; sustained application is the subsequent process, being subtle and having the nature of continued examination, like the bell’s reverberation.

Vietnamese AI Translation

Và mặc dù trong một số trường hợp chúng không tách rời, tầm là tác động đầu tiên của tâm, thô và xảy ra trước, giống như tiếng gõ vào chuông; tứ là quá trình tiếp theo, vi tế và có bản chất là tiếp tục khảo sát, giống như tiếng vang của chuông.

AI Translation Nissaya

ca=Furthermore. ; nesaṃ=of that initial and sustained application. ; katthaci=in some fifty-five kinds of consciousness. ; avippayoge=inseparable association. ; santepi=although there is. ; oḷārikaṭṭhena=due to its gross nature, and. ; pubbaṅgamaṭṭhenaca=due to its nature of going first. ; ghaṇḍābhiyātoviya=like the striking of a bell. ; cetaso=of the mind. ; paṭhamābhinipāto=the initial impact on the object. ; vitakko=is called initial application. ; sukhumaṭṭhena=due to its subtle nature, and. ; anumajjasabhāvenaca=due to its nature of repeated examination of the object. ; ghaṇḍānuravoviya=like the reverberation of a bell. ; anuppabandho=the continuity of the mind. ; vā=or the continuous flow of the mind. ; vicāro=is called sustained application. ;

Myanmar Nissaya

ca=ဆက်။ ; nesaṃ=ထိုဝိတက်ဝိစာရတို့၏။ ; katthaci=အချို့သော ငါးဆယ့်ငါးပါးသော စိတ်၌။ ; avippayoge=မကွေမကွာ ယှဉ်ခြင်းသည်။ ; santepi=ရှိလျှင်မူလည်း။ ; oḷārikaṭṭhena=ရုန့်ရင်းသော အနက်ကြောင့်လည်းကောင်း။ ; pubbaṅgamaṭṭhenaca=ရှေ့သွားဖြစ်သော အနက်ကြောင့် လည်းကောင်း။ ; ghaṇḍābhiyātoviya=ခေါင်းလောင်းကို မတ်သော အသံကဲ့သို့။ ; cetaso=စိတ်၏။ ; paṭhamābhinipāto=အာရုံ၌ မဆွစွာ ကျခြင်းသည်။ ; vitakko=မည်၏။ ; sukhumaṭṭhena=သိမ်မွေ့သော အနက်ကြောင့်လည်းကောငး်။ ; anumajjasabhāvenaca=တလုံလဲလဲ အာရုံသို့ သုံးသပ်ခြင်း သဘောရှိသည်၏ အဖြစ်ကြောင့်လည်းကောင်း။ ; ghaṇḍānuravoviya=ခေါင်းလောင်း ယဉ်သော အသံကဲ့သို့။ ; anuppabandho=စိတ်၏ မပြတ်ခြင်းသည်။ ; vā=စိတ်၏ မပြတ်သော အစဉ်သည်။ ; vicāro=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3372 | Chunk: 56

Vipphāravā cettha vitakko paṭhamuppattikāle paripphandanabhūto cittassa, ākāse uppatitukāmassa pakkhino pakkhavikkhepo viya, padumābhimukhapāto viya ca gandhānubandhacetaso bhamarassa.

AI Translation based on Nissaya

Herein, initial application, being expansive, is the stirring of the mind at its first arising, like a bird that wants to fly up into the air flapping its wings, or like a bee with its mind set on a scent plunging towards a lotus.

Vietnamese AI Translation

Ở đây, tầm, có tính lan rộng, là sự khuấy động của tâm khi nó mới khởi sinh, giống như một con chim muốn bay lên không trung vỗ cánh, hoặc như một con ong với tâm trí hướng về mùi hương lao tới một đóa sen.

AI Translation Nissaya

ca=Furthermore. ; ettha=among this initial and sustained application. ; ākāse=in the sky. ; vā=towards. ; uppatitukāmassa=wishing to fly up. ; pakkhino=of a bird. ; pakkhavikkhepoviya=like the flapping of its wings, and. ; bhamarassa=of a bee. ; gandhānubandhacetaso=with a mind bound to a scent. ; hutvā=having become. ; tanaññaḥ=. ; gandhānubandhacetaso=with a mind bound to a scent. ; bhamarassa=of a bee. ;

Myanmar Nissaya

ca=ထိုမှတစ်ပါး။ ; ettha=ဤဝိတက်ဝိစာရတို့တွင်။ ; ākāse=၌။ ; vā=သို့။ ; uppatitukāmassa=ပျံတက်ခြင်းငှါ အလိုရှိသော။ ; pakkhino=ငှက်၏။ ; pakkhavikkhepoviya=အတောင်ကို ခတ်သကဲ့သို့လည်းကောင်း။ ; bhamarassa=ပိတုန်း၏။ ; gandhānubandhacetaso=အနံ့ဖြင့် ဖွဲ့သော စိတ်ရှိသည်။ ; hutvā=၍။ ; tanaññaḥ= ; gandhānubandhacetaso=အနံ့ဖြင့် ဖွဲ့အပ်သော စိတ်ရှိသော။ ; bhamarassa=ပိတုန်း၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3373 | Chunk: 56

Santavutti vicāro [P1.182] nātiparipphandanabhūto cittassa, ākāse uppatitassa pakkhino pakkhappasāraṇaṃ viya, paribbhamanaṃ viya ca padumābhimukhapatitassa bhamarassa padumassa uparibhāge.

AI Translation based on Nissaya

Sustained application, being of a quiet nature, is the not-very-stirred state of the mind, like the bird’s spreading its wings once it has flown up into the air, or like the bee, after it has plunged towards the lotus, circling above it.

Vietnamese AI Translation

Tứ, có bản chất tĩnh lặng, là trạng thái không-khuấy-động-lắm của tâm, giống như con chim giang rộng đôi cánh một khi đã bay lên không trung, hoặc như con ong, sau khi đã lao tới đóa sen, lượn vòng trên đó.

AI Translation Nissaya

padumāmukhapātoviyaca=like plunging towards a lotus flower, and. ; paṭhamuppattikāle=at the time of initial arising. ; cittassa=of the mind. ; paripphandanabhūto=which is in a state of agitation. ; vipphāravā=the spreading out onto the object. ; vitakkā=is called initial application. ; ākāse=in the sky. ; vā=towards. ; uppatitassa=having flown up. ; pakkhino=of a bird. ; pakkhappasāraṇaṃviya=like the spreading of its wings, and. ; padumābhimukhapatitassa=having plunged towards the lotus flower. ; vā=having reached. ; bhamarassa=of a bee. ; padumassa=of the lotus flower. ; uparibhāge=on the upper part. ; paribbhamanaṃviyaca=like circling around, and. ; cittassa=of the mind. ; nātiparipphandanabhūto=which is not excessively agitated. ; santavutti=the tranquil occurrence. ; vicāro=is called sustained application. ;

Myanmar Nissaya

padumāmukhapātoviyaca=ပဒုမ္မာကြာတောသို့ ရှေ့ရှုကျသကဲ့သို့ လည်းကောင်း။ ; paṭhamuppattikāle=မဆွစွာဖြစ်သောအခါ၌။ ; cittassa=၏။ ; paripphandanabhūto=တုန်လှုပ်သော အခြင်းအရာအားဖြင့် ဖြစ်သော။ ; vipphāravā=အာရုံ၌ ပြန့်ခြင်းသည်။ ; vitakkā=မည်၏။ ; ākāse=၌။ ; vā=သို့။ ; uppatitassa=ပျံ့တက်ပြီးသော။ ; pakkhino=ငှက်၏။ ; (ṅhakaṅayakiuyū) pakkhappasāraṇaṃviya=အတောင်ကို ဖြန့်သကဲ့သို့လည်းကောင်း။ ; padumābhimukhapatitassa=ပဒုမ္မာ ကြာတော်သို့ ရှေ့ရှုကျပြီးသော။ ; vā=ရောက်ပြီးသော။ ; bhamarassa=ပိတုန်း၏။ ; padumassa=ပဒုမ္မာ ကြာတော၏။ ; uparibhāge=အထက်၌။ ; paribbhamanaṃviyaca=ရစ်ဝဲသကဲ့သို့ လည်းကောင်း။ ; cittassa=၏။ ; nātiparipphandanabhūto=မတုန်လှုပ်လွန်းသောအားဖြင့် ဖြစ်သော။ ; santavutti=ငြိမ်သက်သော ဖြစ်ခြင်းသည်။ ; vicāro=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3374 | Chunk: 56

Dukanipātaṭṭhakathāyaṃ [M1.169 V1.154] pana ‘‘ākāse gacchato mahāsakuṇassa ubhohi pakkhehi vātaṃ gahetvā pakkhe sannisīdāpetvā gamanaṃ viya ārammaṇe cetaso abhiniropanabhāvena pavatto vitakko, vātaggahaṇatthaṃ pakkhe phandāpayamānassa gamanaṃ viya anumajjanabhāvena pavatto vicāro’’ ti vuttaṃ.

AI Translation based on Nissaya

In the commentary to the Dukanipāta, however, it is said: “Initial application is the mind’s act of applying itself to the object, like a great bird flying in the sky that, having caught the wind with both wings, glides with its wings outstretched. Sustained application is the act of continued examination, like that bird’s flapping its wings to catch the wind.”

Vietnamese AI Translation

Tuy nhiên, trong chú giải của Dukanipāta, có nói rằng: “Tầm là hành động của tâm áp đặt mình lên đối tượng, giống như một con chim lớn bay trên bầu trời, sau khi đã bắt được gió bằng cả hai cánh, lướt đi với đôi cánh dang rộng. Tứ là hành động tiếp tục khảo sát, giống như con chim đó vỗ cánh để bắt gió.”

AI Translation Nissaya

pana=I shall now state a specific point. ; dukanipātaṭṭhakathāyaṃ=In the commentary to the Dukanipāta. ; ākāse gacchato.la. vicāroti=as "flying in the sky... sustained application". ; vuttaṃ=it is said. ; ākāse=in the sky. ; gacchato=flying. ; mahāsakuṇassa=of a large bird. ; vā=or a vulture. ; (Ganthi). ; ubhohi=with both. ; pakkhehi=wings. ; vātaṃ=the wind. ; gahetvā=having caught. ; pakkhe=both wings. ; sannisīdāpetvā=having stretched out. ; gamanaṃviya=like flying without flapping. ; ārammaṇe=on the object. ; vā=towards. ; cetaso=of the mind. ; vā=or. ; abhiniropanabhāvena=with the nature of directing towards. ; vā=with the nature of making manifest. ; pavatto=the state that has arisen. ; vitakko=is called initial application. ; vātaggahanatthaṃ=in order to catch the wind. ; pakkho=the wings. ; phandāpayamānassa=of the flapping bird. ; gamanaṃviya=like its flying. ; anumajjanabhāvena=with the nature of repeatedly examining the object. ; pavatto=the state that has arisen. ; vicāro=is called sustained application. ; iti=Thus. ; vuttaṃ=it is said. ;

Myanmar Nissaya

pana=အထူးကို ဆိုဦးအံ့။ ; dukanipātaṭṭhakathāyaṃ=၌။ ; ākāse gacchato.la. vicāroti=ဟူ၍။ ; vuttaṃ=၏။ ; ākāse=ကောင်းကင်ပ။ ; gacchato=ပျံသွားသော။ ; mahāsakuṇassa=ကြီးသော ငှက်၏။ ; vā=ဠင်းတ၏။ ; (ဂဏ္ဌိ)။ ; ubhohi=နှစ်ဘက်ကုန်သော။ ; pakkhehi=အတောင်တို့ဖြင့်။ ; vātaṃ=လေကို။ ; gahetvā=၍။ ; pakkhe=အတောင်နှစ်ဘက်တိ့ကို။ ; sannisīdāpetvā=ဆန့်တန်း၍။ ; gamanaṃviya=အတောင်မခတ်ဘဲ သွားသကဲ့သို့။ ; ārammaṇe=၌။ ; vā=သို့။ ; cetaso=စိတ်၏။ ; vā=ကို။ ; abhiniropanabhāvena=ရှေးရှုရောက်သည်၏ အဖြစ်ဖြင့်။ ; vā=ရှေ့ရှုထင်သည်၏ အဖြစ်ဖြင့်။ ; pavatto=ဖြစ်သော သဘောတရားသည်။ ; vitakko=မည်၏။ ; vātaggahanatthaṃ=လေကို ယူခြင်းငွှ။ ; pakkho=အတောင်တို့ကို။ ; phandāpayamānassa=ခတ်သော ငှက်၏။ ; gamanaṃviya=ပျံသွားခြင်းကဲ့သို့။ ; anumajjanabhāvena=အာရုံကို တလုံလဲလဲ သုံးသပ်သည်၏ အဖြစ်ဖြင့်။ ; pavatto=ဖြစ်သော သဘောတရားသည်။ ; vicāro=မည်၏။ ; iti=သို့။ ; vuttaṃ=ပြီ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3375 | Chunk: 56

Taṃ anuppabandhena pavattiyaṃ yujjati.

AI Translation based on Nissaya

That statement is appropriate for the continuous process in access and absorption.

Vietnamese AI Translation

Phát biểu đó phù hợp cho quá trình liên tục trong cận định và an chỉ định.

AI Translation Nissaya

taṃvacanaṃ=That statement of the large bird simile. ; anuppabandhena=by means of continuous occurrence in the object. ; pavattiyaṃ=at the time of access and absorption concentration. ; yujjati=is suitable. ;

Myanmar Nissaya

taṃvacanaṃ=ထိုငှက်ကြီး ဥပမာစကားသည်။ ; anuppabandhena=အာရုံ၌ မပြတ်ဖြစ်သော အားဖြင့်။ ; pavattiyaṃ=ဥပစာရအပ္ပနာဖြစ်သော အခါ၌။ ; yujjati=သင့်ပါပေသတည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3376 | Chunk: 56

So pana tesaṃ viseso paṭhamadutiyajjhānesu pākaṭo hoti.

AI Translation based on Nissaya

However, the distinction between them becomes manifest in the first and second jhānas.

Vietnamese AI Translation

Tuy nhiên, sự phân biệt giữa chúng trở nên rõ ràng trong sơ thiền và nhị thiền.

AI Translation Nissaya

pana=I shall now state a specific point. ; tesaṃ=of that initial and sustained application. ; so viseso=that distinction. ; paṭhama dutiyajjhānesu=in the first and second jhānas. ; pākaṭo=is manifest. ; hoti=it is. ;

Myanmar Nissaya

pana=ဆိုဖွယ်အထူးကို ဆိုဦးအံ့။ ; tesaṃ=ထိုဝိတက် ဝိစာရ တို့၏။ ; so viseso=ထိုအထူးသည်။ ; paṭhama dutiyajjhānesu=တို့၌။ ; pākaṭo=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3377 | Chunk: 56

Apica malaggahitaṃ kaṃsabhājanaṃ ekena hatthena daḷhaṃ gahetvā itarena hatthena cuṇṇatelavālaṇḍupakena parimajjantassa daḷhaggahaṇahattho viya vitakko, parimajjanahattho viya vicāro.

AI Translation based on Nissaya

Again, initial application is like the hand of a person who, while scrubbing a tarnished bronze vessel, holds it tightly with one hand; sustained application is like the other hand that scrubs it with powder, oil, and a brush.

Vietnamese AI Translation

Một lần nữa, tầm giống như bàn tay của một người, trong khi cọ rửa một bình đồng bị xỉn màu, giữ chặt nó bằng một tay; tứ giống như bàn tay kia cọ nó với bột, dầu và bàn chải.

AI Translation Nissaya

apica aparo=Another. ; (nayo=method. ; mayā=by me. ; vuccate=will be spoken.) ; malaggahitaṃ=a tarnished. ; kaṃsabhājanaṃ=bronze vessel. ; ekena=with one. ; hatthena=hand. ; daḷhaṃ=firmly. ; gahetvā=having grasped. ; itarena hatthena=with the other hand. ; cuṇṇatelavālaṇḍupakena=with a brush of horsehair with stone powder mixed with oil. ; parimajjantassa=of a person scrubbing. ; daḷhaggahaṇatthoviya=like the hand that holds firmly. ; vitakko=initial application. ; daḷabbo=should be seen. ; parimajajanahatthoviya=like the hand that scrubs. ; vicāro=sustained application. ; daṭṭhabbo=should be seen. ;

Myanmar Nissaya

apica aparo=သော။ ; (nayo=ကို။ ; mayā=သည်။ ; vuccate=အံ့။) ; malaggahitaṃ=ကြေးညှိတတ်သော ။ ; kaṃsabhājanaṃ=ကြေးခွက်ကို။ ; ekena=တဖက်သော။ ; hatthena=ဖြင့်။ ; daḷhaṃ=ကြပ်ကြပ်။ ; gahetvā=၍။ ; itarena hatthena=ဖြင့်။ ; cuṇṇatelavālaṇḍupakena=ဆီနှင့် ရောသော ကျောက်မှုန့်ကို သွားမွေးတံပွက်ဖြင့်။ ; parimajjantassa=ပွတ်တိုက်သော သူ၏။ ; daḷhaggahaṇatthoviya=မြဲမြံစွာ ကိုင်သော လက်ကဲ့သို့။ ; vitakko=ကို။ ; daḷabbo=၏။ ; parimajajanahatthoviya=ပွတ်တိုက်သော လက်ကဲ့သို့။ ; vicāro=ကို။ ; daṭṭhabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3378 | Chunk: 56

Tathā kumbhakārassa daṇḍappahārena cakkaṃ bhamayitvā bhājanaṃ karontassa uppīḷanahattho viya vitakko, ito cito ca saṃsaraṇahattho viya vicāro.

AI Translation based on Nissaya

It is like a potter making a pot: initial application is like the hand that presses down on the clay after making the wheel spin by striking it with a stick; sustained application is like the hand that moves this way and that.

Vietnamese AI Translation

Nó giống như một người thợ gốm làm một cái nồi: tầm giống như bàn tay ấn xuống đất sét sau khi làm cho bàn xoay quay bằng cách dùng gậy đánh vào nó; tứ giống như bàn tay di chuyển qua lại.

AI Translation Nissaya

tathā=Furthermore. ; daṇḍappahārena=by striking with a stick. ; cakkaṃ=the potter's wheel. ; bhamayitvā=having made it spin. ; vā=or having turned. ; bhājanaṃ=a clay vessel. ; karontassa=who is making. ; kumbhakārassa=of a potter. ; uppiḷanahatthoviya=like the hand that presses down. ; vitakko=initial application. ; daḷabbo=should be seen. ; itato citoca=here and there. ; tanaññaḥ=. ; itoca=from here also. ; itoca=from there also. ; saṃsaraṇahatthoviya=like the hand that moves about. ; vicāro=sustained application. ; daṭṭhabbo=should be seen. ;

Myanmar Nissaya

tathā=ထိုမှ တပါး။ ; daṇḍappahārena=လှံတံခတ်သဖြင့်။ ; cakkaṃ=အိုးထိန်းစက်ကို။ ; bhamayitvā=လည်စေ၍။ ; vā=လှည့်၍။ ; bhājanaṃ=မြေခွက်ကို။ ; karontassa=လုပ်သော။ ; kumbhakārassa=အိုးထိန်းသည်၏။ ; uppiḷanahatthoviya=နှိပ်သော လက်ကဲ့သို့။ ; vitakko=ကို။ ; daḷabbo=၏။ ; itato citoca=ထိုမှ ဤမှ။ ; tanaññaḥ= ; itoca=ထိုမှလည်း။ ; itoca=ထိုမှလည်း။ ; saṃsaraṇahatthoviya=ရွေ့ရှားသော လက်ကဲ့သို့။ ; vicāro=ကို။ ; daṭṭhabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3379 | Chunk: 56

Tathā maṇḍalaṃ karontassa majjhe sannirujjhitvā ṭhitakaṇṭako viya abhiniropano vitakko, bahi paribbhamanakaṇṭako viya anumajjano vicāro.

AI Translation based on Nissaya

It is like drawing a circle: initial application, which applies the mind, is like the point of the compass fixed in the center; sustained application, which examines repeatedly, is like the point that revolves around it.

Vietnamese AI Translation

Nó giống như vẽ một vòng tròn: tầm, áp đặt tâm, giống như mũi compa cố định ở trung tâm; tứ, khảo sát lặp đi lặp lại, giống như mũi xoay quanh nó.

AI Translation Nissaya

tathā=Furthermore. ; maṇḍalaṃ=a circle. ; karontassa=of a person drawing. ; majjhe=in the center. ; santirujjhitvā=having been fixed. ; ṭhitakaṇṭakoviya=like the fixed point of a compass. ; abhiniropano=the state which directs towards the object. ; vitakko=is called initial application. ; bahi=on the outside. ; paribbhamanakaṇṭakoviya=like the point that revolves. ; anumajjano=the state which repeatedly examines the object. ; vicāro=is called sustained application. ;

Myanmar Nissaya

tathā=ထိုမှတစ်ပါး။ ; maṇḍalaṃ=စက်ဝန်းကို။ ; karontassa=ပြုသော သူ၏။ ; majjhe=အလယ်၌။ ; santirujjhitvā=စိုက်၍။ ; ṭhitakaṇṭakoviya=တည်သော ဆူးကဲ့သို့။ ; abhiniropano=အာရုံသို့ ရှေ့ရှုတတ်သော တရားသည်။ ; vitakko=မည်၏။ ; bahi=အပ၌။ ; paribbhamanakaṇṭakoviya=လည်စေသော ဆူးကဲ့သို့။ ; anumajjano=တလုံလဲလဲ အာရုံကို သုံးသပ်တတ်သော တရားသည်။ ; vicāro=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3380 | Chunk: 56

Iti iminā ca vitakkena iminā ca vicārena saha vattati rukkho viya pupphena phalena cāti idaṃ jhānaṃ ‘‘savitakkaṃ savicāran’’ ti vuccati.

AI Translation based on Nissaya

Thus, because this jhāna occurs together with this initial application and this sustained application—just as a tree exists together with its flowers and fruit—it is called “with initial application and with sustained application.”

Vietnamese AI Translation

Do đó, vì thiền na này xảy ra cùng với tầm này và tứ này—giống như một cái cây tồn tại cùng với hoa và quả của nó—nó được gọi là “có tầm và có tứ.”

AI Translation Nissaya

iti=Thus. ; iminā ca vitakkena=with this initial application, and. ; iminā ca vicārena=with this sustained application. ; saha=together. ; vattati=it occurs. ; (kimiva=Like what?) ; rukkho=a tree. ; pupphenapi=with flowers, and. ; phalenaca=with fruit. ; saha=together. ; vattativiya=just as it exists. ; ititasmā=Therefore. ; idaṃjhānaṃ=this first jhāna. ; savitakkaṃsavicāranti=as 'with initial application and with sustained application'. ; vuccati=is called. ;

Myanmar Nissaya

iti=သို့။ ; iminā ca vitakkena=လည်းကောင်း။ ; iminā ca vicārena=နှင့်လည်းကောင်း။ ; saha=တကွ။ ; vattati=၏။ ; (kimiva=ဟူမူကား။) ; rukkho=သည်။ ; pupphenapi=အပွင့်နှင့်လည်းကောင်း။ ; phalenaca=အသီးနှင့် လည်းကောင်း။ ; saha=ကွ။ ; vattativiya=သို့တည်း။ ; ititasmā=ကြောင့်။ ; idaṃjhānaṃ=ဤ ပဌမဈာန်ကို။ ; savitakkaṃsavicāranti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3381 | Chunk: 56

Vivekajan ti ettha vivitti viveko, nīvaraṇavigamoti attho.

AI Translation based on Nissaya

Herein, in the word 'vivekajaṃ' (born of seclusion), seclusion (viveka) is being secluded (vivitti), meaning the absence of the hindrances.

Vietnamese AI Translation

Ở đây, trong từ 'vivekajaṃ' (sanh do ly), sự ly (viveka) là sự bị ly (vivitti), có nghĩa là sự vắng mặt của các triền cái.

AI Translation Nissaya

vivekajantiettha=In the word 'vivekajaṃ'. ; (attho=The meaning. ; evaṃ=thus. ; veditabbo=should be understood.) ; vivitti=Seclusion. ; viveko=is seclusion. ; vā=or quietude. ; nīvaraṇavigamo=the absence of the hindrances. ; itiayaṃ=is. ; attho=the meaning. ;

Myanmar Nissaya

vivekajantiettha=၌။ ; (attho=ကို။ ; evaṃ=သို့။ ; veditabbo=၏။) ; vivitti=ဆိတ်ခြင်း။ ; viveko=ဆိတ်ခြင်း။ ; vā=တိတ်ခြင်း။ ; nīvaraṇavigamo=နီဝရဏ၏ ကင်းခြင်း။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3382 | Chunk: 56

Vivittoti vā viveko, nīvaraṇavivitto jhānasampayuttadhammarāsīti attho.

AI Translation based on Nissaya

Or, seclusion (viveka) is that which is secluded (vivitto), meaning the collection of states associated with jhāna that is free from the hindrances.

Vietnamese AI Translation

Hoặc, sự ly (viveka) là cái bị ly (vivitto), có nghĩa là tập hợp các trạng thái tương ưng với thiền na mà không có các triền cái.

AI Translation Nissaya

vā=Or. ; vivitto=the collection of states secluded from the hindrances. ; vā=the collection of states abandoned by the hindrances. ; ititasmā=Therefore. ; viveko=is called 'viveka' (seclusion). ; nīvaraṇavivitto=free from the hindrances. ; jhānasampayuttadhammarāsi=the collection of states associated with jhāna. ; itiayaṃ=is. ; attho=the meaning. ;

Myanmar Nissaya

vā=ကား။ ; vivitto=နီဝရဏမှ ဆိတ်သော တရားအစုတည်း။ ; vā=နီဝရဏ တို့သည် ကြဉ်အပ်သော တရားအစုတည်း။ ; ititasmā=ကြောင့်။ ; viveko=မည်၏။ ; nīvaraṇavivitto=နီဝရဏမှ ကင်းသော။ ; jhānasampayuttadhammarāsi=ဈာန်နှင့်ယှဉ်သော တရားအစုတည်း။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3383 | Chunk: 56

Tasmā vivekā, tasmiṃ vā viveke jātanti vivekajaṃ.

AI Translation based on Nissaya

It is ‘born of seclusion’ (vivekajaṃ) because it is born from that seclusion or born in that seclusion.

Vietnamese AI Translation

Nó là ‘sanh do ly’ (vivekajaṃ) bởi vì nó được sanh ra từ sự ly đó hoặc sanh ra trong sự ly đó.

AI Translation Nissaya

tasmā vivekāca=Because of the seclusion of the hindrances. ; vā=or. ; tasmiṃ viveke=in that collection of states associated with jhāna which is secluded from the hindrances. ; jātaṃ=it is born. ; ititasmā=Therefore. ; vivekajaṃ=it is called 'vivekajaṃ' (born of seclusion). ;

Myanmar Nissaya

tasmā vivekāca=နီဝရဏတို့၏ ဆိတ်ခြင်းကြောင့်။ ; vā=ကား။ ; tasmiṃ viveke=ထိုနီဝရဏတို့မှ ဆိတ်သော ဈာန်နှင့် ယှဉ်သော တရားအစု၌။ ; jātaṃ=ဖြစ််သည်တည်း။ ; ititasmā=ကြောင့်။ ; vivekajaṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3384 | Chunk: 56

Pītisukhan ti ettha pīṇayatīti pīti, sā sampiyāyanalakkhaṇā.

AI Translation based on Nissaya

Herein, in the phrase 'pītisukhaṃ' (zest and happiness), 'zest' (pīti) is so called because it pleases (pīṇayati). It has the characteristic of cherishing.

Vietnamese AI Translation

Ở đây, trong cụm từ 'pītisukhaṃ' (hỷ và lạc), 'hỷ' (pīti) được gọi như vậy vì nó làm hài lòng (pīṇayati). Nó có đặc tính là trân quý.

AI Translation Nissaya

pītisukhantiettha=In the phrase 'pītisukhaṃ'. ; (attho=the meaning. ; evaṃ=thus. ; veditabbo=should be understood.) ; pīṇayati=It pleases. ; vā=or it makes grow. ; ititasmā=Therefore. ; pīti=it is called 'pīti' (zest). ; sā=That zest. ; sampiyāyanalakkhaṇā=has the characteristic of cherishing the object. ;

Myanmar Nissaya

pītisukhantiettha=၌။ ; (attho=ကို။ ; evaṃ=သို့။ ; veditabbo=၏။) ; pīṇayati=နှစ်သက်စေတတ်၏။ ; vā=ပွားစေတတ်၏။ ; ititasmā=ကြောင့်။ ; pīti=မည်၏။ ; sā=ထိုပီတိသည်။ ; sampiyāyanalakkhaṇā=အာရုံကို မြတ်နိုးခြင်း လက္ခဏာရှိ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3385 | Chunk: 56

Sā panesā khuddikā pīti, khaṇikā pīti, okkantikā pīti, ubbegā pīti, pharaṇā pītīti pañcavidhā hoti.

AI Translation based on Nissaya

Furthermore, that rapture is of five kinds: minor rapture, momentary rapture, showering rapture, uplifting rapture, and pervading rapture.

Vietnamese AI Translation

Hơn nữa, hỷ đó có năm loại: tiểu hỷ, sát-na hỷ, ba-lãng hỷ, thăng-đằng hỷ, và biến-mãn hỷ.

AI Translation Nissaya

pana=Furthermore. ; sā esā pīti=that rapture. ; khuddikāpīti=as minor rapture. ; khaṇikāpīti=as momentary rapture. ; okkantikāpīti=as showering rapture. ; ubbegāpīti=as uplifting rapture. ; pharaṇāpīti=as pervading rapture. ; iti=thus. ; pañcavidhā=is of five kinds. ; hoti=it is. ;

Myanmar Nissaya

pana=အပြားကို ဆိုဦးအံ့။ ; sā esā pīti=ထိုပီတိသည်။ ; khuddikāpīti=လည်းကောင်း။ ; khaṇikāpīti=လည်းကောင်း။ ; okkantikāpīti=လည်းကောင်း။ ; ubbegāpīti=လည်းကောင်း။ ; pharaṇāpīti=လည်းကောင်း။ ; iti=သို့။ ; pañcavidhā=ရှိသည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3386 | Chunk: 57

Tattha khuddikā pīti sarīre lomahaṃsanamattameva kātuṃ sakkoti.

AI Translation based on Nissaya

Among these, minor rapture is only able to cause the hair on the body to stand on end.

Vietnamese AI Translation

Trong số này, tiểu hỷ chỉ có thể làm cho lông trên cơ thể dựng đứng.

AI Translation Nissaya

tattha=Among those five. ; khuddikāpīti=minor rapture. ; sarīre=in the body. ; lomahaṃsanamattameva=only to the extent of making the hair stand on end. ; vā=or only to the extent of causing goosebumps. ; kātuṃ=is able to cause. ; sakkoti=it is able. ;

Myanmar Nissaya

tattha=ထိုငါးပါးတို့တွင်။ ; khuddikāpīti=သည်။ ; sarīre=ကိုယ်၌။ ; lomahaṃsanamattameva=အမွေရွှင်ခြင်းမျှ ကိုသာလျှင်။ ; vā=ကြက်သီးထခြင်းမျှကိုသာလျှင်။ ; kātuṃ=ငှါ။ ; sakkoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3387 | Chunk: 57

Khaṇikā pīti khaṇe khaṇe vijjuppādasadisā hoti.

AI Translation based on Nissaya

Momentary rapture is like a flash of lightning from moment to moment.

Vietnamese AI Translation

Sát-na hỷ giống như một tia chớp từ khoảnh khắc này sang khoảnh khắc khác.

AI Translation Nissaya

khaṇikā pīti=Momentary rapture. ; khaṇekhaṇe=from moment to moment. ; vijjuppādasadisā=is like the arising of lightning. ; hoti=it is. ;

Myanmar Nissaya

khaṇikā pīti=သည်။ ; khaṇekhaṇe=ခဏခဏ၌။ ; vijjuppādasadisā=လျှပ်ပျက်သည်နှင့် တူသည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3388 | Chunk: 57

Okkantikā pīti samuddatīraṃ vīci viya kāyaṃ okkamitvā okkamitvā bhijjati.

AI Translation based on Nissaya

Showering rapture, like a wave on the seashore, washes over the body again and again and breaks.

Vietnamese AI Translation

Ba-lãng hỷ, giống như một con sóng trên bờ biển, tràn qua cơ thể hết lần này đến lần khác rồi tan vỡ.

AI Translation Nissaya

okkantikāpīti=Showering rapture. ; samuddatīraṃ=to the ocean shore. ; vīci=a wave. ; okkamitvā okkamitvā=descending again and again. ; bhijjativiya=as if breaking. ; kāyaṃ=upon the body. ; okkamitvā okkamitvā=descending again and again. ; bhijjati=it breaks. ;

Myanmar Nissaya

okkantikāpīti=သည်။ ; samuddatīraṃ=သမုဒ္ဒရာကမ်းသိ့။ ; vīci=လှိုင်းတပိုးသည်။ ; okkamitvā okkamitvā=သက်၍ သက်၍။ ; bhijjativiya=ပျက်ပြိုသကဲ့သို့။ ; kāyaṃ=ကိုယ်ကို။ ; okkamitvā okkamitvā=၍။ ; bhijjati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3389 | Chunk: 57

Ubbegā pīti balavatī hoti kāyaṃ uddhaggaṃ katvā ākāse laṅghāpanappamāṇappattā.

AI Translation based on Nissaya

Uplifting rapture is powerful, reaching the extent of making the body rise up and leap into the air.

Vietnamese AI Translation

Thăng-đằng hỷ rất mạnh mẽ, đến mức làm cho cơ thể bay lên và nhảy vào không trung.

AI Translation Nissaya

ubbegāpīti=Uplifting rapture. ; balavatī=is powerful. ; hoti=it is. ; kāyaṃ=the body. ; uddhaggaṃ=making it rise up. ; katvā=having made. ; ākāse=in the sky. ; laṅghāpanappamāṇappattā=reaches the extent of causing it to leap. ; hoti=it is. ;

Myanmar Nissaya

ubbegāpīti=သည်။ ; balavatī=အားကြီးသည်။ ; hoti=၏။ ; kāyaṃ=ကို။ ; uddhaggaṃ=အတက်သို့ တက်သည်ကို။ ; katvā=၍။ ; ākāse=ကောင်းကင်၌။ ; laṅghāpanappamāṇappattā=လွင့်စေခြင်း အတိုင်းအရှည်သို့ရောက်သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3390 | Chunk: 57

Pharaṇā pīti atibalavatī hoti.

AI Translation based on Nissaya

Pervading rapture is extremely powerful.

Vietnamese AI Translation

Biến-mãn hỷ cực kỳ mạnh mẽ.

AI Translation Nissaya

pharaṇāpīti=Pervading rapture. ; atijalavatī=is extremely powerful. ; hoti=it is. ;

Myanmar Nissaya

pharaṇāpīti=သည်။ ; atijalavatī=အလွန်အားကြီးသည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3391 | Chunk: 57

Tāya hi uppannāya sakalasarīraṃ dhamitvā pūritavatthi viya [P1.183] mahatā udakoghena pakkhandapabbatakucchi viya ca anupariphuṭaṃ hoti.

AI Translation based on Nissaya

Indeed, when it has arisen, the entire body is thoroughly pervaded, like a filled bladder [P1.183] that has been inflated, and like a mountain cavern rushed into by a great flood of water.

Vietnamese AI Translation

Thật vậy, khi nó đã khởi lên, toàn bộ cơ thể được thấm nhuần triệt để, giống như một bàng quang đầy [P1.183] đã được thổi phồng, và giống như một hang núi bị một trận lụt lớn tràn vào.

AI Translation Nissaya

hi saccaṃ=Indeed. ; tāya=when that pervading rapture. ; uppannāya=has arisen. ; sakalasarīraṃ=the entire body. ; dhamitvā=having been inflated. ; pūritavatthiviya=like a filled bladder. ; mahatā=by a great. ; udakoghena=flood of water. ; pakkhandapabbatakucchiviyaca=and like a mountain cavern rushed into. ; anupariphuṭaṃ=is thoroughly pervaded. ; hoti=it is. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; tāya=ထိုဖရဏာပီတိ သည်။ ; uppannāya=ဖြစ်သည်ရှိသော်။ ; sakalasarīraṃ=ကိုယ်အလုံးသည်။ ; dhamitvā=မှုတ်၍။ ; pūritavatthiviya=လေဖြင့် ပြည့်သော သားရေအိတ်ကဲ့သို့လည်းကောင်းဓ ; mahatā=များစွာသော။ ; udakoghena=ရေအလျဉ်သည်။ ; pakkhandapabbatakucchiviyaca=ပြေးဝင်သော တောင်ဝှမ်းကဲ့သို့ လည်းကောင်း။ ; anupariphuṭaṃ=ထက်ဝန်းကျင်မှ နှံ့သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3392 | Chunk: 57

Sā panesā pañcavidhā pīti gabbhaṃ gaṇhantī paripākaṃ gacchantī duvidhaṃ passaddhiṃ paripūreti kāyapassaddhiñca cittapassaddhiñca.

AI Translation based on Nissaya

Now, this fivefold rapture, 'conceiving' and coming to maturity, fulfills the twofold tranquility: tranquility of body and tranquility of mind.

Vietnamese AI Translation

Bây giờ, năm loại hỷ này, khi 'hoài thai' và đến lúc trưởng thành, làm viên mãn hai loại khinh an: thân khinh an và tâm khinh an.

AI Translation Nissaya

pana=Now, to speak of the result. ; pañcavidhā=The fivefold. ; sā esā pīti=that rapture. ; gabbhaṃ=as its embryo. ; gaṇhantī=taking. ; paripākaṃ=to maturity. ; gacchanti=and coming. ; kāyapassaddhiṃca=and tranquility of body. ; cittapassaddhiṃca=and tranquility of mind. ; iti=thus. ; duvidhaṃ=the twofold. ; passaddhiṃ=tranquility. ; paripūreti=fulfills. ;

Myanmar Nissaya

pana=အကျိုးကိုဆိုအံ့။ ; pañcavidhā=ငါးပါးအပြားရှိသော။ ; sā esā pīti=သည်။ ; gabbhaṃ=ပဋိသန္ဓေကို။ ; gaṇhantī=ယူသည်ဖြစ်၍။ ; paripākaṃ=ရင့်ခြင်းသို့။ ; gacchanti=ရောက်သည်ဖြစ်၍။ ; kāyapassaddhiṃca=ကိုလည်းကောင်း။ ; cittapassaddhiṃca=ကိုလည်းကောင်း။ ; iti=သို့။ ; duvidhaṃ=သော။ ; passaddhiṃ=ကို။ ; paripūreti=ပြည့်စေ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3393 | Chunk: 57

Passaddhi gabbhaṃ gaṇhantī paripākaṃ gacchantī duvidhampi sukhaṃ paripūreti kāyikañca cetasikañca.

AI Translation based on Nissaya

Tranquility, 'conceiving' and coming to maturity, fulfills both kinds of happiness: bodily and mental.

Vietnamese AI Translation

Khinh an, khi 'hoài thai' và đến lúc trưởng thành, làm viên mãn cả hai loại lạc: thân lạc và tâm lạc.

AI Translation Nissaya

passaddhi=The twofold tranquility. ; gabbhaṃ=as its embryo. ; gaṇhantī=taking. ; paripākaṃ=to maturity. ; gacchanti=and coming. ; kāyikañca=and bodily happiness. ; cetasikasukhañca=and mental happiness. ; duvidhampi=both kinds of. ; sukhaṃ=happiness. ; paripūreti=fulfills. ;

Myanmar Nissaya

passaddhi=နှစ်ပါးသော ပဿဒ္ဓိသည်။ ; gabbhaṃ=ကို။ ; gaṇhantī=ယူသည်ဖြစ်၍။ ; paripākaṃ=ရင့်ခြင်းသို့။ ; gacchanti=ရောက်သည်ဖြစ်၍။ ; kāyikañca=ကာယိကသုခကိုလည်းကောင်း။ ; cetasikasukhañca=ကိုလည်းကောင်း။ ; duvidhampi=သော။ ; sukhaṃ=ကို။ ; paripūreti=ပြည့်စေ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3394 | Chunk: 57

Sukhaṃ [M1.170] gabbhaṃ gaṇhantaṃ paripākaṃ gacchantaṃ tividhaṃ samādhiṃ paripūreti – khaṇikasamādhiṃ, upacārasamādhiṃ, appanāsamādhiñcāti.

AI Translation based on Nissaya

Happiness [M1.170], 'conceiving' and coming to maturity, fulfills the threefold concentration: momentary concentration, access concentration, and absorption concentration.

Vietnamese AI Translation

Lạc [M1.170], khi 'hoài thai' và đến lúc trưởng thành, làm viên mãn ba loại định: sát-na định, cận định, và an chỉ định.

AI Translation Nissaya

sukhaṃ=Happiness. ; gabbhaṃ=as its embryo. ; gaṇhantaṃ=taking. ; paripākaṃ=to maturity. ; gacchantaṃ=and coming. ; khaṇikasamādhiṃ=momentary concentration. ; upacārasamādhiṃ=access concentration. ; appanāsamādhiñca=and absorption concentration. ; iti=thus. ; tividhaṃ=the threefold. ; samādhiṃ=concentration. ; paripūreti=fulfills. ;

Myanmar Nissaya

sukhaṃ=သည်။ ; gabbhaṃ=ပဋိသန္ဓေကို။ ; gaṇhantaṃ=ယူသည်ဖြစ်၍။ ; paripākaṃ=သို့။ ; gacchantaṃ=ဖြစ်၍။ ; khaṇikasamādhiṃ=ကာမာဝစရသမာဓိကို လည်းကေင်း။ ; upacārasamādhiṃ=သမာဓိကို လည်းကောင်း။ ; appanāsamādhiñca=ကိုလည်းကောင်း။ ; iti=သုိ့။ ; tividhaṃ=သော။ ; samādhiṃ=ကို။ ; paripūreti=စေ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3395 | Chunk: 57

Tāsu ca yā appanāsamādhissa mūlaṃ hutvā vaḍḍhamānā samādhisampayogaṃ gatā pharaṇā pīti, ayaṃ imasmiṃ atthe adhippetā pītīti.

AI Translation based on Nissaya

And among those, that which is pervading rapture—which, having become the root of absorption concentration, grows and becomes associated with concentration—this is the 'rapture' intended in this context.

Vietnamese AI Translation

Và trong số đó, cái là biến-mãn hỷ—sau khi đã trở thành gốc rễ của an chỉ định, phát triển và trở nên tương ưng với định—đây chính là 'hỷ' được nhắm đến trong bối cảnh này.

AI Translation Nissaya

tāsuca=And among those five kinds of rapture. ; appanāsamādhissa=of absorption concentration. ; mūlaṃ=as the root. ; hutvā=having become. ; vaḍḍhamānā=which grows. ; samādhisampayogaṃ=to association with concentration. ; gatā=and has gone. ; yā pharaṇāpīti=that which is pervading rapture. ; atthi=there is. ; ayaṃ=This. ; imasmiṃ atthe=in this context. ; pītiti=as 'rapture'. ; adhippetā=is intended. ;

Myanmar Nissaya

tāsuca=ထိုငါးပါးသော ပီတိတို့တွင်လည်း။ ; appanāsamādhissa=၏။ ; mūlaṃ=အကြောင်းအရင်းသည်။ ; hutvā=၍။ ; vaḍḍhamānā=ပွားစီးသော။ ; samādhisampayogaṃ=ခြင်းသို့။ ; gatā=သော။ ; yā pharaṇāpīti=သည်။ ; atthi=၏။ ; ayaṃ=ကို။ ; imasmiṃ atthe=ဤအရာ၌။ ; pītiti=ဟူ၍။ ; adhippetā=ရှိအပ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3396 | Chunk: 57

Itaraṃ [V1.155] pana sukhayatīti sukhaṃ, yassuppajjati, taṃ sukhitaṃ karotīti attho.

AI Translation based on Nissaya

Now, as for what is other [V1.155] than rapture: it makes one happy (sukhayati), therefore it is happiness (sukhaṃ). The meaning is: for whomever it arises, it makes that person happy.

Vietnamese AI Translation

Bây giờ, đối với cái khác [V1.155] với hỷ: nó làm cho người ta hạnh phúc (sukhayati), do đó nó là lạc (sukhaṃ). Ý nghĩa là: đối với bất cứ ai mà nó khởi lên, nó làm cho người đó hạnh phúc.

AI Translation Nissaya

pana=Now, to speak of happiness, which is other than rapture. ; itaraṃ=The feeling of happiness. ; sukhayati=makes happy. ; ititasmā=Therefore. ; sukhaṃ=it is called 'happiness' (sukha). ; yassa=For whom. ; uppajjati=happiness arises. ; taṃ=that person. ; sukhitaṃ=happiness. ; vā=or makes them experience happiness. ; karoti=it does. ; itiayaṃ=This. ; attho=is the meaning. ;

Myanmar Nissaya

pana=ပီတိမှ တပါး သုခကို ဆိုဦးအံ့။ ; itaraṃ=သုခဝေဒနာသည်။ ; sukhayati=ချမ်းသာစေတတ်၏။ ; ititasmā=ကြောင့်။ ; sukhaṃ=မည်၏။ ; yassa=အား။ ; uppajjati=သုခသည်ဖြစ်၏။ ; taṃ=ထိုပုဂ္ဂိုလ်ကို။ ; sukhitaṃ=ခြင်းကို။ ; vā=ခြင်းသို့ ရောက်သည်ကို။ ; karoti=၏။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3397 | Chunk: 57

Sukhanaṃ vā sukhaṃ, suṭṭhu vā khādati, khaṇati ca kāyacittābādhanti sukhaṃ, somanassavedanāyetaṃ nāmaṃ.

AI Translation based on Nissaya

Or, being happy (sukhanaṃ) is happiness (sukhaṃ). Or, it consumes (khādati) or digs up (khaṇati) the afflictions of body and mind well (suṭṭhu); therefore, it is happiness. This is a name for the feeling of mental pleasure.

Vietnamese AI Translation

Hoặc, sự hạnh phúc (sukhanaṃ) là lạc (sukhaṃ). Hoặc, nó tiêu thụ (khādati) hoặc đào lên (khaṇati) những phiền não của thân và tâm một cách tốt đẹp (suṭṭhu); do đó, nó là lạc. Đây là một tên gọi cho cảm giác của tâm lạc.

AI Translation Nissaya

vā=Alternatively. ; sukhanaṃ=the state of being happy. ; sukhaṃ=is happiness. ; vā=Or. ; suṭṭhu=well. ; kāyacittābādhaṃ=the affliction of body and mind. ; khādati=it consumes. ; ca=Or also. ; kāyacittābādhaṃ=the affliction of body and mind. ; khaṇati=it digs up/destroys. ; ititasmā=Therefore. ; sukhaṃ=it is called 'happiness'. ; etaṃ=This name 'happiness'. ; somanassavedanāya=of the feeling of mental pleasure. ; nāmaṃ=is a name. ;

Myanmar Nissaya

vā=ကား။ ; sukhanaṃ=ခြင်း။။ ; sukhaṃ=ခြင်း။ ; vā=၏။ ; suṭṭhu=စွာ။ ; kāyacittābādhaṃ=ကိုယ်စိတ်၏ ကျင်နာခြင်းကို။ ; khādati=ခဲတတ်၏။ ; ca=တနည်းလည်း။ ; kāyacittābādhaṃ=ကို။ ; khaṇati=တူးဖြိုတတ်၏။ ; ititasmā=ကြောင့်။ ; sukhaṃ=မည်၏။ ; etaṃ=ဤသုခဟူသော အမည်သည်။ ; somanassavedanāya=၏။ ; nāmaṃ=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3398 | Chunk: 57

Taṃ sātalakkhaṇaṃ.

AI Translation based on Nissaya

It has the characteristic of gratification.

Vietnamese AI Translation

Nó có đặc tính là sự thỏa mãn.

AI Translation Nissaya

taṃ=That feeling of happiness. ; sātalakkhaṇaṃ=has the characteristic of gratification. ;

Myanmar Nissaya

taṃ=ထိုသုခဝေဒနာသည်။ ; sātalakkhaṇaṃ=သာယာခြင်း လက္ခဏာရှိ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3399 | Chunk: 57

Santepi ca nesaṃ katthaci avippayoge iṭṭhārammaṇapaṭilābhatuṭṭhi pīti, paṭiladdharasānubhavanaṃ sukhaṃ.

AI Translation based on Nissaya

And although they are inseparable in some cases, the delight in obtaining a desirable object is rapture; the experiencing of the flavor of the obtained object is happiness.

Vietnamese AI Translation

Và mặc dù trong một số trường hợp chúng không thể tách rời, sự vui thích khi đạt được một đối tượng mong muốn là hỷ; sự trải nghiệm hương vị của đối tượng đã đạt được là lạc.

AI Translation Nissaya

ca=Now, to speak of the distinction. ; nesaṃ=of those (rapture and happiness). ; katthaci=in some cases (in the 51 states of consciousness). ; avippayoge=in their inseparability. ; santepi=even though there is. ; iṭṭhārammaṇa paṭilātuṭṭhi=the delight in obtaining a desirable object. ; pīti=is called rapture. ; paṭiladdharasānubhavanaṃ=the experiencing of the flavor of the obtained object. ; sukhaṃ=is called happiness. ;

Myanmar Nissaya

ca=အထူးကိုဆိုဦးအံ့။ ; nesaṃ=ထိုပီတိသုခတို့၏ ။ ; katthaci=အချို့သော (၅၁)ခုသော စိတ်၌။ ; avippayoge=မကွေမကွာယှဉ်ခြင်းသည်။ ; santepi=ဖြစ်လျှင်မူလည်း။ ; iṭṭhārammaṇa paṭilātuṭṭhi=အလိုရှိအပ်သော အာရုံကိုရခြင်း၌ နှစ်သက်ခြင်းသည်။ ; pīti=မည်၏။ ; paṭiladdharasānubhavanaṃ=ရအပ်သော အာရုံ၏ အရသာကို ခံစားခြင်းသည်။ ; sukhaṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3400 | Chunk: 57

Yattha pīti, tattha sukhaṃ.

AI Translation based on Nissaya

Where there is rapture, there is happiness.

Vietnamese AI Translation

Nơi nào có hỷ, nơi đó có lạc.

AI Translation Nissaya

pīti=Rapture. ; (uppajjati=arises). ; tattha=there, in those fifty-one states of consciousness where rapture arises. ; yattha=wherever, in those fifty-one states of consciousness. ; yattha=wherever, in those fifty-one states of consciousness. ; sukhaṃ=happiness. ; (uppajjati=arises). ;

Myanmar Nissaya

pīti=သည်။ ; (uppajjati=၏)။ ; tattha=ထိုပီတိဖြစ်ရာ ငါးဆယ့် တစ်ခုသော စိတ်၌။ ; yattha=အကြင်ခြောယ်ဆယ့် တစ်ခုသော စိတ်၌။ ; yattha=အကြင် ငါးဆယ့်တစ်ခုသော စိတ်၌။ ; sukhaṃ=သည်။ ; (uppajjati=၏။) ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3401 | Chunk: 57

Yattha sukhaṃ, tattha na niyamato pīti.

AI Translation based on Nissaya

Where there is happiness, there is not necessarily rapture.

Vietnamese AI Translation

Nơi nào có lạc, không nhất thiết có hỷ.

AI Translation Nissaya

tattha=There, in the sixty-two states of mind where happiness arises. ; niyamato=definitely. ; pīti=rapture. ; (na uppajjati=does not arise). ; pīti=Rapture. ;

Myanmar Nissaya

tattha=ထိုသုခ ဖြစ်ရာ ခြောယ်ဆယ့်တစ်ခုသော စိတ်၌။ ; niyamato=မြဲသောအာဖြင့်။ ; pīti=သည်။ ; (na uppajjati=မဖြစ်။) ; pīti=ကို။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3402 | Chunk: 57

Saṅkhārakkhandhasaṅgahitā pīti, vedanākkhandhasaṅgahitaṃ sukhaṃ.

AI Translation based on Nissaya

Rapture is included in the aggregate of formations; happiness is included in the aggregate of feelings.

Vietnamese AI Translation

Hỷ được bao gồm trong hành uẩn; lạc được bao gồm trong thọ uẩn.

AI Translation Nissaya

saṅkhārakkhandhasaṅgahitā=Rapture is included in the aggregate of mental formations. ; sukhaṃ=Happiness. ; vedanākkhandhasaṅgahitaṃ=is included in the aggregate of feelings. ;

Myanmar Nissaya

saṅkhārakkhandhasaṅgahitā=ဖြင့် သင်္ဂြိုလ်ရေတွက်အပ်၏။ ; sukhaṃ=ကို။ ; vedanākkhandhasaṅgahitaṃ=ဖြင့် သင်္ဂြိုဟ်ရေတွက်အပ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3403 | Chunk: 57

Kantārakhinnassa vanantudakadassanasavanesu viya pīti, vanacchāyāpavesanaudakaparibhogesu viya sukhaṃ.

AI Translation based on Nissaya

For a man exhausted in a wasteland, rapture is like seeing a forest grove and hearing of water; happiness is like entering the shade of the forest grove and using the water.

Vietnamese AI Translation

Đối với một người đàn ông kiệt sức trong một vùng đất hoang, hỷ giống như nhìn thấy một lùm cây và nghe nói về nước; lạc giống như đi vào bóng mát của lùm cây và dùng nước.

AI Translation Nissaya

kantārakhinnassa=for a man exhausted in a wasteland. ; vanantudakadassanasavanesu viya=is like on seeing a forest edge and on hearing of water. ; pīti=rapture. ; daṭṭhabbā=should be understood. ; vanacchāyāpavedanaudakaparibhogesaviya=is like on entering the shade of the forest and on using the water. ; sukhaṃ=happiness. ; daṭṭhabbaṃ=should be understood. ; ca saccaṃ=indeed. ;

Myanmar Nissaya

kantārakhinnassa=ခရီးခဲ၌ ပင်ပန်နွမ်းနယ်သော ယောင်္ကျားအား။ ; vanantudakadassanasavanesu viya=တောအုပ်ကို မြင်သောအခါ ရေရှိ၏ဟု ကြားသောအခါတို့၌ကဲ့သို့။ ; pīti=ကို။ ; daṭṭhabbā=၏။ ; vanacchāyāpavedanaudakaparibhogesaviya=တောအုပ်ရိပ်သို့ ဝင်သောအခါ ရေကို သုံးဆောင်သော အခါသို့၌ကဲ့သို့။ ; sukhaṃ=ကို။ ; daṭṭhabbaṃ=၏။ ; ca saccaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3404 | Chunk: 57

Tasmiṃ tasmiṃ samaye pākaṭabhāvato cetaṃ vuttanti veditabbaṃ.

AI Translation based on Nissaya

It should be understood that this was stated because of their respective manifestation at those times.

Vietnamese AI Translation

Nên hiểu rằng điều này được nói ra là do sự biểu hiện tương ứng của chúng vào những thời điểm đó.

AI Translation Nissaya

tasmiṃ tasmiṃ samaye=At those respective times, such as seeing, hearing, entering the shade, and using. ; pākaṭabhāva‌ota=because of their being manifest. ; etaṃ=this saying beginning with 'kantārakhinnassa'. ; mayā=by me, the commentator. ; vuttaṃ=was said. ; iti=Thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

tasmiṃ tasmiṃ samaye=တို့ကို မြင်ခြင်း ကြားခြင်းအရိပ်သို့ ဝင်ခြင်း သုံးဆောင်ခြင်းစသော အခါ၌။ ; pākaṭabhāva‌ota=ထင်ရှားသည်၏ အဖြစ်ကြောင့်။ ; etaṃ=ဤကန္တာရခိန္နဿ အစရှိသော စကားကို။ ; mayā=ငါ အဋ္ဌကထာ ဆရာသည်။ ; vuttaṃ=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3405 | Chunk: 57

Iti ayañca pīti idañca sukhaṃ assa jhānassa, asmiṃ vā jhāne atthīti idaṃ jhānaṃ ‘‘pītisukhan’’ ti vuccati.

AI Translation based on Nissaya

Thus, because this jhana has this rapture and this happiness, or because this rapture and this happiness exist in this jhana, this jhana is called 'having rapture and happiness.'

Vietnamese AI Translation

Do đó, bởi vì thiền na này có hỷ này và lạc này, hoặc bởi vì hỷ này và lạc này tồn tại trong thiền na này, thiền na này được gọi là 'có hỷ và lạc.'

AI Translation Nissaya

iti=Thus. ; assa jhānassa=to this jhana. ; vā=or. ; asmiṃ jhāne=in this jhana. ; ayañca pīti=this rapture and. ; idañca sukhaṃ=this happiness. ; atthi=exist. ; ititasmā=Therefore. ; idaṃjhānaṃ=this jhana. ; pītisukhanti=as 'pītisukha' (having rapture and happiness). ; vuccati=is called. ;

Myanmar Nissaya

iti=သို့။ ; assa jhānassa=အား။ ; vā=ကား။ ; asmiṃ jhāne=၌။ ; ayañca pīti=ဤပီတိသည် လည်းကောင်း။ ; idañca sukhaṃ=ဤသုခသည်လည်းကောင်း။ ; atthi=၏။ ; ititasmā=ကြောင့်။ ; idaṃjhānaṃ=ကို။ ; pītisukhanti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3406 | Chunk: 57

Atha vā pīti ca sukhañca pītisukhaṃ dhammavinayādayo viya.

AI Translation based on Nissaya

Alternatively, 'rapture and happiness' is 'rapture-happiness,' like 'discipline and doctrine' (dhammavinaya) and so on.

Vietnamese AI Translation

Hoặc cách khác, 'hỷ và lạc' là 'hỷ-lạc', giống như 'pháp và luật' (dhammavinaya) và vân vân.

AI Translation Nissaya

athavā=Alternatively. ; pītica=rapture and. ; sukhañca=happiness. ; pītisukhaṃ=is 'pītisukha' (rapture-happiness). ; (ko viya=Like which dvandva compound?.); dhammavinayādayoviya=Just like 'dhammavinaya' and other such words are dvandva compounds. ;

Myanmar Nissaya

athavā=ကား။ ; pītica=လည်း။ ; sukhañca=လည်း။ ; pītisukhaṃ=ပီတိသုခ။ ; (ko viya=အဘယ်ပုဒ်၏ ဒွန်သမာသ်ကဲ့သို့ နည်းဟူမူကား။) ; dhammavinayādayoviya=ဓမ္မဝိနယ အစရှိသော သဒ္ဒါတို့သည် ဒွန်သမာသ် ဖြစ်သကဲ့သို့တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3407 | Chunk: 57

Vivekajaṃ pītisukhaṃ assa jhānassa, asmiṃ vā jhāne atthīti evampi vivekajaṃ pītisukhaṃ.

AI Translation based on Nissaya

Or, because this jhana has rapture and happiness born of seclusion, or because in this jhana there is rapture and happiness born of seclusion, it is also 'born of seclusion, with rapture and happiness.'

Vietnamese AI Translation

Hoặc, bởi vì thiền na này có hỷ và lạc sanh do ly, hoặc bởi vì trong thiền na này có hỷ và lạc sanh do ly, nó cũng là 'sanh do ly, có hỷ và lạc.'

AI Translation Nissaya

assa jhānassa=for this jhana. ; vā=or. ; asmiṃjhāne=in this jhana. ; vivekajaṃ=born of seclusion from the hindrances. ; vā=or born in the jhana factors that are secluded from the hindrances. ; pītisukhaṃ=rapture and happiness. ; atthi=exists. ; iti evampi=For this reason also. ; vivekajaṃpītisukhaṃ=it is 'born of seclusion, with rapture and happiness'. ; hi saccaṃ=Indeed. ;

Myanmar Nissaya

assa jhānassa=အား။ ; vā=ကား။ ; asmiṃjhāne=၌။ ; vivekajaṃ=နီဝရဏတို့၏ ဆိတ်ခြင်းကြောင့်ဖြစ်သော။ ; vā=နီဝရဏတို့မှ ဆိတ်သော ဈာန်တရားတို့၌ဖြစ်သော။ ; pītisukhaṃ=သည်။ ; atthi=၏။ ; iti evampi=ဤသို့သောအကြောင်းကြောင့်လည်း။ ; vivekajaṃpītisukhaṃ=၏။ ; hi saccaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3408 | Chunk: 57

Yatheva hi jhānaṃ, evaṃ pītisukhampettha vivekajameva hoti.

AI Translation based on Nissaya

Indeed, just as the jhana is born of seclusion, so too, in this jhana, the rapture and happiness are born of seclusion.

Vietnamese AI Translation

Thực vậy, cũng như thiền na sanh do ly, thì trong thiền na này, hỷ và lạc cũng sanh do ly.

AI Translation Nissaya

jhānaṃ=The jhana. ; vivekajaṃ=is called 'born of seclusion'. ; hoti yatheva=just as it is. ; evaṃtathā=similarly. ; ettha=in this first jhana. ; pītisukhampi=rapture and happiness also. ; vivekajameva=are only called 'born of seclusion'. ; hoti=they are. ;

Myanmar Nissaya

jhānaṃ=သည်။ ; vivekajaṃ=ဝိဝေကဇ မည်သည်။ ; hoti yatheva=ဖြစ်သကဲ့သို့သာလျှင်။ ; evaṃtathā=တူ။ ; ettha=ဤပဌမဈာန်၌။ ; pītisukhampi=သည်လည်း။ ; vivekajameva=မည်သည်သာလျှင်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3409 | Chunk: 57

Tañcassa atthīti tasmā alopasamāsaṃ katvā ekapadeneva ‘‘vivekajaṃpītisukhan’’ tipi vattuṃ yujjati.

AI Translation based on Nissaya

And that (rapture and happiness) belongs to it. Therefore, forming a bahubbīhi compound with non-elision of the case ending, it is also appropriate to say it as a single term: 'vivekajaṃpītisukhaṃ' (that which has rapture and happiness born of seclusion).

Vietnamese AI Translation

Và cái đó (hỷ và lạc) thuộc về nó. Do đó, tạo thành một hợp từ bahubbīhi với việc không loại bỏ biến cách, cũng thích hợp để nói nó như một thuật ngữ duy nhất: 'vivekajaṃpītisukhaṃ' (cái có hỷ và lạc sanh do ly).

AI Translation Nissaya

assa jhānassa=To this jhana. ; tañca=that rapture and happiness also. ; atthi=belongs. ; iti=Thus. ; (veditabbaṃ=it should be known). ; tasmā=Therefore. ; alopasamāsaṃ=a bahubbīhi compound with non-elision of the first case ending. ; katvā=having formed. ; ekapadeneva=with a single term. ; vivekajaṃ pītisukhantipi=as 'vivekajaṃpītisukhaṃ' also. ; vatthuṃ=to say. ; yujjati=is appropriate. ;

Myanmar Nissaya

assa jhānassa=အား။ ; tañca=ကိုပီတိသုခသည်လည်း။ ; atthi=ရှိ၏။ ; iti=သို့။ ; (veditabbaṃ=၏။) ; tasmā=ကြောင့်။ ; alopasamāsaṃ=ပဌမာဝိဘတ်မကျေသော ဗဟုဗ္ဗီဟိသမာသ်ကို။ ; katvā=၍။ ; ekapadeneva=တစ်ပုဒ်တည်းဖြင့်သာလျှင်။ ; vivekajaṃ pītisukhantipi=ဟူ၍လည်း။ ; vatthuṃ=ဆိုခြင်းငှါ။ ; yujjati=သင့်ပါသတည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3410 | Chunk: 57

Paṭhaman ti gaṇanānupubbatā paṭhamaṃ, paṭhamaṃ uppannantipi paṭhamaṃ.

AI Translation based on Nissaya

As for 'first' (paṭhamaṃ), it is first by way of numerical sequence; it is also first because it is the first to arise.

Vietnamese AI Translation

Về 'sơ' (paṭhamaṃ), nó là thứ nhất theo thứ tự số học; nó cũng là thứ nhất vì nó là cái đầu tiên khởi lên.

AI Translation Nissaya

paṭhamanti=As for 'first'. ; gaṇanānupubbatā=by way of numerical sequence. ; paṭhamaṃ=it is called first. ; paṭhamaṃ=Foremost. ; uppannaṃ=it has arisen. ; ititasmāpi=For this reason also. ; paṭhamaṃ=it is called first. ;

Myanmar Nissaya

paṭhamanti=ကား။ ; gaṇanānupubbatā=အရေအတွက် အစဉ်အားဖြင့်။ ; paṭhamaṃ=မည်၏။ ; paṭhamaṃ=လက်မွန်။ ; uppannaṃ=ဖြစ်သည်တည်း။ ; ititasmāpi=ကြောင့်လည်း။ ; paṭhamaṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3411 | Chunk: 57

Jhānan ti duvidhaṃ jhānaṃ ārammaṇūpanijjhānañca lakkhaṇūpanijjhānañca.

AI Translation based on Nissaya

As for 'jhāna', jhāna is twofold: the jhāna of closely examining an object (ārammaṇūpanijjhāna) and the jhāna of closely examining characteristics (lakkhaṇūpanijjhāna).

Vietnamese AI Translation

Về 'jhāna', thiền na có hai loại: thiền quán xét kỹ đối tượng (ārammaṇūpanijjhāna) và thiền quán xét kỹ các đặc tính (lakkhaṇūpanijjhāna).

AI Translation Nissaya

jhānanti=As for 'jhāna'. ; jhānaṃ=jhāna. ; āramaṇūpanijjhānañca=and the jhāna that closely examines an object. ; vā=or the jhāna that closely contemplates an object such as a kasiṇa. ; lakkhaṇūpanijjhānañca=and the jhāna that closely examines a characteristic. ; vā=or the jhāna that closely contemplates a characteristic such as impermanence. ; iti=thus. ; duvidhaṃ=is twofold. ; hoti=it is. ;

Myanmar Nissaya

jhānanti=ကား။ ; jhānaṃ=သည။ ; āramaṇūpanijjhānañca=လည်းကောင်း။ ; vā=ကသိုဏ်းအစရှိသော အာရုံသို့ ကပ်၍ ရှုတတ်သော ဈာန်လည်းကောင်း။ ; lakkhaṇūpanijjhānañca=လည်းကောင်း။ ; vā=အနိစ္စ အစရှိသော လက္ခဏာသို့ ကပ်၍ ရှုတတ်သော ဈာန် လည်းကောင်း။ ; iti=ဤသို့။ ; duvidhaṃ=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3412 | Chunk: 57

Tattha aṭṭha samāpattiyo pathavīkasiṇādiārammaṇaṃ upanijjhāyantīti ‘‘ārammaṇūpanijjhānan’’ ti saṅkhyaṃ gatā.

AI Translation based on Nissaya

Therein, the eight attainments closely examine an object such as the earth kasina, and so they are designated as 'the jhāna of closely examining an object'.

Vietnamese AI Translation

Trong đó, tám tầng thiền chứng quán xét kỹ một đối tượng như biến xứ đất, và vì vậy chúng được gọi là 'thiền quán xét kỹ đối tượng'.

AI Translation Nissaya

tattha=Between these two. ; aṭṭhasamāpattiyo=the eight attainments. ; pathavīkasiṇādiārammaṇaṃ=an object such as the earth kasiṇa. ; upanijjhāyanti=they closely examine. ; iti tasmā=Therefore. ; ārammaṇūpanijjhānanti=as 'the jhāna of closely examining an object'. ; saṅkhaṃ=to the designation. ; gatā=they have gone. ;

Myanmar Nissaya

tattha=ထိုနှစ်ပါးတို့တွင်။ ; aṭṭhasamāpattiyo=တို့သည်။ ; pathavīkasiṇādiārammaṇaṃ=ပထဝီ ကသိုဏ်းအစရှိသော အာရုံကို။ ; upanijjhāyanti=ကပ်၍ ရှုတတ်ကုန်၏။ ; iti tasmā=ကြောင့်။ ; ārammaṇūpanijjhānanti=ဟူ၍။ ; saṅkhaṃ=သို့။ ; gatā=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3413 | Chunk: 57

Vipassanāmaggaphalāni pana lakkhaṇūpanijjhānaṃ [P1.184] nāma.

AI Translation based on Nissaya

Insight, path, and fruition, however, are called 'the jhāna of closely examining characteristics' [P1.184].

Vietnamese AI Translation

Tuy nhiên, tuệ, đạo và quả được gọi là 'thiền quán xét kỹ các đặc tính' [P1.184].

AI Translation Nissaya

pana=Now, to speak of the jhāna of closely examining a characteristic. ; vipassanāmaggaphalāni=Insight, path, and fruition. ; lakkhaṇūpanijjhānaṃnāma=are called 'the jhāna of closely examining a characteristic'. ;

Myanmar Nissaya

pana=လက္ခဏူပနိဇ္ဈာနကိုဆိုဦးအံ့။ ; vipassanāmaggaphalāni=တို့သည်။ ; lakkhaṇūpanijjhānaṃnāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3414 | Chunk: 57

Tattha vipassanā aniccādilakkhaṇassa upanijjhānato lakkhaṇūpanijjhānaṃ, vipassanāya katakiccassa maggena ijjhanato maggo lakkhaṇūpanijjhānaṃ, phalaṃ pana nirodhasaccaṃ tathalakkhaṇaṃ upanijjhāyatīti lakkhaṇūpanijjhānaṃ.

AI Translation based on Nissaya

Therein, insight is 'the jhāna of closely examining a characteristic' because it closely examines the characteristics of impermanence, etc. The path is 'the jhāna of closely examining a characteristic' because the task performed by insight is completed by the path. As for fruition, it is 'the jhāna of closely examining a characteristic' because it closely examines the unalterable characteristic of the truth of cessation.

Vietnamese AI Translation

Trong đó, tuệ là 'thiền quán xét kỹ một đặc tính' vì nó quán xét kỹ các đặc tính của vô thường, v.v. Đạo là 'thiền quán xét kỹ một đặc tính' vì nhiệm vụ được thực hiện bởi tuệ được hoàn thành bởi đạo. Đối với quả, nó là 'thiền quán xét kỹ một đặc tính' vì nó quán xét kỹ đặc tính bất biến của chân lý về sự diệt.

AI Translation Nissaya

tattha=Among insight, path, and fruition. ; vipassanā=insight. ; anaccādilakkhaṇassa=of the characteristics of impermanence, etc. ; upanijjhānatto=because of closely examining. ; lakkhaṇūpanijjhānaṃ=is called 'the jhāna of closely examining a characteristic'. ; vipassanāya=by insight. ; katakiccassa=of the task performed. ; maggena=by the path. ; ijjhanato=because of the completion. ; maggo=the path. ; lakkhaṇūpanijjhānaṃ=is called 'the jhāna of closely examining a characteristic'. ; phalaṃpana=As for fruition. ; nirodhasaccaṃ=the truth of cessation. ; tathalakkhaṇaṃ=its unalterable characteristic. ; upanijjhāyati=it closely examines. ; iti tasmā=Therefore. ; lakkhaṇūpanijjhānaṃ=it is called 'the jhāna of closely examining a characteristic'. ;

Myanmar Nissaya

tattha=ဝိပဿနာမဂ်ဖိုလ်တို့တွင်။ ; vipassanā=သည်။ ; anaccādilakkhaṇassa=ကို။ ; upanijjhānatto=ကပ်၍ ရတတ်သောကြောင့်။ ; lakkhaṇūpanijjhānaṃ=မည်၏။ ; vipassanāya=သည်။ ; katakiccassa=ပြုသော ကိစ္စ၏။ ; maggena=ဖြင့်။ ; ijjhanato=ပြည့်စုံသောကြောင့်။ ; maggo=သည်။ ; lakkhaṇūpanijjhānaṃ=မည်၏။ ; phalaṃpana=ကား။ ; nirodhasaccaṃ=ကို။ ; tathalakkhanaṃ=မဖောက်ပြန်သော လက္ခဏာကို။ ; upanijjhāyati=ကပ်၍ ရှုတတ်၏။ ; iti tasmā=ကြောင့်။ ; lakkhaṇūpanijjhānaṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3415 | Chunk: 57

Tesu idha pubbabhāge ārammaṇūpanijjhānaṃ, lokuttaramaggakkhaṇe lakkhaṇūpanijjhānaṃ adhippetaṃ, tasmā ārammaṇūpanijjhānato lakkhaṇūpanijjhānato paccanīkajjhāpanato ca ‘‘jhānan’’ ti veditabbaṃ.

AI Translation based on Nissaya

Among these, here in the preliminary part, the jhāna of closely examining an object is intended, while at the moment of the supramundane path, the jhāna of closely examining a characteristic is intended. Therefore, it should be understood as 'jhāna' because it closely examines an object, because it closely examines a characteristic, and because it burns up opposing states.

Vietnamese AI Translation

Trong số này, ở đây trong phần sơ khởi, thiền quán xét kỹ đối tượng được nhắm đến, trong khi vào thời điểm của đạo siêu thế, thiền quán xét kỹ một đặc tính được nhắm đến. Do đó, nó nên được hiểu là 'thiền na' bởi vì nó quán xét kỹ một đối tượng, bởi vì nó quán xét kỹ một đặc tính, và bởi vì nó thiêu đốt các trạng thái đối nghịch.

AI Translation Nissaya

tesu=Among those jhānas. ; idha=here, in the term 'paṭhamaṃ jhānaṃ'. ; pubbabhāge=in the preliminary part of the path. ; ārammaṇūpanijjhānaṃ=the jhāna of closely examining an object. ; adhippetaṃ=is intended. ; lokuttaramaggakkhaṇe=at the moment of the supramundane path. ; lakkhaṇūpanijjhānaṃ=the jhāna of closely examining a characteristic. ; adhippetaṃ=is intended. ; tasmā ārammaṇūpanijjhānatoca=Therefore, because it closely examines an object such as a kasina, and. ; tasmālakkhaṇūpanijjhānatoca=because it closely examines a characteristic such as impermanence, and. ; tasmā paccanīkajjhāpanatoca=because it burns up opposing states such as the hindrances. ; jhānaṃ=it is called 'jhāna'. ; iti=Thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

tesu=ထိုဈာန်တို့တွင်။ ; idha=ဤပထဝီဈာနံဟူသော ပုဒ်၌။ ; pubbabhāge=မဂ်၏ ရှေ့အဖို့၌။ ; ārammaṇūpanijjhānaṃ=ကို။ ; adhippetaṃ=၏။ ; lokuttaramaggakkhaṇe=၌။ ; lakkhaṇūpanijjhānaṃ=ကို။ ; adhippetaṃ=၏။ ; tasmā ārammaṇūpanijjhānatoca=ထိုကသိုဏ်းအစရှိသော အာရုံကို ကပ်၍ ရှုတတ်သောကြောင့် လည်းကောင်း။ ; tasmālakkhaṇūpanijjhānatoca=ထိုသို့အနိစ္စ အစရှိသော လက္ခဏာကို ကပ်၍ ရှုတတ်သောကြောင့်လည်းကောင်း။ ; tasmā paccanīkajjhāpanatoca=ထိုသို့နီဝရဏအစရှိသော ဆန့်ကျင်ဘက်တရားတို့ကို လောင်မြိုက်တတ်သောကြောင့်လည်းကောင်း။ ; jhānaṃ=မည်၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3416 | Chunk: 57

Upasampajjāti upagantvā, pāpuṇitvāti vuttaṃ hoti.

AI Translation based on Nissaya

As for 'upasampajja' (having entered upon), it means 'having approached, having attained.'

Vietnamese AI Translation

Về 'upasampajja' (chứng đắc), nó có nghĩa là 'đã tiếp cận, đã đạt được.'

AI Translation Nissaya

upasampajjāti=As for 'upasampajja'. ; upagantvā pāpuṇitvā=having approached, having attained. ; iti=thus. ; vuttaṃ vutto=it is said. ; hoti=it is. ;

Myanmar Nissaya

upasampajjāti=ကား။ ; upagantvā pāpuṇitvā=ရောက်၍။ ; iti=သို့။ ; vuttaṃ vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3417 | Chunk: 57

Upasampādayitvā vā, nipphādetvāti vuttaṃ hoti.

AI Translation based on Nissaya

Or, it means 'having brought to completion, having produced.'

Vietnamese AI Translation

Hoặc, nó có nghĩa là 'đã đưa đến hoàn mãn, đã tạo ra.'

AI Translation Nissaya

vā=Alternatively. ; upasampadayitvā nipphādetvā=having brought to completion, having produced. ; iti=thus. ; vuttaṃ vutto=it is said. ; hoti=it is. ;

Myanmar Nissaya

vā=ကား။ ; upasampadayitvā nipphādetvā=ပြီးစေ၍။ ; iti=သို့။ ; vuttaṃ vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3418 | Chunk: 57

Viharatīti tadanurūpena iriyāpathavihārena iriyati, vuttappakārajhānasamaṅgī hutvā attabhāvassa vuttiṃ abhinipphādeti.

AI Translation based on Nissaya

As for 'viharati' (dwells), it means one maintains a posture suitable for that state; being endowed with the aforementioned type of jhana, one brings about the continuity of one's personal existence.

Vietnamese AI Translation

Về 'viharati' (an trú), nó có nghĩa là người ta duy trì một tư thế phù hợp với trạng thái đó; được trang bị với loại thiền na đã nói ở trên, người ta tạo ra sự liên tục của sự tồn tại cá nhân của mình.

AI Translation Nissaya

viharatīti=As for 'viharati' (dwells). ; tadanurūpena=in accordance with that attainment of jhana. ; iriyāpathavīhārena=with a posture of dwelling. ; iriyati=one carries on. ; vuttappakārajhānasamaṅgī=endowed with the aforementioned kind of jhana. ; hutvā=being. ; attabhāvassa=of one's being. ; vuttiṃ=the continuance. ; abhinipphādeti=one accomplishes. ;

Myanmar Nissaya

viharatīti=ကား ; tadanurūpena=ထိုဈာန် ဝင်စားခြင်းအားလျော်သော။ ; iriyāpathavīhārena=ဖြင့်။ ; iriyati=နေ၏။ ; vuttappakārajhānasamaṅgī=ဆိုအပ်ပြီးသော အပြားရှိသော ဈာန်နှင့် ပြည့်စုံသည်။ ; hutvā=၍။ ; attabhāvassa=အတ္တဘော၏။ ; vuttiṃ=ပြည့်စုံခြင်းကို။ ; abhinipphādeti=ပြီးစေ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3419 | Chunk: 57

Vitakkavicārānaṃ [M1.171] vūpasamāti ettha vitakkassa ca vicārassa cāti imesaṃ dvinnaṃ vūpasamā samatikkamā, dutiyajjhānakkhaṇe apātubhāvāti vuttaṃ hoti.

AI Translation based on Nissaya

Herein, in the phrase 'from the stilling of thought-conception and discursive thinking' [M1.171], it is said to mean: from the stilling, from the transcending, from the non-manifestation of these two jhana factors at the moment of the second jhana.

Vietnamese AI Translation

Ở đây, trong cụm từ 'do sự lắng dịu của tầm và tứ' [M1.171], nó được nói có nghĩa là: từ sự lắng dịu, từ sự vượt qua, từ sự không biểu hiện của hai thiền chi này vào thời điểm của nhị thiền.

AI Translation Nissaya

vitakkavicārānaṃ vūpasamātiettha=Herein, in the phrase 'from the stilling of thought-conception and discursive thinking'. ; vitakkassaca=of thought-conception and. ; vicārassaca=of discursive thinking. ; iti=thus. ; dvinnaṃ=of the two. ; imesaṃ=of these jhana factors. ; vūpasamā=from the stilling. ; samatikkamā=from the transcending. ; dutiyajjhānakkhaṇe=at the moment of the second jhana. ; apātubhāvā=from their non-manifestation. ; iti=thus. ; vuttaṃ vutto=it is said. ; ho=it is. ;

Myanmar Nissaya

vitakkavicārānaṃ vūpasamātiettha=၌။ ; vitakkassaca=၏လည်းကောင်း။ ; vicārassaca=၏လည်းကောင်း။ ; iti=ဤသို့။ ; dvinnaṃ=ကုန်သော။ ; imesaṃ=ဤဈာနင်တရားတို့၏။ ; vūpasamā=ငြိမ်းခြင်းကြောင့်။ ; samatikkamā=လွန်မြောက်ခြင်းကြောင့်။ ; dutiyajjhānakkhaṇe=ဒုတိယဈာန်ခဏ၌။ ; apātubhāvā=ထင်ရှားမရှိခြင်းကြောင့်။ ; iti=သို့။ ; vuttaṃ vutto=သည်။ ; ho=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3420 | Chunk: 57

Tattha kiñcāpi dutiyajjhāne sabbepi paṭhamajjhānadhammā na santi, aññeyeva hi paṭhamajjhāne phassādayo, aññe idhāti.

AI Translation based on Nissaya

Therein, although none of the mental states of the first jhana are present in the second jhana—for indeed, the contact, etc., in the first jhana are different from the contact, etc., here in the second jhana.

Vietnamese AI Translation

Trong đó, mặc dù không có trạng thái tâm nào của sơ thiền có mặt trong nhị thiền—vì thực vậy, xúc, v.v., trong sơ thiền khác với xúc, v.v., ở đây trong nhị thiền.

AI Translation Nissaya

tattha tasmiṃ dutiyajjhāne=Therein, in that second jhana. ; sabbepi=all. ; paṭhamajjhānadhammā=the states of the first jhana. ; vā=or the states present in the first jhana. ; kiṃñcāpi na santi=are not present, indeed. ; hisaccaṃ=Indeed. ; paṭhamajjhāne=in the first jhana. ; phassādayo=contact and so on. ; aññeyeva=are quite different. ; honti=they are. ; idha=here, in this second jhana. ; phassādayo=contact and so on. ; aññe=are different. ; honti=they are. ; iti=Thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

tattha tasmiṃ dutiyajjhāne=၌။ ; sabbepi=ကုန်သော။ ; paṭhamajjhānadhammā=တရားတို့သည်။ ; vā=ပဌမဈာန်၌ရှိသော တရားတို့သည်။ ; kiṃñcāpi na santi=ကုန်၏ရှင့်။ ; hisaccaṃ=၏။ ; paṭhamajjhāne=၌။ ; phassādayo=တို့သည်။ ; aññeyeva=တပါးတို့သည်သာလျှင်။ ; honti=ကုန်၏။ ; idha=ဤဒုတိယဈာန်၌။ ; phassādayo=တို့သည်။ ; aññe=တပါးတို့သည်။ ; honti=ကုန်၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3421 | Chunk: 57

Oḷārikassa pana oḷārikassa aṅgassa samatikkamā paṭhamajjhānato paresaṃ dutiyajjhānādīnaṃ adhigamo hotīti dassanatthaṃ ‘‘vitakkavicārānaṃ vūpasamā’’ ti evaṃ vuttanti veditabbaṃ [V1.156].

AI Translation based on Nissaya

It should be understood [V1.156] that it is stated this way—'from the stilling of thought-conception and discursive thinking'—in order to show that the attainment of the subsequent second jhana and so on occurs by transcending the grosser and grosser factors of the first jhana.

Vietnamese AI Translation

Nên hiểu rằng [V1.156] nó được nói theo cách này—'do sự lắng dịu của tầm và tứ'—để cho thấy rằng sự chứng đắc nhị thiền và các thiền sau đó xảy ra bằng cách vượt qua các chi phần ngày càng thô của sơ thiền.

AI Translation Nissaya

pana tathāpi=nevertheless. ; oḷārikassa oḷārikassa=of the grosser and grosser. ; aṅgassa=jhana factors. ; samatikkamā=due to the transcending. ; vā=or only after transcending. ; paṭhamajjhānato=from the first jhana. ; paresaṃ=which are subsequent. ; dutiyajjhānādīnaṃ=the second jhana and so on. ; adhigamo=the attainment. ; hoti=occurs. ; iti imassa atthassa=this meaning. ; dassanatthaṃ=in order to show. ; vitakkavicārānaṃ vūpasamāti=as 'from the stilling of thought-conception and discursive thinking'. ; evaṃ=thus. ; vuttaṃ=it was stated. ; iti=Thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

pana tathāpi=ယင်းသို့ တပဲမရှိလင့်ကစား။ ; oḷārikassa oḷārikassa=ရုန့်ရင်း ရုန့်ရင်းသော။ ; aṅgassa=ဈာနင်တို့ကို။ ; samatikkamā=လွန်ခြင်းကြောင့်။ ; vā=လွန်ရမှ။ ; paṭhamajjhānato=မှ။ ; paresaṃ=နောက်ဖြစ်ကုန်သော။ ; dutiyajjhānādīnaṃ=တို့ကို။ ; adhigamo=ရခြင်းသည်။ ; hoti=၏။ ; iti imassa atthassa=ကို။ ; dassanatthaṃ=ငှါ။ ; vitakkavicārānaṃ vūpasamāti=ဟူ၍။ ; evaṃ=ဤသို့။ ; vuttaṃ=ဟောတော်မူအပ်၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3422 | Chunk: 57

Ajjhattan ti idha niyakajjhattaṃ adhippetaṃ, tasmā attani jātaṃ, attasantāne nibbattanti attho.

AI Translation based on Nissaya

As for 'internal' (ajjhattaṃ), here one's own internality is intended. Therefore, the meaning is 'born in oneself,' 'produced in one's own mental continuum.'

Vietnamese AI Translation

Về 'nội' (ajjhattaṃ), ở đây nội tại của chính mình được nhắm đến. Do đó, ý nghĩa là 'sanh ra trong chính mình,' 'được tạo ra trong dòng tâm thức của chính mình.'

AI Translation Nissaya

ajjhattanti=As for 'ajjhattaṃ' (internal). ; idha=here in this context. ; niyakajjhattaṃ=one's own internality. ; adhippetaṃ=is intended. ; tasmā=Therefore. ; attani=in oneself. ; jātaṃ=it is born. ; attasantāne=in one's own continuity. ; nibbattaṃ=it is produced. ; itiayaṃ=This. ; attho=is the meaning. ;

Myanmar Nissaya

ajjhattanti=ကား။ ; idha=ဤအရာ၌။ ; niyakajjhattaṃ=ကို။ ; adhippetaṃ=၏။ ; tasmā=ကြောင့်။ ; attani=မိမိ၌။ ; jātaṃ=ဖြစ်သည်တည်း။ ; attasantāne=မိမိသန္တာန်၌။ ; nibbattaṃ=ဖြစ်သည်တည်း။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3423 | Chunk: 57

Sampasādanan ti sampasādanaṃ vuccati saddhā.

AI Translation based on Nissaya

As for 'sampasādanaṃ' (serenity), faith is called 'sampasādanaṃ.'

Vietnamese AI Translation

Về 'sampasādanaṃ' (sự tĩnh lặng), tín được gọi là 'sampasādanaṃ.'

AI Translation Nissaya

sampasādananti=As for 'sampasādanaṃ' (serenity, confidence). ; saddhā=the mental factor of faith. ; sampasādanaṃ=as 'sampasādanaṃ'. ; vuccati=is called. ;

Myanmar Nissaya

sampasādananti=ကား။ ; saddhā=သဒ္ဓါစေတသိက်ကို။ ; sampasādanaṃ=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3424 | Chunk: 57

Sampasādanayogato jhānampi sampasādanaṃ nīlavaṇṇayogato nīlavatthaṃ viya.

AI Translation based on Nissaya

Just as a cloth is called a 'blue cloth' because of its connection with the color blue, so too the jhana is called 'sampasādanaṃ' (serenity) because of its connection with faith.

Vietnamese AI Translation

Cũng như một tấm vải được gọi là 'vải xanh' vì sự liên hệ của nó với màu xanh, thì thiền na cũng được gọi là 'sampasādanaṃ' (sự tĩnh lặng) vì sự liên hệ của nó với tín.

AI Translation Nissaya

nīlavaṇṇayogato=due to its connection with the color blue. ; nīlavatthaṃviya=just as a cloth is called a blue cloth. ; sampasādanayogato=due to its connection with the mental factor of faith. ; jhānampi=the jhana also. ; sampasādanaṃ=as 'sampasādanaṃ'. ; vuccati=is called. ;

Myanmar Nissaya

nīlavaṇṇayogato=ညိုသောအဆင်းနှင့် ယှဉ်ခြင်းကြောင့်။ ; nīlavatthaṃviya=ပုဆိုးညိုဟု ဆိုအပ်သကဲ့သို့။ ; sampasādanayogato=သဒ္ဓါစေတသိက်နှင့်ယှဉ်ခြင်းကြောင့်။ ; jhānampi=ကိုလည်း။ ; sampasādanaṃ=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3425 | Chunk: 57

Yasmā vā taṃ jhānaṃ sampasādanasamannāgatattā vitakkavicārakkhobhavūpasamanena ca ceto sampasādayati, tasmāpi sampasādananti vuttaṃ.

AI Translation based on Nissaya

Or, because that jhana, being endowed with faith and through the calming of the disturbance of thought-conception and discursive thinking, clarifies the mind, for this reason also it is called 'sampasādanaṃ' (serenity).

Vietnamese AI Translation

Hoặc, bởi vì thiền na đó, được phú bẩm với tín và thông qua sự lắng dịu của sự xáo trộn của tầm và tứ, làm trong sáng tâm trí, vì lý do này nó cũng được gọi là 'sampasādanaṃ' (sự tĩnh lặng).

AI Translation Nissaya

vā=Alternatively. ; yasmā=because. ; taṃjhānaṃ=that second jhana. ; sampasādanasamannāgatattā=due to being endowed with faith. ; vitakkavicārakkhobhavūpasamanenaca=and through the calming of the disturbance of thought-conception and discursive thinking. ; ceto=the jhanic mind. ; sampasādayati=it clarifies. ; tasmāpi=for this reason also. ; sampasādananti=as 'sampasādanaṃ'. ; vuttaṃ=it is said. ;

Myanmar Nissaya

vā=ကား။ ; yasmā=ကြောင့်။ ; taṃjhānaṃ=ထိုဒုတိယဈာန်သည်။ ; sampasādanasamannāgatattā=သဒ္ဓါစေတသိက်နှင့် ပြည့်စုံသည်၏အဖြစ်ကြောင့်။ ; vitakkavicārakkhobhavūpasamanenaca=ဝိတက် ဝိစာရတို့၏ ချောက်ချားခြင်းမှ ငြိမ်းသဖြင့်လည်း။ ; ceto=ဈာန်စိတ်ကို။ ; sampasādayati=ကြည်စေ၏။ ; tasmāpi=ကြောင့်လည်း။ ; sampasādananti=ဟူ၍။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3426 | Chunk: 57

Imasmiñca atthavikappe sampasādanaṃ cetasoti evaṃ padasambandho veditabbo, purimasmiṃ pana atthavikappe cetasoti etaṃ ekodibhāvena saddhiṃ yojetabbaṃ.

AI Translation based on Nissaya

In this alternative meaning, the connection of the words should be understood as 'that which clarifies the mind' (sampasādanaṃ cetaso). In the former alternative meaning, however, the word 'cetaso' should be connected with 'ekodibhāvaṃ'.

Vietnamese AI Translation

Trong ý nghĩa thay thế này, sự kết nối của các từ nên được hiểu là 'cái làm trong sáng tâm trí' (sampasādanaṃ cetaso). Tuy nhiên, trong ý nghĩa thay thế trước đó, từ 'cetaso' nên được kết nối với 'ekodibhāvaṃ'.

AI Translation Nissaya

ca=Further. ; imasmiṃ atthavikappe=in this alternative meaning. ; cetaso=of the mind. ; sampasādanaṃ=that which clarifies. ; itievaṃ=thus. ; padasambandho=the connection of the words. ; veditabbo=should be understood. ; pana=However. ; purimasmiṃ=in the former. ; atthavikappe=alternative meaning. ; cetaso tietaṃpadaṃ=the word 'cetaso'. ; ekodibhāvena=with the word 'ekodibhāva'. ; saddhiṃ=together. ; yojetabbaṃ=should be connected. ;

Myanmar Nissaya

ca=ဆက်။ ; imasmiṃ atthavikappe=ထိုအတ္တဝိကပ်၌။ ; cetaso=စိတ်ကို။ ; sampasādanaṃ=ကြည်စေတတ်သော။ ; itievaṃ=ဤသို့။ ; padasambandho=ပုဒ်၏ စပ်ခြင်းကို။ ; veditabbo=၏။ ; pana=ထိုမှတစ်ပါး။ ; purimasmiṃ=ရှေ့ဖြစ်သော။ ; atthavikappe=၌။ ; cetaso tietaṃpadaṃ=ပုဒ်ကို။ ; ekodibhāvena=ဧကောဒိဘာဝ ဟူသော ပုဒ်နှင့်။ ; saddhiṃ=တကွ။ ; yojetabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3427 | Chunk: 57

Tatrāyaṃ atthayojanā – eko udetīti ekodi , vitakkavicārehi anajjhārūḷhattā aggo seṭṭho hutvā udetīti attho.

AI Translation based on Nissaya

In that regard, this is the application of the meaning: 'Eko udeti' means it arises as 'one' (eko); therefore it is 'ekodi'. The meaning is that, because it is not overwhelmed by thought-conception and discursive thinking, it arises as foremost and excellent.

Vietnamese AI Translation

Về vấn đề đó, đây là ứng dụng của ý nghĩa: 'Eko udeti' có nghĩa là nó khởi lên như là 'một' (eko); do đó nó là 'ekodi'. Ý nghĩa là, bởi vì nó không bị lấn át bởi tầm và tứ, nó khởi lên như là hàng đầu và xuất sắc.

AI Translation Nissaya

tatra=In that connection. ; ayaṃ=this which will be stated. ; atthayojanā=is the explanation of the meaning. ; eko=excellent. ; (hutvā=being). ; udeti=it arises. ; ititasmā=Therefore. ; ekodi=it is 'ekodi'. ; vitakkavicārehi=by thought-conception and discursive thinking. ; anajjhārūḷhattā=due to not being overcome. ; aggo seṭṭho=excellent, supreme. ; hutvā=being. ; udeti=it arises. ; itiayaṃ=This. ; attho=is the meaning. ;

Myanmar Nissaya

tatra=ထိုယှဉ်ရာ စပ်ရာ၌။ ; ayaṃ=ဤဆိုလတ္တံ့သည်ကား။ ; atthayojanā=အနက်အားဖြင့် ယှဉ်ခြင်းတည်း။ ; eko=မြတ်သည်။ ; (hutvā=၍။) ; udeti=ဖြစ်တတ်၏။ ; ititasmā=ကြောင့်။ ; ekodi=မည်၏။ ; vitakkavicārehi=တို့သည်။ ; anajjhārūḷhattā=မလွမ်းမိုးအပ်သည်၏ အဖြစ်ကြောင့်။ ; aggo seṭṭho=မြတ်သည်။ ; hutvā=၍။ ; udeti=ဖြစ်တတ်၏။ ; itiayaṃ=ဤသည်ကား။ ; attho=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3428 | Chunk: 57

Seṭṭhopi hi loke ekoti vuccati.

AI Translation based on Nissaya

Indeed, in the world, that which is excellent is also called 'one' (eko).

Vietnamese AI Translation

Thật vậy, trên thế gian, cái gì xuất sắc cũng được gọi là 'một' (eko).

AI Translation Nissaya

hi saccaṃ=Indeed. ; seṭṭhopi=that which is excellent. ; loke=in the world. ; ekoti=as 'eko' (one/unique). ; vuccati=is called. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; seṭṭhopi=မြတ်သည်ကိုလည်း။ ; loke=လူ့ရွာ၌။ ; ekoti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3429 | Chunk: 57

Vitakkavicāravirahito vā eko asahāyo hutvā itipi vattuṃ vaṭṭati.

AI Translation based on Nissaya

Alternatively, it is fitting to say that being devoid of thought-conception and discursive thinking, it is 'one,' without a companion.

Vietnamese AI Translation

Hoặc cách khác, thích hợp để nói rằng vì không có tầm và tứ, nó là 'một', không có bạn đồng hành.

AI Translation Nissaya

vā=Alternatively. ; vitakkavicāravirahito=devoid of thought-conception and discursive thinking. ; hutvā=being. ; eko asahāyo=one, without a companion. ; hutvā=being. ; itipi=thus also. ; vattuṃ=to say. ; vaṭṭati=is fitting. ;

Myanmar Nissaya

vā=ကား။ ; vitakkavicāravirahito=ဝိတက် ဝိစာရမှ ကင်းသည်။ ; hutvā=၍။ ; eko asahāyo=အဖေါ်ကင်းသည်။ ; hutvā=၍။ ; itipi=ဤသို့လည်း။ ; vattuṃ=ဆိုခြင်းငှါ။ ; vaṭṭati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3430 | Chunk: 57

Atha vā sampayuttadhamme udāyatīti udi, uṭṭhapetīti attho.

AI Translation based on Nissaya

Alternatively, 'udi' means 'it causes associated states to arise' (udāyati); this is the meaning.

Vietnamese AI Translation

Hoặc cách khác, 'udi' có nghĩa là 'nó làm cho các trạng thái tương ưng khởi lên' (udāyati); đây là ý nghĩa.

AI Translation Nissaya

athavā=Alternatively. ; sampayuttadhamme=associated states. ; udāyati=it causes to arise. ; iviayaṃ=this. ; attho=is the meaning. ;

Myanmar Nissaya

athavā=ကား။ ; sampayuttadhamme=တို့ကို။ ; udāyati=ဖြစ်စေတတ်၏။ ; iviayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3431 | Chunk: 57

Seṭṭhaṭṭhena eko ca so [P1.185] udi cāti ekodi.

AI Translation based on Nissaya

It is 'eka' [P1.185] in the sense of being excellent, and it is 'udi' because it causes associated states to arise; thus it is 'ekodi'.

Vietnamese AI Translation

Nó là 'eka' [P1.185] theo nghĩa là xuất sắc, và nó là 'udi' vì nó làm cho các trạng thái tương ưng khởi lên; do đó nó là 'ekodi'.

AI Translation Nissaya

seṭṭhaṭṭhena=due to the meaning of 'excellent'. ; ekoca=it is 'eka' and. ; vā=or 'excellent'. ; vā=or 'without the companion of thought-conception and discursive thinking'. ; hoti=it is. ; so=That 'eka'. ; udica=also causes associated states to arise. ; hoti=it is. ; ititasmā=Therefore. ; ekodi=it is 'ekodi'. ;

Myanmar Nissaya

seṭṭhaṭṭhena=မြတ်သောအနက်ကြောင့်။ ; ekoca=ဧက မည်သည်လည်း။ ; vā=မြတ်သည်လည်း။ ; vā=ဝိတက် ဝိစာရတည်းဟူသောအဖော်ကင်းသည်လည်း။ ; hoti=၏။ ; so=ထိုဧကဟူသည်။ ; udica=သမ္ပယုတ်တရားတို့ကို ဖြစ်စေတတ်သည်လည်း။ ; hoti=၏။ ; ititasmā=ကြောင့်။ ; ekodi=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3432 | Chunk: 57

Samādhissetaṃ adhivacanaṃ.

AI Translation based on Nissaya

This is a synonym for concentration.

Vietnamese AI Translation

Đây là một từ đồng nghĩa với định.

AI Translation Nissaya

etaṃ=This term 'ekodi'. ; samādhissa=of concentration. ; adhivacanaṃ=is a designation. ;

Myanmar Nissaya

etaṃ=ထိုဧကောဒိ ဟူသောအမည်သည်။ ; samādhissa=သမာဓိ၏။ ; adhivacanaṃ=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3433 | Chunk: 57

Iti imaṃ ekodiṃ bhāveti vaḍḍhetīti idaṃ dutiyaṃ jhānaṃ ekodibhāvaṃ.

AI Translation based on Nissaya

Thus, this second jhana 'develops this one-pointedness' (imaṃ ekodiṃ bhāveti); therefore, it is 'ekodibhāvaṃ'.

Vietnamese AI Translation

Do đó, nhị thiền này 'phát triển sự nhất tâm này' (imaṃ ekodiṃ bhāveti); do đó, nó là 'ekodibhāvaṃ'.

AI Translation Nissaya

iti=Thus. ; imaṃ ekodiṃ=this concentration. ; bhāveti vaḍḍheti=it develops, it increases. ; iti tasmā=Therefore. ; idaṃ dutiyaṃ jhānaṃ=this second jhana. ; ekodibhāvaṃ=is 'ekodibhāvaṃ' (the developing of one-pointedness). ;

Myanmar Nissaya

iti=သို့။ ; imaṃ ekodiṃ=ဤသမာဓိကို။ ; bhāveti vaḍḍheti=ပွားစေ၏။ ; iti tasmā=ကြောင့်။ ; idaṃ dutiyaṃ jhānaṃ=ဤဒုတိယဈာန်သည်။ ; ekodibhāvaṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3434 | Chunk: 57

So panāyaṃ ekodi yasmā cetaso, na sattassa na jīvassa.

AI Translation based on Nissaya

Now, this one-pointedness belongs to the mind (cetaso), not to a being (satta) or a soul (jīva).

Vietnamese AI Translation

Bây giờ, sự nhất tâm này thuộc về tâm (cetaso), không phải của một chúng sinh (satta) hay một linh hồn (jīva).

AI Translation Nissaya

pana=Now, to state the reason for saying 'cetaso'. ; so ayaṃ ekodi=That one-pointedness. ; yasmā=because. ; cetaso=of the mind. ; ekodi=it is the excellent concentration. ; sattassa=of a being. ; ekodi=the one-pointedness. ; na=it is not. ; jīvassa=of a soul. ; ekodi=the one-pointedness. ; na=it is not. ;

Myanmar Nissaya

pana=စေတသော ဟူသော သမ္ဗန်ပုဒ်ကို ဟောခြင်း၏ အကြောင်းကိုဆိုအံ့။ ; so ayaṃ ekodi=ထိုသမာဓိသည်။ ; yasmā=ကြောင့်။ ; cetaso=စိတ်၏။ ; ekodi=မြတ်သော သမာဓိတည်း။ ; sattassa=သတ္တဝါ၏။ ; ekodi=သည်။ ; na=မဟုတ်။ ; jīvassa=ဇီဝ၏။ ; ekodi=သည်။ ; na=မဟုတ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3435 | Chunk: 57

Tasmā etaṃ ‘‘cetaso ekodibhāvan’’ ti vuttaṃ.

AI Translation based on Nissaya

Therefore it is stated as 'cetaso ekodibhāvaṃ' (the unification of mind).

Vietnamese AI Translation

Do đó nó được nói là 'cetaso ekodibhāvaṃ' (sự nhất tâm của tâm).

AI Translation Nissaya

tasmā=Therefore. ; etaṃ=this second jhana. ; cetaso=of the mind. ; ekodibhāvaṃ=develops the excellent concentration. ; iti=thus. ; vuttaṃ=it is said. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; etaṃ=ဤဒုတိယဈာန်သည်။ ; cetaso=စိတ်၏။ ; ekodibhāvaṃ=မြတ်သော သမာဓိကိုပွားစေအပ်၏။ ; iti=သို့။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3436 | Chunk: 57

Nanu cāyaṃ saddhā paṭhamajjhānepi atthi, ayañca ekodināmako samādhi.

AI Translation based on Nissaya

But is not this faith present also in the first jhana? And is not this concentration called 'ekodi' also present?

Vietnamese AI Translation

Nhưng chẳng phải tín này cũng có mặt trong sơ thiền sao? Và chẳng phải định này được gọi là 'ekodi' cũng có mặt sao?

AI Translation Nissaya

nanu ca codemi=Now, I object. ; ayaṃ saddhā=This faith. ; paṭhamajjhānepi=in the first jhana also. ; atthananu=is it not present?. ; eko dināmako=named 'ekodi'. ; ayañca samādhi=this concentration also. ; atthi nanu=is it not present?. ;

Myanmar Nissaya

nanu ca codemi=အံ့။ ; ayaṃ saddhā=သည်။ ; paṭhamajjhānepi=၌လည်း။ ; atthananu=ရှိသည် မဟုတ်တုံလော။ ; eko dināmako=ဧကောဒိအမည်ရှိသော။ ; ayañca samādhi=သည်လည်း။ ; atthi nanu=လော။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3437 | Chunk: 57

Atha kasmā idameva ‘‘sampasādanaṃ cetaso ekodibhāvan’’ ti ca vuttanti ?

AI Translation based on Nissaya

Why, then, is only this jhana called 'serenity and unification of mind'?'

Vietnamese AI Translation

Vậy thì, tại sao chỉ có thiền na này được gọi là 'sự tĩnh lặng và sự nhất tâm của tâm'?'

AI Translation Nissaya

atha=If it is so present. ; kasmā=why then. ; idameva=only this second jhana. ; sampasādanaṃ cetaso ekodibhāvanti=as 'serenity and unification of mind'. ; vuttaṃ=is it called?. ; itiayaṃ=This. ; codanā=is the objection. ; parihāro=The reply. ; mayā=by me. ; vuccate=will be stated. ;

Myanmar Nissaya

atha=ထိုသို့ ရှိသည်ဖြစ်လျှင်။ ; kasmā=မူ၍။ ; idameva=ဤဒုတိယဈာန်ကိုသာလျှင်။ ; sampasādanaṃ cetaso ekodibhāvanti=ဟူ၍။ ; vuttaṃ=သနည်း။ ; itiayaṃ=ကား။ ; codanā=တည်း။ ; parihāro=ကို။ ; mayā=သည်။ ; vuccate=အံ့။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3438 | Chunk: 57

Vuccate – aduñhi paṭhamajjhānaṃ vitakkavicārakkhobhena vīcitaraṅgasamākulamiva jalaṃ na suppasannaṃ hoti, tasmā satiyāpi saddhāya ‘‘sampasādanan’’ ti na vuttaṃ.

AI Translation based on Nissaya

The reply is: Because that first jhana is not perfectly serene, like water agitated by the waves and ripples of the disturbance of thought-conception and discursive thinking. Therefore, even though faith is present, it is not called 'serenity'.

Vietnamese AI Translation

Câu trả lời là: Bởi vì sơ thiền đó không hoàn toàn tĩnh lặng, giống như nước bị khuấy động bởi những con sóng và gợn sóng của sự xáo trộn của tầm và tứ. Do đó, mặc dù tín có mặt, nó không được gọi là 'sự tĩnh lặng'.

AI Translation Nissaya

hi yasmā=Because. ; aduṃ paṭhamajjhānaṃ=that first jhana. ; viitakkavicārakkhobhena=due to the disturbance of thought-conception and discursive thinking. ; vīcitaraṅgasamākulaṃ=agitated by waves and ripples. ; jalaṃ=water. ; suppasannaṃ=is perfectly serene. ; na hoti iva=just as it is not. ; suppasannaṃ=perfectly serene. ; nahoti=it is not. ; tasmā=Therefore. ; saddhāya=faith. ; satiyāpi=even though being present. ; sampasādananti=as 'serenity'. ; na vuttaṃ=it is not called. ;

Myanmar Nissaya

hi yasmā=ကြောင့်။ ; aduṃ paṭhamajjhānaṃ=သည်။ ; viitakkavicārakkhobhena=ဝိတက် ဝိစာရတို့၏ ချောက်ချားခြင်းကြောင့်။ ; vīcitaraṅgasamākulaṃ=လှိုင်းတံပိုးတို့ဖြင့် ပြွမ်းသော။ ; jalaṃ=ရေသည်။ ; suppasannaṃ=ကောင်းစွာ ကြည်သည်။ ; na hoti iva=ကဲ့သို့။ ; suppasannaṃ=သည်။ ; nahoti=မဖြစ်။ ; tasmā=ကြောင့်။ ; saddhāya=သည်။ ; satiyāpi=ရှိလျှင်မူလည်း။ ; sampasādananti=ဟူ၍။ ; na vuttaṃ=အပ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3439 | Chunk: 57

Na suppasannattāyeva cettha samādhipi na suṭṭhu pākaṭo.

AI Translation based on Nissaya

And because it is not perfectly serene, concentration is also not very manifest therein.

Vietnamese AI Translation

Và bởi vì nó không hoàn toàn tĩnh lặng, định cũng không biểu hiện rõ ràng trong đó.

AI Translation Nissaya

ca=Furthermore. ; ettha=in this first jhana. ; na suppasannattāyeva=precisely because of the lack of perfect serenity of the faith faculty. ; samādhipi=concentration also. ; suṭṭhu=well. ; pākaṭo=manifest. ; nahoti=is not. ;

Myanmar Nissaya

ca=အံ့။ ; ettha=ဤပဌမဈာ်၌။ ; na suppasannattāyeva=သဒ္ဓါ စေတသိက်၏ ကောင်းစွာ မကြည်သည်၏ အဖြစ်ကြောင့်သာလျှင်။ ; samādhipi=သည်လည်း။ ; suṭṭhu=ကောင်းစွာ။ ; pākaṭo=သည်။ ; nahoti=မဖြစ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3440 | Chunk: 57

Tasmā ‘‘ekodibhāvan’’ tipi na vuttaṃ.

AI Translation based on Nissaya

Therefore it is not called 'unification of mind' either.

Vietnamese AI Translation

Do đó nó cũng không được gọi là 'sự nhất tâm của tâm'.

AI Translation Nissaya

tasmā=Therefore. ; ekodibhāvantipi=as 'unification of mind' also. ; na vuttaṃ=it is not called. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; ekodibhāvantipi=ဟူ၍လည်း။ ; na vuttaṃ=မဟောအပ်သတည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3441 | Chunk: 57

Imasmiṃ pana jhāne vitakkavicārapalibodhābhāvena laddhokāsā balavatī saddhā, balavasaddhāsahāyapaṭilābheneva ca samādhipi pākaṭo, tasmā idameva evaṃ vuttanti veditabbaṃ.

AI Translation based on Nissaya

In this jhana, however, due to the absence of the obstruction of thought-conception and discursive thinking, faith finds its opportunity and becomes strong. And precisely by gaining strong faith as its ally, concentration also becomes manifest. Therefore, it should be understood that only this jhana is described in this way.

Vietnamese AI Translation

Tuy nhiên, trong thiền na này, do sự vắng mặt của sự cản trở của tầm và tứ, tín tìm thấy cơ hội và trở nên mạnh mẽ. Và chính xác bằng cách có được tín mạnh mẽ làm đồng minh, định cũng trở nên biểu hiện. Do đó, nên hiểu rằng chỉ có thiền na này được mô tả theo cách này.

AI Translation Nissaya

pana=Now, to state the reason for speaking of it. ; imasmiṃ jhāne=in this second jhana. ; vitakkavicārapalibodhābhāvena=due to the absence of the obstruction of thought-conception and discursive thinking. ; saddhā=faith. ; laddhokāsā=has found its opportunity. ; hutvā=and having. ; balavatī=is strong. ; hoti=it is. ; ca=Now, to speak of concentration. ; balavasaddhā sahāyapaṭilābheneva=precisely by gaining a powerful faith as its ally. ; samādhipi=concentration also. ; pākaṭo=is manifest. ; tasmā=Therefore. ; idameva=only this second jhana. ; evaṃ=thus, as 'sampasādanaṃ cetaso ekodibhāvaṃ'. ; vuttaṃ=is called. ; iti=Thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

pana=ဟောခြင်း၏ အကြောင်းကို ဆိုအံံ။ ; imasmiṃ jhāne=ဤဒုတိယဈာန်၌။ ; vitakkavicārapalibodhābhāvena=ဝိတက် ဝိစာရတို့ဖြင့် ကြောင့်ကြခြင်းမရှိသည်၏ အဖြစ်ကြောင့်။ ; saddhā=သည်။ ; laddhokāsā=ရှိသည်။ ; hutvā=၍။ ; balavatī=အားရှိသည်။ ; hoti=၏။ ; ca=သမာဓိကို ဆိုဦးအံ့။ ; balavasaddhā sahāyapaṭilābheneva=အားရှိသော သဒ္ဓါစေတသိက်တည်းဟူသော သဟဲကို ရခြင်းကြောင့်သာလျှင်။ ; samādhipi=သည်လည်း။ ; pākaṭo=၏။ ; tasmā=ကြောင့်။ ; idameva=ဤဒုတိယဈာန်ကိုသာလျှင်။ ; evaṃ=ဤသို့ သမ္ပသာဒနံ စေတသော ဧကောဒိဘာဝံ ဟူ၍။ ; vuttaṃ=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3442 | Chunk: 57

Avitakkaṃ [M1.172] avicāran ti bhāvanāya pahīnattā etasmiṃ, etassa vā vitakko natthīti avitakkaṃ.

AI Translation based on Nissaya

As for 'without thought-conception' [M1.172] and 'without discursive thinking': because thought-conception has been abandoned for it by means of development, it has no thought-conception; therefore it is 'without thought-conception' (avitakkaṃ).

Vietnamese AI Translation

Về 'không có tầm' [M1.172] và 'không có tứ': bởi vì tầm đã được từ bỏ đối với nó bằng phương tiện phát triển, nó không có tầm; do đó nó là 'không có tầm' (avitakkaṃ).

AI Translation Nissaya

avitakkaṃ avicāranti=In the phrase 'without thought-conception, without discursive thinking'. ; (avayavattho=The analysis of the components. ; evaṃ=thus. ; veditabbo=should be understood.) ; etasmiṃ=in that second jhana. ; vā=or. ; etassa=for that second jhana. ; bhāvanāya=by development. ; vā=or. ; pahīnatthā=because of being abandoned. ; vitakko=thought-conception. ; natthi=is not. ; ititasmā=Therefore. ; avitakkaṃ=it is 'avitakkaṃ' (without thought-conception). ;

Myanmar Nissaya

avitakkaṃ avicāranti=ဟူသော ပုဒ်၌။ ; (avayavattho=ကို။ ; evaṃ=သို့။ ; veditabbo=၏။) ; etasmiṃ=ထိုဒုတိယဈာန်၌။ ; vā=ကား။ ; etassa=ထိုဒုတိယဈာန်အား။ ; bhāvanāya=၏။ ; vā=သည်။ ; pahīnatthā=ပယ်အပ်သည် ၏ အဖြစ်ကြောင့်။ ; vitakko=သည်။ ; natthi=မရှိ။ ; ititasmā=ကြောင့်။ ; avitakkaṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3443 | Chunk: 57

Imināva nayena avicāraṃ.

AI Translation based on Nissaya

By the same method, it is 'without discursive thinking' (avicāraṃ).

Vietnamese AI Translation

Bằng phương pháp tương tự, nó là 'không có tứ' (avicāraṃ).

AI Translation Nissaya

imināva nayena=By this same method. ; avicāraṃ=it is 'avicāraṃ' (without discursive thinking). ;

Myanmar Nissaya

imināva nayena=ဖြင့်သာလျှင်။ ; avicāraṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3444 | Chunk: 57

Etthāha –

AI Translation based on Nissaya

Herein, an objection is raised:

Vietnamese AI Translation

Ở đây, một sự phản đối được nêu ra:

AI Translation Nissaya

ettha=Here. ; (codako=the objector. ; ṭhatvā=standing. ; āha=said). ;

Myanmar Nissaya

ettha=ဤအရာ၌။ ; (codako=သည်။ ; ṭhatvā=ရပ်တန့်၍။) ; āha=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3445 | Chunk: 57

‘‘nanu ca ‘ vitakkavicārānaṃ vūpasamā ’ ti imināpi ayamattho siddho.

AI Translation based on Nissaya

'Is not this meaning already established by the phrase 'from the stilling of thought-conception and discursive thinking'?

Vietnamese AI Translation

'Chẳng phải ý nghĩa này đã được xác lập bởi cụm từ 'do sự lắng dịu của tầm và tứ' sao?

AI Translation Nissaya

kiṃ āha=What was said?. ; nanu ca codemi=Now, I object. ; vitakkavicārānaṃ vūpasamāti imināpi=by this phrase 'from the stilling of thought-conception and discursive thinking' also. ; ayaṃ attho=this meaning, that there is no thought-conception or discursive thinking in the second jhana. ; siddho nanu=is it not already established?. ;

Myanmar Nissaya

kiṃ āha=ကား။ ; nanu ca codemi=အံ့။ ; vitakkavicārānaṃ vūpasamāti imināpi=ဟူသော ပါဌ်ဖြင့်လည်း။ ; ayaṃ attho=ဒုတိယဈာန်၌ ဝိတက် ဝိစာရ မရှိဟူသော အနက်သည်။ ; siddho nanu=ပြီးပြီးသည် မဟုတ်တုံလော။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3446 | Chunk: 57

Atha kasmā puna vuttaṃ ‘ avitakkaṃ avicāran ’ ti’’ ?

AI Translation based on Nissaya

Why then is it stated again, 'without thought-conception, without discursive thinking'?'

Vietnamese AI Translation

Vậy tại sao nó lại được nêu một lần nữa, 'không có tầm, không có tứ'?'

AI Translation Nissaya

atha=If so. ; kasmā=why then. ; puna=again. ; avitakkaṃ avicāranti=as 'without thought-conception, without discursive thinking'. ; vuttaṃnanu=is it stated?. ; iti=Thus. ; codako=the objector. ; āha=said. ; (parihāro=The reply. ; mayā=by me.) ; vuccate=will be stated. ;

Myanmar Nissaya

atha=လျက်။ ; kasmā=မူ၍။ ; puna=နောက်ပြီးတဖန်။ ; avitakkaṃ avicāranti=ဟူ၍။ ; vuttaṃnanu=ဟောပြန်လေဘိသနည်း။ ; iti=ဤသို့။ ; codako=သည်။ ; āha=၏။ ; (parihāro=ကို။ ; mayā=သည်။) ; vuccate=အံ့။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3447 | Chunk: 57

Vuccate – evametaṃ, siddhovāyamattho, na panetaṃ tadatthadīpakaṃ, nanu avocumha ‘‘oḷārikassa [V1.157] pana oḷārikassa aṅgassa samatikkamā paṭhamajjhānato paresaṃ dutiyajjhānādīnaṃ samadhigamo hotīti dassanatthaṃ vitakkavicārānaṃ vūpasamāti evaṃ vuttan’’ ti.

AI Translation based on Nissaya

The reply is: It is as you say. This meaning is indeed established, but that phrase is not what clarifies that meaning. Did we not [V1.157] say, 'it is stated this way in order to show that the attainment of the subsequent jhanas... occurs by transcending the grosser... factors'?

Vietnamese AI Translation

Câu trả lời là: Đúng như ngài nói. Ý nghĩa này thực sự đã được xác lập, nhưng cụm từ đó không phải là cái làm rõ ý nghĩa đó. Chẳng phải chúng tôi đã nói [V1.157], 'nó được nói theo cách này để cho thấy rằng sự chứng đắc của các thiền na tiếp theo... xảy ra bằng cách vượt qua các chi phần... thô hơn' sao?

AI Translation Nissaya

etaṃ=This statement of the objector. ; evaṃ=is as stated. ; hoti=it is. ; ayaṃ attho=This meaning, that there is no thought-conception or discursive thinking in the second jhana. ; siddhova=is indeed established. ; pana tathāpi=However. ; evaṃ vacanaṃ=this phrase 'vitakkavicārānaṃ vūpasamā'. ; tadatthadīpakaṃ=that which clarifies that meaning. ; na hoti=it is not. ; oḷārikassa.la. evaṃ vuttanti=as 'oḷārikassa... evaṃ vuttaṃ'. ; mayaṃ=we. ; avocumha nanu=did we not say?. ;

Myanmar Nissaya

etaṃ=ဤစောဒကဆရာတို့၏စကားသည်။ ; evaṃ=ဆိုတိုင်း။ ; hoti=၏။ ; ayaṃ attho=ဤဒုတိယဈာန်၌ ဝိတက် ဝိစာရ မရှိဟူသော အနက်သည်။ ; siddhova=ပြီးသည်သာလျှင်တည်း။ ; pana tathāpi=သော်လည်း။ ; evaṃ vacanaṃ=ဤဝိတက္ကဝိစာရာနံ ဝူပသမာ ဟူသော စကားသည်။ ; tadatthadīpakaṃ=ထိုဝိတက် ဝိစာရ မရှိဟူသော အနက်ကို ပြတတ်သည်။ ; na hoti=မဖြစ်။ ; oḷārikassa.la. evaṃ vuttanti=ဟူ၍။ ; mayaṃ=ငါတို့သည်။ ; avocumha nanu=တုံလော။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3448 | Chunk: 57

Apica vitakkavicārānaṃ vūpasamā idaṃ sampasādanaṃ, na kilesakālussiyassa.

AI Translation based on Nissaya

Moreover, it is from the stilling of thought-conception and discursive thinking that this serenity arises, not from the stilling of the turmoil of the defilements.

Vietnamese AI Translation

Hơn nữa, chính từ sự lắng dịu của tầm và tứ mà sự tĩnh lặng này khởi lên, chứ không phải từ sự lắng dịu của sự náo động của các phiền não.

AI Translation Nissaya

apica aparo=Furthermore, another. ; (nayo=method. ; vuccate=will be stated). ; vitakkavicārānaṃ=of thought-conception and discursive thinking. ; vūpasamā=because of the stilling. ; idaṃ jhānaṃ=this second jhana. ; sampasādanaṃ=clarifies associated states. ; hoti=it is. ; kilesakālussiyassa=of the turmoil of defilements. ; (vūpasamā=because of the stilling. ; idaṃ dutiyajjhānaṃ=this second jhana. ; sampasādanaṃ=clarifies associated states). ; nahoti=it is not. ;

Myanmar Nissaya

apica aparo=သော။ ; (nayo=ကို။ ; vuccate=အံ့။) ; vitakkavicārānaṃ=တို့၏။ ; vūpasamā=ကြောင့်။ ; idaṃ jhānaṃ=ဤဒုတိယဈာန်သည်။ ; sampasādanaṃ=သမ္ပယုတ် တရားတို့ကို ကြည်စေတတ်သည်။ ; hoti=၏။ ; kilesakālussiyassa=ကိလေသာတို့၏ ချောက်ချားခြင်း၏။ ; (vūpasamā=ကြောင့်။ ; idaṃ dutiyajjhānaṃ=သည်။ ; sampasādanaṃ=သမ္ပယုတ်တရားတို့ကို ကြည်စေတတ်သည်။) ; nahoti=မဖြစ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3449 | Chunk: 57

Vitakkavicārānañca vūpasamā ekodibhāvaṃ, na upacārajjhānamiva nīvaraṇappahānā, na paṭhamajjhānamiva ca aṅgapātubhāvāti evaṃ sampasādanaekodibhāvānaṃ hetuparidīpakamidaṃ vacanaṃ.

AI Translation based on Nissaya

And it is from the stilling of thought-conception and discursive thinking that it becomes a unification of mind, not from the abandoning of the hindrances as in the case of access concentration, nor from the manifestation of the factor (of one-pointedness) as in the first jhana. Thus, this phrase clarifies the cause of serenity and the unification of mind.

Vietnamese AI Translation

Và chính từ sự lắng dịu của tầm và tứ mà nó trở thành một sự nhất tâm, không phải từ việc từ bỏ các triền cái như trong trường hợp cận định, cũng không phải từ sự biểu hiện của chi phần (nhất tâm) như trong sơ thiền. Do đó, cụm từ này làm rõ nguyên nhân của sự tĩnh lặng và sự nhất tâm.

AI Translation Nissaya

ca=Furthermore. ; vitakkavicārānaṃ=of thought-conception and discursive thinking. ; vūpasamā=because of the stilling. ; ekodibhāvaṃ=it develops excellent concentration. ; hoti=it is. ; upacārajjhānamiva=like access concentration. ; nivaraṇappahānā=due to the abandoning of the hindrances. ; (ekodibhāvaṃ=it is called 'ekodibhāva'). ; na hoti=it is not. ; paṭhamajjhānamiva=like the first jhana. ; aṅgapātubhāvā=due to the manifestation of the factor of one-pointedness also. ; ekodibhāvaṃ=it is called 'ekodibhāva'. ; nahoti=it is not. ; iti=Thus. ; veditabbaṃ=it should be understood. ; evaṃ=Thus. ; idaṃ vacanaṃ=this phrase 'vitakkavicārānaṃ vūpasamā'. ; sampasādanaekodibhāvānaṃ=of serenity and unification of mind. ; hetuparidīpakaṃ=is a phrase that clarifies the cause. ;

Myanmar Nissaya

ca=ထိုမှ တစ်ပါး။ ; vitakkavicārānaṃ=တို့၏။ ; vūpasamā=ကြောင့်။ ; ekodibhāvaṃ=မြတ်သော သမာဓိကို ပွားစေတတ်သည်။ ; hoti=၏။ ; upacārajjhānamiva=ကဲ့သို့။ ; nivaraṇappahānā=ခြင်းကြောင့်။ ; (ekodibhāvaṃ=ဧကောဒိဘာဝ မည်သည်။) ; na hoti=မဖြစ်။ ; paṭhamajjhānamiva=ကဲ့သို့။ ; aṅgapātubhāvā=ဧကဂ္ဂတာအင်္ဂါ၏ ဖြစ်ခြင်းကြောင့်လည်း။ ; ekodibhāvaṃ=မည်သည်။ ; nahoti=မဖြစ်။ ; iti=သို့။ ; veditabbaṃ=၏။ ; evaṃ=ဤသို့။ ; idaṃ vacanaṃ=ဤဝိတက္က ဝိစာရာနံ ဝူပသမာ ဟူသော စကားသည်။ ; sampasādanaekodibhāvānaṃ=ကောင်းစွာ ကြည်စေခြင်း မြတ်သော သမာဓိကို ပွားစေခြင်းတို့၏။ ; hetuparidīpakaṃ=အကြောင်းကို ပြတတ်သော စကားတည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3450 | Chunk: 57

Tathā vitakkavicārānaṃ vūpasamā idaṃ avitakkaavicāraṃ, na tatiyacatutthajjhānāni viya cakkhuviññāṇādīni viya ca abhāvāti evaṃ avitakkaavicārabhāvassa hetuparidīpakañca.

AI Translation based on Nissaya

Similarly, it is from the stilling of thought-conception and discursive thinking that this (jhana) is 'without thought-conception and discursive thinking,' not from their (mere) absence as in the case of the third and fourth jhanas or of eye-consciousness and so on. Thus, this also clarifies the cause for the state of being without thought-conception and discursive thinking.

Vietnamese AI Translation

Tương tự, chính từ sự lắng dịu của tầm và tứ mà (thiền na) này là 'không có tầm và tứ,' không phải từ sự vắng mặt (đơn thuần) của chúng như trong trường hợp tam thiền và tứ thiền hoặc của nhãn thức và vân vân. Do đó, điều này cũng làm rõ nguyên nhân cho trạng thái không có tầm và tứ.

AI Translation Nissaya

tathā=Furthermore. ; vitakka vicārānaṃ=of thought-conception and discursive thinking. ; vūpasamā=because of the stilling. ; idaṃ (dutiyajjhānaṃ)=this (second jhana). ; avitakkaavicāraṃ=is called 'without thought-conception, without discursive thinking'. ; tatiya catutthajjhānāniviya=like the third and fourth jhanas and. ; cakkhuvīññāṇā dīniviyaca=like eye-consciousness and so on. ; abhāvā=due to the absence of thought-conception and discursive thinking. ; aviitakkaavicāraṃ=it is called 'without thought-conception, without discursive thinking'. ; na=it is not. ; iti=Thus. ; veditabbaṃ=it should be understood. ; evaṃ=Thus. ; avitakkaavicārabhāvassa=of the state of being without thought-conception and discursive thinking. ; hetuparidīpakañca=it is also a clarification of the cause. ; hoti=it is. ;

Myanmar Nissaya

tathā=ထိုမှ တစ်ပါး။ ; vitakka vicārānaṃ=တို့၏။ ; vūpasamā=ကြောင့်။ ; idaṃ (dutiyajjhānaṃ)=သည်။ ; avitakkaavicāraṃ=မည်၏။ ; tatiya catutthajjhānāniviya=တို့ကဲ့သို့လည်းကောငး်။ ; cakkhuvīññāṇā dīniviyaca=စက္ခုဝိညာဏ အစရှိသည်တို့ကဲ့သို့ လည်းကောင်း။ ; abhāvā=ဝိတက် ဝိစာရ တို့၏ မရှိခြင်းကြောင့်။ ; aviitakkaavicāraṃ=မည်သည်။ ; na=မဟုတ်။ ; iti=သို့။ ; veditabbaṃ=၏။ ; evaṃ=သို့။ ; avitakkaavicārabhāvassa=အဝိတက္က အဝိစာရ မည်သည်၏ အဖြစ်၏။ ; hetuparidīpakañca=သည်လည်း။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3451 | Chunk: 57

Na vitakkavicārābhāvamattaparidīpakaṃ, vitakkavicārābhāvamattaparidīpakameva [P1.186] pana ‘‘avitakkaṃ avicāran’’ ti idaṃ vacanaṃ.

AI Translation based on Nissaya

It is not a phrase that merely clarifies the absence of thought-conception and discursive thinking. Rather, the phrase 'without thought-conception, without discursive thinking' [P1.186] is what merely clarifies their absence.

Vietnamese AI Translation

Đó không phải là một cụm từ chỉ làm rõ sự vắng mặt của tầm và tứ. Thay vào đó, cụm từ 'không có tầm, không có tứ' [P1.186] mới là cái chỉ làm rõ sự vắng mặt của chúng.

AI Translation Nissaya

vitakka vicārābhāvamattaparidīpakaṃ=A term that merely clarifies the absence of thought-conception and discursive thinking. ; na=it is not. ; pana=Now, to speak of the meaning of 'avitakka avicāra'. ; avitakkaṃ avicāranti idaṃvacanaṃ=This phrase 'without thought-conception, without discursive thinking'. ; vitakka vicārābhāvamattaparidīpakameva=is only a term that clarifies the absence of thought-conception and discursive thinking. ; hoti=it is. ;

Myanmar Nissaya

vitakka vicārābhāvamattaparidīpakaṃ=ဝိတက် ဝိစာရတို့၏ မရှိခြင်းမျှကို ပြတတ်သော ပုဒ်သည်။ ; na=မဟုတ်။ ; pana=အဝိတက္က အဝိစာရ ဟူသော ပုဒ်၏ အနက်ကို ဆိုဦးအံ့။ ; avitakkaṃ avicāranti idaṃvacanaṃ=ဟူသော စကားသည်။ ; vitakka vicārābhāvamattaparidīpakameva=ဝိတက် ဝိစာရတို့၏ မရှိခြင်းမျှကို ပြတတ်သော ပုဒ်သည်သာလျှင်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3452 | Chunk: 57

Tasmā purimaṃ vatvāpi puna vattabbamevāti.

AI Translation based on Nissaya

Therefore, even after stating the former, it must be stated again. This is the explanation.

Vietnamese AI Translation

Do đó, ngay cả sau khi đã nêu vế trước, nó phải được nêu lại. Đây là lời giải thích.

AI Translation Nissaya

tasmā=Therefore. ; purimaṃ=the former phrase, 'vitakkavicārānaṃ vūpasamā'. ; vatvāpi=even having spoken. ; puna=again. ; vattabbameva=the phrase 'avitakkaṃ avicāraṃ' should certainly be spoken. ; hoti=is. ; itiayaṃ=This. ; parihāro=is the explanation. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; purimaṃ=ရှေ့ဖြစ်သော ဝိတက္ကဝိစာရာနံ ဝူပသမာ ဟူသော ပုဒ်ကို။ ; vatvāpi=ဟောတော်မူပြီး၍လည်း။ ; puna=တဖန်။ ; vattabbameva=အဝိတက္က အဝိစာရံ ဟူသော ပုဒ်ကို ဟောတော်မူအပ်သည်သာလျှင်။ ; hoti=၏။ ; itiayaṃ=ကား။ ; parihāro=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3453 | Chunk: 58

Samādhijan ti paṭhamajjhānasamādhito, sampayuttasamādhito vā jātanti attho.

AI Translation based on Nissaya

'Born of concentration' (samādhijaṃ) means born either from the concentration of the first jhāna or from the concentration associated with the second jhāna. This is the meaning.

Vietnamese AI Translation

'Sanh do định' (samādhijaṃ) có nghĩa là sanh ra từ định của sơ thiền hoặc từ định tương ưng với nhị thiền. Đây là ý nghĩa.

AI Translation Nissaya

samādhijanti='Samādhijaṃ' means. ; paṭhamajjhānasamādhitovā=either from the concentration of the first jhāna. ; sampayuttasamādhi tovā=or from the concentration associated with the second jhāna. ; jātaṃ=born. ; itiayaṃ=this. ; attho=is the meaning. ;

Myanmar Nissaya

samādhijanti=ကား။ ; paṭhamajjhānasamādhitovā=ကြောင့်လည်းကောင်း။ ; sampayuttasamādhi tovā=ဒုတိယဈာန်နှင့် ယှဉ်သော သမာဓိကြောင့်လည်းကောင်း။ ; jātaṃ=သည်တည်း။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3454 | Chunk: 58

Tattha kiñcāpi paṭhamajjhānampi sampayuttasamādhito jātaṃ, atha kho ayameva samādhi ‘‘samādhī’’ ti vattabbataṃ arahati vitakkavicārakkhobhavirahena ativiya acalattā suppasannattā ca.

AI Translation based on Nissaya

In this context, although the first jhāna is also born from its associated concentration, nevertheless this very concentration [of the second jhāna] is worthy of being called 'concentration' due to the absence of the disturbance from thought and examination, and because it is exceedingly unshakeable and exceptionally serene.

Vietnamese AI Translation

Trong bối cảnh này, mặc dù sơ thiền cũng sanh ra từ định tương ưng của nó, tuy nhiên chính định này [của nhị thiền] xứng đáng được gọi là 'định' do sự vắng mặt của sự xáo trộn từ tầm và tứ, và bởi vì nó vô cùng không lay chuyển và đặc biệt tĩnh lặng.

AI Translation Nissaya

tattha=In that case. ; paṭhamajjhānampi=the first jhāna also. ; sampayuttasamādhito=from associated concentration. ; kiñcāpi jātaṃ=although it is born. ; athakho=nevertheless. ; ayameva samādhi=this very concentration of the second jhāna. ; samādhīti=as 'concentration'. ; vattabbataṃ=the state of being called. ; arahati=is worthy of. ; kasmā=Why?. ; vitakkavicārakkhobhavirasena=due to the absence of the disturbance from thought and examination. ; ativiya=exceedingly. ; acalattā=because of its unshakeable nature, and. ; suppasannattāca=because of its extremely serene nature. ;

Myanmar Nissaya

tattha=ထိုသို့ ဖြစ်ရာ၌။ ; paṭhamajjhānampi=သည်လည်း။ ; sampayuttasamādhito=ကြောင့်။ ; kiñcāpi jātaṃ=၏ရှင့်။ ; athakho=ထိုသို့ ဖြစ်စေကာမူ။ ; ayameva samādhi=ဤဒုတိယဈာန် သမာဓိကို သာလျှင်။ ; samādhīti=သမာဓိဟူ၍။ ; vattabbataṃ=အဖြစ်ကို။ ; arahati=ထိုက်၏။ ; kasmā=ကား။ ; vitakkavicārakkhobhavirasena=ဝိတက် ဝိစာရတို့၏ ချောက်ချားခြင်းမှ ကင်းသဖြင့်။ ; ativiya=လျှင်။ ; acalattā=တုန်လှုပ်ခြင်း မရှိသည်၏ အဖြစ်ကြောင့်လည်းကောင်း။ ; suppasannattāca=အလွန်ကြည်သည်၏ အဖြစ်ကြောင့်လည်းကောင်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3455 | Chunk: 58

Tasmā imassa vaṇṇabhaṇanatthaṃ idameva ‘‘samādhijan’’ ti vuttaṃ.

AI Translation based on Nissaya

Therefore, for the sake of praising its qualities, this very [jhāna] was called 'born of concentration'.

Vietnamese AI Translation

Do đó, vì mục đích tán dương các phẩm chất của nó, chính [thiền na] này đã được gọi là 'sanh do định'.

AI Translation Nissaya

tasmā=Therefore. ; imassa=of this (second jhāna). ; vaṇṇabhaṇanatthaṃ=for the purpose of praising its qualities. ; idameva=this very (second jhāna). ; samādhijanti=as 'born of concentration'. ; vuttaṃ=was said. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; imassa=ဤဒုတိယဈာန်၏။ ; vaṇṇabhaṇanatthaṃ=ကျေးဇူးကို ချီးမွမ်း၍ ဆိုခြင်းငှါ။ ; idameva=ဤဒုတိယဈာန်ကို သာလျှင်။ ; samādhijanti=ဟူ၍။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3456 | Chunk: 58

Pītisukhan ti idaṃ vuttanayameva.

AI Translation based on Nissaya

'Rapture and happiness' (pītisukhaṃ) is just as has been explained.

Vietnamese AI Translation

'Hỷ và lạc' (pītisukhaṃ) cũng giống như đã được giải thích.

AI Translation Nissaya

pītisukhanti idaṃ vacanaṃ=This phrase 'pītisukhaṃ'. ; vuttanayameva=is just as has been explained. ;

Myanmar Nissaya

pītisukhanti idaṃ vacanaṃ=ဟူသော ဤစကားသည်။ ; vuttanayameva=ဆိုအပ်ပြီးသော နည်းရှိသည်သာလျှင်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3457 | Chunk: 58

Dutiyan ti gaṇanānupubbatā dutiyaṃ, idaṃ dutiyaṃ uppannantipi dutiyaṃ.

AI Translation based on Nissaya

'Second' (dutiyaṃ) is so called according to the numerical sequence. This second jhāna arises second, and for that reason also it is called 'second'.

Vietnamese AI Translation

'Nhị' (dutiyaṃ) được gọi như vậy theo thứ tự số học. Nhị thiền này khởi lên thứ hai, và vì lý do đó nó cũng được gọi là 'nhị'.

AI Translation Nissaya

dutiyanti=The word 'dutiyaṃ' (second). ; gaṇanānupubbatā gaṇanānupubbavāya=by way of numerical sequence. ; dutiyaṃ=is called second. ; idaṃ=This second jhāna. ; dutiyaṃ=second. ; uppannaṃ=arises. ; ititasmāpi=Therefore also. ; dutiyaṃ=it is called 'second'. ;

Myanmar Nissaya

dutiyanti=ကား။ ; gaṇanānupubbatā gaṇanānupubbavāya=အရေအတွက်အစဉ်အားဖြင့်။ ; dutiyaṃ=မည်၏။ ; idaṃ=ဤဒုတိယဈာန်သည်။ ; dutiyaṃ=မြောက်။ ; uppannaṃ=ဖြစ်၏။ ; ititasmāpi=ကြောင့်လည်း။ ; dutiyaṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3458 | Chunk: 58

Pītiyā ca virāgāti virāgo nāma vuttappakārāya pītiyā jigucchanaṃ vā samatikkamo vā, ubhinnaṃ pana antarā casaddo sampiṇḍanattho, so vūpasamaṃ vā sampiṇḍeti vitakkavicāravūpasamaṃ vā.

AI Translation based on Nissaya

'And from the fading of rapture' (pītiyā ca virāgā): 'fading away' (virāga) means either aversion towards or the overcoming of rapture of the kind mentioned. Furthermore, the word 'ca' (and) between the two terms has a conjunctive meaning; it conjoins either 'stilling' (vūpasama) or 'the stilling of thought and examination' (vitakkavicāravūpasama).

Vietnamese AI Translation

'Và do sự ly hỷ' (pītiyā ca virāgā): 'ly' (virāga) có nghĩa là sự nhàm chán đối với hoặc sự vượt qua hỷ của loại đã được đề cập. Hơn nữa, từ 'ca' (và) giữa hai thuật ngữ có ý nghĩa nối kết; nó nối kết hoặc 'sự lắng dịu' (vūpasama) hoặc 'sự lắng dịu của tầm và tứ' (vitakkavicāravūpasama).

AI Translation Nissaya

pītiyāca virāgāti=In the phrase 'and from the fading of rapture'. ; virāgonāma='Virāga' (fading away/dispassion). ; vuttappakārāya=of the kind mentioned. ; pītiyā=towards rapture. ; jigucchanaṃvā=is either aversion. ; samatikkamovā=or overcoming. ; virāgonāma=is called 'virāga'. ; puna=Again. ; ca=I will state the meaning of the word 'ca'. ; ubhinnaṃ=of the two words, 'pīti' and 'virāga'. ; antarā=between them. ; ca saddo=the word 'ca'. ; sapiṇḍanattho=has the meaning of conjoining. ; so=That word 'ca'. ; vūpasamaṃvā=either 'stilling' (vūpasama). ; sampiṇḍeti=it conjoins. ; vitakkavicāravūpasamaṃvā=or 'the stilling of thought and examination'. ; sampiṇḍeti=it conjoins. ;

Myanmar Nissaya

pītiyāca virāgāti=ဟူသော ပုဒ်၌။ ; virāgonāma=ဝိရာဂမည်သည်ကား။ ; vuttappakārāya=ရှိသော။ ; pītiyā=ကို။ ; jigucchanaṃvā=သည်လည်းကောင်း။ ; samatikkamovā=လွန်ခြင်းသည်လည်းကောင်း။ ; virāgonāma=မည်၏။ ; puna=ဖန်။ ; ca=သဒ္ဒါ၏ အနက်ကို ဆိုအံ့။ ; ubhinnaṃ=နှစ်ပါးကုန်သော ပီတိဟူသော ပုဒ်ဝိရာဂဟူသော ပုဒ်တို့၏။ ; antarā=အလယ်၌။ ; ca saddo=ရှိသော စ သဒ္ဒါသည်။ ; sapiṇḍanattho=ပေါင်းခြင်းအနက်ရှိ၏။ ; so=ထို စသဒ္ဒါသည်။ ; vūpasamaṃvā=ငြိမ်းခြင်းကိုလည်း။ ; sampiṇḍeti=ပေါင်း၏။ ; vitakkavicāravūpasamaṃvā=ဝိတက် ဝိစာရတို့၏ ငြိမ်းခြင်းကိုလည်း။ ; sampiṇḍeti=ပေါင်း၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3459 | Chunk: 58

Tattha yadā vūpasamameva sampiṇḍeti, tadā pītiyā virāgā ca, kiñca bhiyyo vūpasamā cāti evaṃ yojanā veditabbā.

AI Translation based on Nissaya

Therein, when it conjoins only 'stilling', then the construction should be understood thus: 'and from the fading of rapture, and what more, from its stilling'.

Vietnamese AI Translation

Trong đó, khi nó chỉ nối kết 'sự lắng dịu', thì cấu trúc nên được hiểu như sau: 'và do sự ly hỷ, và hơn nữa, do sự lắng dịu của nó'.

AI Translation Nissaya

tattha=Between these two ways of conjoining. ; yadā=when. ; vūpasamameva=it conjoins only 'stilling'. ; sampiṇḍeti=it conjoins. ; tadā=then. ; cītiyā=towards rapture. ; virāgāca=and due to fading away. ; kiñcabhiyyo=what more is to be said?. ; vūpasamāca=and due to the stilling of rapture. ; iti evaṃ=thus. ; yojanā=the connection. ; veditabbā=should be understood. ;

Myanmar Nissaya

tattha=ထိုနှစ်ပါးသော ပေါင်းခြင်းတို့တွင်။ ; yadā=၌။ ; vūpasamameva=ငြိမ်းခြင်းမျှကို သာလျှင်။ ; sampiṇḍeti=၏။ ; tadā=၌။ ; cītiyā=ကို။ ; virāgāca=စက်ဆုပ်ခြင်းကြောင့် လည်းကောင်း။ ; kiñcabhiyyo=ဆိုဖွယ်ရှိသေး၏။ ; vūpasamāca=ပီတိ၏ ငြိမ်းခြင်းကြောင့်လည်းကောင်း။ ; iti evaṃ=သို့။ ; yojanā=ကို။ ; veditabbā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3460 | Chunk: 58

Imissā ca yojanāya virāgo jigucchanattho hoti, tasmā pītiyā jigucchanā ca samatikkamā cāti ayamattho daṭṭhabbo.

AI Translation based on Nissaya

And in this construction, the word 'virāga' has the meaning of aversion. Therefore, the meaning should be understood as: 'due to aversion towards rapture and due to its overcoming'.

Vietnamese AI Translation

Và trong cấu trúc này, từ 'virāga' có ý nghĩa là sự nhàm chán. Do đó, ý nghĩa nên được hiểu là: 'do sự nhàm chán đối với hỷ và do sự vượt qua nó'.

AI Translation Nissaya

ca=Further. ; imissā yojanāya=in this construction. ; tirāgo=the word 'virāga'. ; jigucchanatto=has the meaning of aversion. ; hoti=it has. ; tasmā=Therefore. ; pītiyā=towards rapture. ; jigucchanā=due to aversion. ; samatikkamāca=and due to overcoming. ; iti ayaṃ attho=this meaning. ; daṭṭhabbo=should be seen. ;

Myanmar Nissaya

ca=ဆက်။ ; imissā yojanāya=ဤသို့သော ယောဇနာခြင်းသည်။ ; tirāgo=ဝိရာဂ သဒ္ဒါသည်။ ; jigucchanatto=စက်ဆုပ်ခြင်း အနက်ရှိသည်။ ; hoti=၏။ ; tasmā=ကြောင့်။ ; pītiyā=ကို။ ; jigucchanā=စက်ဆုပ်ခြင်းကြောင့် လည်းကောင်း။ ; samatikkamāca=လွန်ခြင်းကြောင့်လည်းကောင်း။ ; iti ayaṃ attho=ကို။ ; daṭṭhabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3461 | Chunk: 58

Yadā pana vitakkavicāravūpasamaṃ sampiṇḍeti, tadā pītiyā ca virāgā, kiñca bhiyyo vitakkavicārānañca vūpasamāti evaṃ yojanā veditabbā.

AI Translation based on Nissaya

When, however, it conjoins 'the stilling of thought and examination', then the construction should be understood thus: 'and from the fading away of rapture, and what more, from the stilling of thought and examination'.

Vietnamese AI Translation

Tuy nhiên, khi nó nối kết 'sự lắng dịu của tầm và tứ', thì cấu trúc nên được hiểu như sau: 'và do sự ly hỷ, và hơn nữa, do sự lắng dịu của tầm và tứ'.

AI Translation Nissaya

pana=Now, I shall speak of conjoining the phrase 'vitakka vicāra vūpasamā'. ; yadā=When. ; vitakka vicāra vūpasamaṃ=the stilling of thought and examination. ; sampiṇḍeti=it conjoins. ; tadā=then. ; pītiyā=towards rapture. ; virāgāca=and due to overcoming. ; kiñcabhiyyo=what more is to be said?. ; vitakkavicārānaṃ=of thought and examination. ; vūpasamāca=and due to the stilling. ; itievaṃ=thus. ; yojanā=the connection. ; veditabbā=should be understood. ;

Myanmar Nissaya

pana=ဝိတက္က ဝိစာရ ဝူပသမာ ဟူသော စကားကို ပေါင်းသည်ကိုဆိုဦးအံ့။ ; yadā=၌။ ; vitakka vicāra vūpasamaṃ=ဝိတက် ဝိစာရ၏ ငြိမ်းခြင်းကို။ ; sampiṇḍeti=၏။ ; tadā=၌။ ; pītiyā=ကို။ ; virāgāca=လွန်မြောက်ခြင်းကြောင့် လည်းကောင်း။ ; kiñcabhiyyo=ဆိုဖွယ်ရှိသေး၏။ ; vitakkavicārānaṃ=တို့၏။ ; vūpasamāca=ငြိမ်းခြင်းကြောင့်လည်းကောင်း။ ; itievaṃ=ဤသို့။ ; yojanā=ကို။ ; veditabbā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3462 | Chunk: 58

Imissā ca yojanāya virāgo samatikkamanattho hoti, tasmā pītiyā ca samatikkamā, vitakkavicārānañca vūpasamāti ayamattho daṭṭhabbo.

AI Translation based on Nissaya

And in this construction, the word 'virāga' has the meaning of 'overcoming'. Therefore, the meaning should be understood as: 'due to the overcoming of rapture and the stilling of thought and examination'.

Vietnamese AI Translation

Và trong cấu trúc này, từ 'virāga' có ý nghĩa là 'sự vượt qua'. Do đó, ý nghĩa nên được hiểu là: 'do sự vượt qua hỷ và sự lắng dịu của tầm và tứ'.

AI Translation Nissaya

ca=Further. ; imissā yojanāya=in this construction. ; virāgo=the word 'virāga'. ; samatikkamanattho=has the meaning of overcoming. ; hoti=it has. ; tasmā=Therefore. ; pītiyā=towards rapture. ; samatikkamāca=and due to overcoming. ; vitakkavicārānaṃ=of thought and examination. ; vūpasamāca=and due to the stilling. ; iti ayaṃ attho=this meaning. ; daṭṭhabbo=should be seen. ;

Myanmar Nissaya

ca=ဆက်။ ; imissā yojanāya=၌။ ; virāgo=ဝိရာဂသဒ္ဒါသည်။ ; samatikkamanattho=လွန်မြောက်ခြင်း အနက်ရှိသည်။ ; hoti=၏။ ; tasmā=ကြောင့်။ ; pītiyā=ကို။ ; samatikkamāca=လွန်မြောက်ခြင်းကြောင့် လည်းကောင်း။ ; vitakkavicārānaṃ=တို့၏။ ; vūpasamāca=ကြောင့်လည်းကောင်း။ ; iti ayaṃ attho=ကို။ ; daṭṭhabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3463 | Chunk: 58

Kāmañcete [M1.173] vitakkavicārā dutiyajjhāneyeva vūpasantā, imassa pana jhānassa maggaparidīpanatthaṃ vaṇṇabhaṇanatthañcetaṃ vuttaṃ.

AI Translation based on Nissaya

Although these thoughts and examinations [M1.173] are indeed stilled in the second jhāna itself, this statement is made for the purpose of indicating the path to this jhāna and for the purpose of praising it.

Vietnamese AI Translation

Mặc dù những tầm và tứ này [M1.173] thực sự đã được lắng dịu trong chính nhị thiền, phát biểu này được đưa ra nhằm mục đích chỉ ra con đường đến thiền na này và nhằm mục đích tán dương nó.

AI Translation Nissaya

ete vitakkavicārā=These thoughts and examinations. ; dutiyajjhāneyeva=in the second jhāna itself. ; vā=even from the second jhāna. ; kāmañca vūpasantā=are indeed stilled. ; pana tathāpi=But nevertheless. ; imassa jhānassa=of this third jhāna. ; maggaparidīpanatthañca=and for the purpose of showing the path. ; vaṇṇabhaṇa natthañca=and for the purpose of stating its praise. ; etaṃ vacanaṃ=this statement 'vitakkavicārānaṃ vūpasamā'. ; vuttaṃ=was said. ;

Myanmar Nissaya

ete vitakkavicārā=တို့သည်။ ; dutiyajjhāneyeva=၌သာလျှင်။ ; vā=ဒုတိယဈာန်ကပင်လျှင်။ ; kāmañca vūpasantā=ကုန်၏ရှင့်။ ; pana tathāpi=သော်ကား။ ; imassa jhānassa=ဤတတိယဈာန်၏။ ; maggaparidīpanatthañca=အကြောင်းကို ပြခြင်းငှါလည်းကောင်း။ ; vaṇṇabhaṇa natthañca=ကျေးဇူးကို ဆိုခြင်းငှါ လည်းကောင်း။ ; etaṃ vacanaṃ=ဤဝိတက္က ဝိစာရာနံ ဝူပသမာ ဟူသော စကားကို။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3464 | Chunk: 58

Vitakkavicārānaṃ vūpasamāti hi vutte idaṃ paññāyati ‘‘nūna vitakkavicāravūpasamo maggo imassa jhānassā’’ ti.

AI Translation based on Nissaya

For when it is said, 'with the stilling of thought and examination', this becomes clear: 'Surely, the stilling of thought and examination is the path to this jhāna'.

Vietnamese AI Translation

Vì khi được nói, 'với sự lắng dịu của tầm và tứ', điều này trở nên rõ ràng: 'Chắc chắn, sự lắng dịu của tầm và tứ là con đường đến thiền na này'.

AI Translation Nissaya

hi saccaṃ=Indeed. ; vitakkavicārānaṃ vūpasamāti=as 'with the stilling of thought and examination'. ; vutte=when it is said. ; idaṃ atthajātaṃ=this meaning about to be stated. ; paññāyati=becomes clear. ; kiṃ paññāyati=What becomes clear?. ; nanu=Surely. ; vitakkavicāravūpasamo=the stilling of thought and examination. ; imassa jhānassa=of this third jhāna. ; maggo=is the path. ; hoti=it is. ; iti=thus. ; paññāyati=it becomes clear. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; vitakkavicārānaṃ vūpasamāti=ဟူ၍။ ; vutte=သော်။ ; idaṃ atthajātaṃ=ဤဆိုလတ္တံ့သော အနက်သဘောသည်။ ; paññāyati=ထင်၏။ ; kiṃ paññāyati=အား။ ; nanu=စင်စစ်။ ; vitakkavicāravūpasamo=ခြင်းသည်။ ; imassa jhānassa=ဤတတိယဈာန်၏။ ; maggo=အကြောင်းသည်။ ; hoti=၏။ ; iti=သို့။ ; paññāyati=ထင်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3465 | Chunk: 58

Yathā ca tatiye ariyamagge [V1.158] appahīnānampi sakkāyadiṭṭhādīnaṃ ‘‘pañcannaṃ orambhāgiyānaṃ saṃyojanānaṃ pahānā’’ ti ( dī. ni. 1.373; ma. ni. 2.133; saṃ. ni. 5.184; a. ni. 3.88) evaṃ pahānaṃ vuccamānaṃ vaṇṇabhaṇanaṃ hoti, tadadhigamāya ussukkānaṃ ussāhajanakaṃ, evameva idha avūpasantānampi vitakkavicārānaṃ vūpasamo vuccamāno vaṇṇabhaṇanaṃ hoti.

AI Translation based on Nissaya

And just as on the third noble path [V1.158], when the abandoning of things that have already been abandoned, such as identity-view, etc., is spoken of with the words 'through the abandoning of the five lower fetters' (Dī. Ni. 1.373; etc.), this is a statement of praise that generates enthusiasm in those diligently striving for its attainment, in the very same way, here, when the stilling of thought and examination, which have already been stilled, is spoken of, it is a statement of praise.

Vietnamese AI Translation

Và cũng giống như trên thánh đạo thứ ba [V1.158], khi sự từ bỏ những điều đã được từ bỏ, chẳng hạn như thân kiến, v.v., được nói đến bằng những lời 'thông qua sự từ bỏ năm hạ phần kiết sử' (Dī. Ni. 1.373; v.v.), đây là một lời tán dương tạo ra sự nhiệt tình ở những người đang tinh tấn nỗ lực để đạt được nó, theo cùng một cách, ở đây, khi sự lắng dịu của tầm và tứ, vốn đã được lắng dịu, được nói đến, đó là một lời tán dương.

AI Translation Nissaya

ca=Furthermore, apart from the exposition of the path, I will speak of the praise. ; tatiye=on the third. ; ariyamagge=noble path (of the non-returner). ; appahīnānampi=of those which have already been abandoned. ; sakkāyadiṭṭhādīnaṃ=such as identity-view, etc. (By etc. is meant doubt and adherence to rites and rituals). ; pañcannaṃ.la. pahānāti='through the abandoning of the five...'. ; evaṃ=thus. ; pahānaṃ=the abandoning. ; vuccamānaṃ=when spoken of. ; vaṇṇabhaṇanaṃ=is a statement of praise (for the path of the non-returner). ; ‌hoti=it is. ; tadadhigamāya=for the attainment of that (non-returner's path). ; ussukkānaṃ=for those people who are diligently striving. ; ussāhajanakaṃ=it generates enthusiasm. ; hoti yathā=just as it is. ; evameva=in the very same way. ; idha=here, in this third jhāna. ; avūpasantānampi=of those which have already been stilled. ; vitakka vicārānaṃ=of thought and examination. ; vūpasamo=the stilling. ; vuccamānā=when spoken of. ; taṇṇabhaṇanaṃ=is a statement of praise. ; hoti=it is. ;

Myanmar Nissaya

ca=မဂ္ဂပရိဒီပန မှ တပါး ဝဏ္ဏဘဏနကိုဆိုဦးအံ့။ ; tatiye=သုံးခုမြောက်သော။ ; ariyamagge=အနာဂါမိမဂ်၌။ ; appahīnānampi=မပယ်ကုန်သည်လည်းဖြစ်ကုန်သော။ ; sakkāyadiṭṭhādīnaṃ=အစရှိသည်တို့ကို။ ; (အာဒိဝန်အရ ဝိစိကိစ္ဆာ သီလဗ္ဗတပရာမာသသံယောဇဉ်ကိုယူ)။ ; pañcannaṃ.la. pahānāti=၍။ ; evaṃ=သို့။ ; pahānaṃ=ပယ်ခြင်းကို။ ; vuccamānaṃ=သော်။ ; vaṇṇabhaṇanaṃ=အနာဂါမိမဂ်ကို ဆိုရသည်။ ; ‌hoti=၏။ ; tadadhigamāya=ထိုအနာဂါမိမဂ်ကိုရခြင်းငှါ ။ ; ussukkānaṃ=အပတ်တကုတ်အားထုတ်ကြကုန်သော အမျိုးသားတို့အား။ ; ussāhajanakaṃ=အားထုတ်ခြင်းကို ဖြစ်စေတတ်သည်။ ; hoti yathā=ကဲ့သို့။ ; evameva=ဤအတူလျှင်။ ; idha=ဤတတိယဈာန်၌။ ; avūpasantānampi=မငြိမ်းတတ်သည်လည်းဖြစ်ကုန်သော။ ; vitakka vicārānaṃ=တို့၏။ ; vūpasamo=ငြိမ်းခြင်းကို။ ; vuccamānā=သော်။ ; taṇṇabhaṇanaṃ=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3466 | Chunk: 58

Tenāyamattho vutto ‘‘pītiyā ca samatikkamā vitakkavicārānañca vūpasamā’’ ti.

AI Translation based on Nissaya

For that reason, this meaning was stated: 'due to the overcoming of rapture and the stilling of thought and examination'.

Vietnamese AI Translation

Vì lý do đó, ý nghĩa này đã được nêu ra: 'do sự vượt qua hỷ và sự lắng dịu của tầm và tứ'.

AI Translation Nissaya

tena=For that reason. ; pītiyāca=of rapture also. ; samatikkamā=because of overcoming. ; vitakkavikārānañca=and of thought and examination. ; vūpasamā=because of stilling. ; iti yaṃ attho=this meaning. ; vutto=was stated. ; hoti=it is. ; iti=Thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

tena=ကြောင့်။ ; pītiyāca=ကိုလည်း။ ; samatikkamā=ကြောင့်။ ; vitakkavikārānañca=တို့၏လည်း။ ; vūpasamā=ကြောင့်။ ; iti yaṃ attho=ကို။ ; vutto=သည်။ ; hoti=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3467 | Chunk: 58

Upekkhako ca viharatīti ettha upapattito ikkhatīti upekkhā [P1.187], samaṃ passati apakkhapatitā hutvā passatīti attho.

AI Translation based on Nissaya

'And abides equanimous' (upekkhako ca viharati): Here, 'upekkhā' [P1.187] is so called because one observes (ikkhati) fittingly (upapattito). The meaning is that one sees evenly, seeing without falling into partiality.

Vietnamese AI Translation

'Và an trú xả' (upekkhako ca viharati): Ở đây, 'upekkhā' [P1.187] được gọi như vậy bởi vì người ta quan sát (ikkhati) một cách phù hợp (upapattito). Ý nghĩa là người ta nhìn một cách bình đẳng, nhìn mà không rơi vào sự thiên vị.

AI Translation Nissaya

upekkhako ca viharatīti ettha=In this passage 'and abides equanimous'. ; (avayavattho=The etymological meaning. ; evaṃ=thus. ; veditabbo=should be understood). ; upapattito=fittingly. ; ikkhati=one sees. ; iti tasmā=therefore. ; upakkho=it is called 'upekkhā'. ; samaṃ=evenly. ; passati=one sees. ; apakkhapatitā=not falling into the side of excess or deficiency. ; hutvā=having become. ; passati=one sees. ; itiayaṃ=this. ; attho=is the meaning. ;

Myanmar Nissaya

upekkhako ca viharatīti ettha=ဟူသော ပါဌ်၌။ ; (avayavattho=ကို။ ; evaṃ=သို့။ ; veditabbo=၏။) ; upapattito=အသင့်အားဖြင့်။ ; ikkhati=ရှုတတ်၏။ ; iti tasmā=ကြောင့်။ ; upakkho=မည်၏။ ; samaṃ=အညီအညွတ်။ ; passati=ရှုတတ်၏။ ; apakkhapatitā=လွန်ခြင်း ယုတ်ခြင်း အဖို့၌ မကျသည်။ ; hutvā=၍။ ; passati=ရှုတတ်၏။ ; itiayaṃ=သည်ကား။ ; attho=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3468 | Chunk: 58

Tāya visadāya vipulāya thāmagatāya samannāgatattā tatiyajjhānasamaṅgī ‘‘upekkhako’’ ti vuccati.

AI Translation based on Nissaya

Because of being endowed with that equanimity which is pure, extensive, and powerful, one who is endowed with the third jhāna is called 'equanimous'.

Vietnamese AI Translation

Bởi vì được trang bị với xả đó, vốn trong sạch, rộng lớn và mạnh mẽ, người nào được trang bị với tam thiền được gọi là 'vị có xả'.

AI Translation Nissaya

visadāya=pure. ; vipulāya=extensive. ; thāmagatāya=endowed with strength and power. ; tāya upekkhāya=with that equanimity. ; samannagatattā=because of being endowed. ; tatiyajjhānamasaṅgī=a person endowed with the third jhāna. ; upekkhakoti=as 'equanimous'. ; vuccati=is called. ;

Myanmar Nissaya

visadāya=သန့်ရှင်းစင်ကြယ်သော။ ; vipulāya=ပြန့်ပြောသော။ ; thāmagatāya=အားအစွမ်းနှင့် ပြည့်စုံသော။ ; tāya upekkhāya=နှင့်။ ; samannagatattā=ကြောင့်။ ; tatiyajjhānamasaṅgī=ပုဂ္ဂိုလ်ကို။ ; upekkhakoti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3469 | Chunk: 58

Upekkhā pana dasavidhā hoti chaḷaṅgupekkhā brahmavihārupekkhā bojjhaṅgupekkhā vīriyupekkhā saṅkhārupekkhā vedanupekkhā vipassanupekkhā tatramajjhattupekkhā jhānupekkhā pārisuddhupekkhāti.

AI Translation based on Nissaya

Moreover, equanimity is of ten kinds: six-factored equanimity, equanimity as a divine abiding, equanimity as an awakening factor, equanimity of energy, equanimity towards formations, equanimity of feeling, equanimity of insight, specific neutrality, equanimity of jhāna, and equanimity of purity.

Vietnamese AI Translation

Hơn nữa, xả có mười loại: xả sáu chi, xả như một phạm trú, xả như một giác chi, xả tinh tấn, xả đối với các hành, xả thọ, xả tuệ, hành xả, xả thiền, và xả thanh tịnh.

AI Translation Nissaya

pana=Now, apart from the etymology, I will state the divisions. ; upekkhā=Equanimity. ; chaḷaṅgupekkhā=six-factored equanimity. ; brahmavihārupekkhā=equanimity as a divine abiding. ; bojjhaṅgupekkhā=equanimity as a factor of awakening. ; vīriyupekkhā=equanimity of energy. ; saṅkhārupekkhā=equanimity towards formations. ; vedanupekkhā=equanimity of feeling. ; vipassanupekkhā=equanimity of insight. ; tatramajjhattupekkhā=specific neutrality. ; jhānupekkhā=equanimity of jhāna. ; pārisuddhupekkhā=and equanimity of purity. ; iti=thus. ; dasavimā=is of ten kinds. ; hoti=it is. ;

Myanmar Nissaya

pana=ဝစနတ္ထမှ တပါး အပြားကိုဆိုဦးအံ့။ ; upekkhā=သည်။ ; chaḷaṅgupekkhā=လည်းကောင်း။ ; brahmavihārupekkhā=လည်းကောင်း။ ; bojjhaṅgupekkhā=လည်းကောင်း။ ; vīriyupekkhā=လည်းကောင်း။ ; saṅkhārupekkhā=လည်းကောင်း။ ; vedanupekkhā=လည်းကောင်း။ ; vipassanupekkhā=လည်းကောင်း။ ; tatramajjhattupekkhā=လည်းကောင်း။ ; jhānupekkhā=လည်းကောင်း။ ; pārisuddhupekkhā=လည်းကောင်း။ ; iti=ဤသို့။ ; dasavimā=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3470 | Chunk: 58

Tattha yā ‘‘idha, bhikkhave, khīṇāsavo bhikkhu cakkhunā rūpaṃ disvā neva sumano hoti na dummano, upekkhako ca viharati sato sampajāno’’ ti ( a. ni. 6.1) evamāgatā khīṇāsavassa chasu dvāresu iṭṭhāniṭṭhachaḷārammaṇāpāthe parisuddhapakatibhāvāvijahanākārabhūtā upekkhā, ayaṃ chaḷaṅgupekkhā nāma.

AI Translation based on Nissaya

Among these, the equanimity that has come down as: 'Here, bhikkhus, a bhikkhu whose cankers are destroyed, on seeing a form with the eye, is neither pleased nor displeased, but abides equanimous, mindful, and fully aware' (A. Ni. 6.1), which, for one whose cankers are destroyed, is in the manner of not abandoning its natural state of thorough purity at the appearance of the six desirable or undesirable sense objects at the six doors—this is called six-factored equanimity (chaḷaṅgupekkhā).

Vietnamese AI Translation

Trong số này, xả được truyền lại như sau: 'Ở đây, này các Tỳ khưu, một vị Tỳ khưu đã đoạn tận các lậu hoặc, khi thấy một sắc bằng mắt, không vui cũng không buồn, mà an trú xả, chánh niệm, và tỉnh giác' (A. Ni. 6.1), mà đối với một người đã đoạn tận các lậu hoặc, là theo cách không từ bỏ trạng thái tự nhiên của sự thanh tịnh hoàn toàn khi sáu đối tượng trần cảnh đáng mong muốn hoặc không đáng mong muốn xuất hiện ở sáu cửa—đây được gọi là xả sáu chi (chaḷaṅgupekkhā).

AI Translation Nissaya

tattha=Among those ten kinds of equanimity. ; idha bhikkhave.la. sampajānoti=as in 'Here, bhikkhus... mindful and fully aware'. ; evaṃ=thus. ; bhāgatā=which comes in the Pātheyya-vagga, Dasuttara Sutta, and the Sattaka Aṅguttara (A. II, 247). ; khīṇāsavassa=of one whose cankers are destroyed. ; chasudvāresu=in the six sense doors. ; iṭṭhāniṭṭhachaḷārammaṇāpāthe=at the appearance of the six sense-objects, which may be desirable or undesirable. ; parisuddhapakatibhāvāvijahanākārabhūtā=which is in the manner of not abandoning the state of its natural, thorough purity. ; yā upekkhā=whatever equanimity. ; atthi=there is. ; ayaṃ=this equanimity. ; chaḷaṅgupekkhānāma=is called 'six-factored equanimity'. ; bhikkhave=Bhikkhus. ; idha=in this teaching. ; khīṇāsavo=whose cankers are destroyed. ; bhikkhu=a bhikkhu. ; cakkhunā=with the eye. ; rūpaṃ=a form. ; disvā=having seen. ; sumano=pleased. ; neva hoti=is not. ; dummano=displeased. ; nahoti=is not. ; upekkhākoca=and being equanimous. ; sato=being mindful. ; sampajāno=and being fully aware with wisdom. ; viharati=abides. ;

Myanmar Nissaya

tattha=ထိုဆယ်ပါးသော ဥပေက္ခာတို့တွင်။ ; idha bhikkhave.la. sampajānoti=ဟူ၍။ ; evaṃ=သို့။ ; bhāgatā=ပါထေယျဝဂ်၊ ဒသုတ္တရသုတ်၊ သတ္တကအင်္ဂုတ္တိုရ်ပါဠိ (အံ-၂။ ၂၄၇) တို့၌ လာသော။ ; khīṇāsavassa=၏။ ; chasudvāresu=တို့၌။ ; iṭṭhāniṭṭhachaḷārammaṇāpāthe=ဣဋ္ဌာရုံ အနိဋ္ဌာရုံဖြစ်သော ခြောက်ပါးသော အာရုံ၏ ထင်ခြင်း၌။ ; parisuddhapakatibhāvāvijahanākārabhūtā=ထက်ဝန်းကျင် စင်ကြယ်သော ပကတိသဘော၏ အဖြစ်ကို အစွန့်သော အခြင်းအရာအားဖြင့် ဖြစ်သော။ ; yā upekkhā=သည်။ ; atthi=၏။ ; ayaṃ=ဤဥပေက္ခာသည်။ ; chaḷaṅgupekkhānāma=၏။ ; bhikkhave=တို့။ ; idha=တော်၌။ ; khīṇāsavo=ရှိသော။ ; bhikkhu=သည်။ ; cakkhunā=ဖြင့်။ ; rūpaṃ=ကို။ ; disvā=၍။ ; sumano=သည်။ ; neva hoti=မြစ်။ ; dummano=သည်။ ; nahoti=မဖြစ်။ ; upekkhākoca=လျစ်လျူရှုသည် ဖြစ်၍လည်း။ ; sato=သတိနှင့်ပြည့်စုံသည်ဖြစ်၍။ ; sampajāno=ပညာအဆင်အခြင်နှင့် ပြည့်စုံသည်ဖြစ်၍။ ; viharati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3471 | Chunk: 58

Yā pana ‘‘upekkhāsahagatena cetasā ekaṃ disaṃ pharitvā viharatī’’ ti ( dī. ni. 1.556; ma. ni. 1.77) evamāgatā sattesu majjhattākārabhūtā upekkhā, ayaṃ brahmavihārupekkhā nāma.

AI Translation based on Nissaya

That equanimity which has come down as: 'abides pervading one direction with a mind accompanied by equanimity' (Dī. Ni. 1.556; etc.), and which is in the manner of neutrality towards beings—this is called equanimity as a divine abiding (brahmavihārupekkhā).

Vietnamese AI Translation

Xả được truyền lại như sau: 'an trú biến mãn một phương với tâm câu hữu với xả' (Dī. Ni. 1.556; v.v.), và theo cách trung lập đối với chúng sinh—đây được gọi là xả như một phạm trú (brahmavihārupekkhā).

AI Translation Nissaya

pana=Furthermore. ; upekkhāsahagatena.la. viharatīti=as in 'abides pervading one direction with a mind accompanied by equanimity'. ; evaṃ=thus. ; āgatā=which comes in (Dī. 1, 234; Ma. 1, 47). ; sattesu=towards beings. ; majjhattākārabhūtā=which is in the manner of neutrality. ; yā upekkhā=whatever equanimity. ; atthi=there is. ; ayaṃ=this equanimity. ; brahmavihārupekkhā nāma=is called 'equanimity as a divine abiding'. ; upekkhāsahagatena=accompanied by specific neutrality equanimity. ; cetasā=with the mind of the fourth jhāna. ; ekaṃ=one. ; disaṃ=the beings in the direction. ; pharitvā=having pervaded. ; viharati=abides. ;

Myanmar Nissaya

pana=ထိုမှတပါး။ ; upekkhāsahagatena.la. viharatīti=ဟူ၍။ ; evaṃ=သို့။ ; āgatā=(ဒီ-၁၊ ၂၃၄။ မ-၁၊ ၄၇။) လာသော။ ; sattesu=တို့၌။ ; majjhattākārabhūtā=လျစ်လျူရှုသော အခြင်းအရာအားဖြင့် ဖြစ်သော။ ; yā upekkhā=သည်။ ; atthi=၏။ ; ayaṃ=ဤဥပေက္ခေါသည်။ ; brahmavihārupekkhā nāma=၏။ ; upekkhāsahagatena=တတြမဇ္ဈတ္တပေက္ခာနှင့် တကွဖြစ်သော။ ; cetasā=စတုတ္ထဈာန်ဖြင့်။ ; ekaṃ=တစ်ခုသော။ ; disaṃ=အရပ်၌ ရှိသော သတ္တဝါကို။ ; pharitvā=နှံ့စေ၍။ ; viharati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3472 | Chunk: 58

Yā pana ‘‘upekkhāsambojjhaṅgaṃ bhāveti vivekanissitan’’ ti ( ma. ni. 2.247) evamāgatā sahajātadhammānaṃ majjhattākārabhūtā upekkhā, ayaṃ bojjhaṅgupekkhā nāma.

AI Translation based on Nissaya

That equanimity which has come down as: 'develops the equanimity awakening factor, based on seclusion' (Ma. Ni. 2.247), and which is in the manner of neutrality towards co-arisen states—this is called equanimity as an awakening factor (bojjhaṅgupekkhā).

Vietnamese AI Translation

Xả được truyền lại như sau: 'phát triển xả giác chi, dựa trên sự ly' (Ma. Ni. 2.247), và theo cách trung lập đối với các trạng thái đồng sanh—đây được gọi là xả như một giác chi (bojjhaṅgupekkhā).

AI Translation Nissaya

pana=Furthermore. ; upekkhāsambojjhaṅgaṃ=bhāveti vivekanissitanti= as in 'develops the equanimity awakening factor, based on seclusion'. ; evaṃ=thus. ; āgatā=which comes in (Ma. 2, 204). ; sahajātadhammānaṃ=towards co-arisen states. ; vā=among co-arisen states. ; majjhattākārabhūtā=which is in the manner of neutrality. ; yā upekkhā=whatever equanimity. ; atthi=there is. ; ayaṃ upekkhā=this equanimity. ; bojjhaṅgupekkhānāma=is called 'equanimity as an awakening factor'. ; vivekanissitaṃ=based on the three kinds of seclusion. ; upekkhāsambojjhaṅgaṃ=the equanimity awakening factor. ; bhāveti=develops. ;

Myanmar Nissaya

pana=ထိုမှတပါး။ ; upekkhāsambojjhaṅgaṃ=ဘာဝေတိ ဝိဝေကနိဿိတန္တိ= ဟူ၍။ ; evaṃ=ဤသို့။ ; āgatā=(မ-၂၊ ၂၀၄။ ၌)လာသော။ ; sahajātadhammānaṃ=တို့ကို။ ; vā=တို့တွင်။ ; majjhattākārabhūtā=ဖြစ်သော။ ; yā upekkhā=သည်။ ; atthi=၏။ ; ayaṃ upekkhā=သည်။ ; bojjhaṅgupekkhānāma=မည်၏။ ; vivekanissitaṃ=ဝိဝေကသုံးပါးကို မှီသော။ ; upekkhāsambojjhaṅgaṃ=ကို။ ; bhāveti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3473 | Chunk: 58

Yā [M1.174] pana ‘‘kālena kālaṃ upekkhānimittaṃ manasikarotī’’ ti ( a. ni. 3.103) evamāgatā anaccāraddhanātisithilavīriyasaṅkhātā upekkhā, ayaṃ vīriyupekkhā nāma.

AI Translation based on Nissaya

That equanimity which [M1.174] has come down as: 'from time to time he gives attention to the sign of equanimity' (A. Ni. 3.103), and which is described as energy that is neither too strenuous nor too lax—this is called equanimity of energy (vīriyupekkhā).

Vietnamese AI Translation

Xả được [M1.174] truyền lại như sau: 'thỉnh thoảng vị ấy tác ý đến tướng xả' (A. Ni. 3.103), và được mô tả là năng lượng không quá căng thẳng cũng không quá chùng—đây được gọi là xả tinh tấn (vīriyupekkhā).

AI Translation Nissaya

pana=Furthermore. ; kālena.la. manasikarotīti=as in 'from time to time he gives attention to the sign of equanimity'. ; evaṃ=thus. ; āgatā=which comes in (A. 1, 258). ; anaccāraddhanātisithilavīriyasaṅkhātā=which is described as energy that is neither too strenuous nor too lax. ; upekkhā=equanimity. ; atthi=there is. ; ayaṃ=this equanimity. ; vīriyupekkhānāma=is called 'equanimity of energy'. ; kālena kālaṃ=from time to time. ; upekkhānimittaṃ=the sign which is balanced energy. ; manasikaroti=gives attention to. ;

Myanmar Nissaya

pana=ထိုမှတပါး။ ; kālena.la. manasikarotīti=ဟူ၍။ ; evaṃ=သို့။ ; āgatā=(အံ-၁။ ၂၅၈) လာသော။ ; anaccāraddhanātisithilavīriyasaṅkhātā=လွန်စွာ အားမထုတ်သော ဝီရိယ၊ အလွန်မလျှော့သော ဝီရိယဟု ဆိုအပ်သော။ ; upekkhā=သည်။ ; atthi=၏။ ; ayaṃ=ဤဥပေက္ခာ သည်။ ; vīriyupekkhānāma=မည်၏။ ; kālena kālaṃ=အခါလေးမြင့်။ ; upekkhānimittaṃ=အလတ်ဖြစ်သော ဝီရိယတည်းဟူသောအကြောင်းကို။ ; manasikaroti=နှလုံးသွင်း၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3474 | Chunk: 58

Yā pana ‘‘kati saṅkhārupekkhā samathavasena uppajjanti, kati saṅkhārupekkhā vipassanāvasena [V1.159] uppajjanti ?

AI Translation based on Nissaya

How many equanimities towards formations arise by way of serenity, and how many equanimities towards formations arise by way of insight [V1.159]?

Vietnamese AI Translation

Có bao nhiêu xả đối với các hành sanh khởi theo đường lối chỉ, và có bao nhiêu xả đối với các hành sanh khởi theo đường lối quán [V1.159]?

AI Translation Nissaya

pana=Furthermore. ; kati.la. uppajjantīti=as in 'How many... arise?'. ; evaṃ=thus. ; āgatā=which comes in this Paṭisambhidāmagga Pāḷi. ; nīvaraṇādipaṭisaṅkhāsantiṭṭhanāgahaṇe=in taking up the state of equanimity that is reached by striving in the abandoning of the hindrances and so on. ; majjhattabhūtā=which has become neutral. ; yā upekkhā=whatever equanimity. ; atthi=there is. ; ayaṃ upekkhā=this equanimity. ; saṅkhārupekkhānāma=is called 'equanimity towards formations'. ; kati=How many. ; saṅkhārupekkhā=equanimities towards formations. ; samathavasena=by way of serenity. ; uppajjanti=arise?. ; kati=How many. ; saṅkhārupekkhā=equanimities towards formations. ; vipassanāvasena=by way of insight. ; uppajjanti=arise?. ;

Myanmar Nissaya

pana=ထိုမှတပါး။ ; kati.la. uppajjantīti=ဟူ၍။ ; evaṃ=ဤသို့။ ; āgatā=ဤပဋိသမ္ဘိဒါမဂ်ပါဠိ၌လာသော။ ; nīvaraṇādipaṭisaṅkhāsantiṭṭhanāgahaṇe=နီဝရဏ အစရှိသည်တို့ကို ပယ်ခြင်း၌ အားထုတ်ခြင်းသို့ ရောက်သဖြင့် လျစ်လျူရှု၍ တည်သော (သာရတ္ထဒီပနီ) ဂဟဏေဥပ္ပါဒဘဝတ္တ အစရှိသော တရားကို ယူခြင်း၌။ ; (နီဝရဏ အစရှိသည်ကို ပယ်ခြင်း၌။) ; majjhattabhūtā=လျစ်လျူရှုသည်ဖြစ်၍ ဖြစ်သော။ ; yā upekkhā=သည်။ ; atthi=၏။ ; ayaṃ upekkhā=သည်။ ; saṅkhārupekkhānāma=မည်၏။ ; kati=ကုန်သော။ ; saṅkhārupekkhā=တို့သ်ည။ ; samathavasena=ဖြင့်။ ; uppajjanti=နည်း။ ; kati=သော။ ; saṅkhārupekkhā=တို့သည်။ ; vipassanāvasena=ဖြင့်။ ; uppajjanti=နည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3475 | Chunk: 58

Aṭṭha saṅkhārupekkhā samathavasena uppajjanti, dasa saṅkhārupekkhā vipassanāvasena uppajjantī’’ ti ( paṭi. ma. 1.57) evamāgatā nīvaraṇādipaṭisaṅkhāsantiṭṭhanāgahaṇe majjhattabhūtā upekkhā, ayaṃ saṅkhārupekkhā nāma.

AI Translation based on Nissaya

That equanimity which has come down as: 'Eight equanimities towards formations arise by way of serenity, ten equanimities towards formations arise by way of insight' (Paṭi. Ma. 1.57), and which has become neutral in taking up the state of abandoning the hindrances, etc.—this is called equanimity towards formations (saṅkhārupekkhā).

Vietnamese AI Translation

Xả được truyền lại như sau: 'Tám xả đối với các hành sanh khởi theo đường lối chỉ, mười xả đối với các hành sanh khởi theo đường lối quán' (Paṭi. Ma. 1.57), và đã trở nên trung lập trong việc đảm nhận trạng thái từ bỏ các triền cái, v.v.—đây được gọi là xả đối với các hành (saṅkhārupekkhā).

AI Translation Nissaya

aṭṭha=Eight. ; saṅkhārupekkhā=equanimities towards formations. ; samathavasena=by way of serenity. ; uppajjanti=arise. ; dassa=Ten. ; saṅkhārupekkhā=equanimities towards formations. ; vipassanāvasena=by way of insight. ; uppajjanti=arise. ;

Myanmar Nissaya

aṭṭha=ကုန်သော။ ; saṅkhārupekkhā=တို့သည်။ ; samathavasena=ဖြင့်။ ; uppajjanti=ကုန်၏။ ; dassa=ကုန်သော။ ; saṅkhārupekkhā=တို့သည်။ ; vipassanāvasena=ဖြင့်။ ; uppajjanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3476 | Chunk: 58

Yā pana ‘‘yasmiṃ samaye kāmāvacaraṃ kusalaṃ cittaṃ uppannaṃ hoti upekkhāsahagatan’’ ti ( dha. sa. 150) evamāgatā adukkhamasukhasaññitā upekkhā, ayaṃ vedanupekkhā nāma.

AI Translation based on Nissaya

That equanimity which has come down as: 'At a time when a wholesome sense-sphere consciousness has arisen, accompanied by equanimity' (Dha. Sa. 150), and which is called neither-painful-nor-pleasant feeling—this is called equanimity of feeling (vedanupekkhā).

Vietnamese AI Translation

Xả được truyền lại như sau: 'Vào thời điểm khi một tâm thiện dục giới đã sanh khởi, đi kèm với xả' (Dha. Sa. 150), và được gọi là cảm thọ không khổ không lạc—đây được gọi là xả thọ (vedanupekkhā).

AI Translation Nissaya

pana=Furthermore. ; yasmiṃ.la. upekkhāsahagatanti=as in 'At a time when a wholesome sense-sphere consciousness has arisen, accompanied by equanimity'. ; evaṃ=thus. ; āgatā=(in Abhi. 1, 40). ; adukkhamasukhasaññitā=which is called neither-painful-nor-pleasant feeling. ; yā upekkhā=whatever equanimity. ; atthi=there is. ; ayaṃ upekkhā=this equanimity. ; vedanupekkhānāma=is called 'equanimity of feeling'. ; yasmiṃ samaye=at which time, said to be the ninth moment of the Buddha's arising. ; upekkhāsahagataṃ=accompanied by equanimity. ; kamāvacaraṃ=of the sense-sphere. ; kusalaṃ=wholesome. ; cittaṃ=consciousness. ; uppannaṃ=has reached the three moments. ; hoti=it is. ;

Myanmar Nissaya

pana=ထိုမှတပါး။ ; yasmiṃ.la. upekkhāsahagatanti=ဟူ၍။ ; evaṃ=သို့။ ; āgatā=(အဘိ-၁၊ ၄၀။ ၌။) လာသော။ ; adukkhamasukhasaññitā=ဥပေက္ခာဝေဒနာဟု ဆိုအပ်သော။ ; yā upekkhā=သည်။ ; atthi=ရှိ၏။ ; ayaṃ upekkhā=သည်။ ; vedanupekkhānāma=မည်၏။ ; yasmiṃ samaye=အကြင်ဗုဒ္ဓုပ္ပါဒနဝမခဏဟု ဆိုအပ်သော အခါ၌။ ; upekkhāsahagataṃ=သော။ ; kamāvacaraṃ=သော။ ; kusalaṃ=သော်။ ; cittaṃ=စိတ်သည်။ ; uppannaṃ=ခဏတ္တယသို့ ရောက်သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3477 | Chunk: 58

Yā ‘‘yadatthi yaṃ bhūtaṃ, taṃ pajahati, upekkhaṃ paṭilabhatī’’ ti ( ma. ni. 3.71; a. ni. 7.55) evamāgatā vicinane majjhattabhūtā upekkhā, ayaṃ vipassanupekkhā nāma.

AI Translation based on Nissaya

That equanimity which has come down as: 'Whatever is, whatever has come to be, that he leaves behind, he attains equanimity' (Ma. Ni. 3.71; A. Ni. 7.55), and which has become neutral in investigation—this is called equanimity of insight (vipassanupekkhā).

Vietnamese AI Translation

Xả được truyền lại như sau: 'Bất cứ cái gì, bất cứ cái gì đã trở thành, vị ấy bỏ lại, vị ấy đạt được xả' (Ma. Ni. 3.71; A. Ni. 7.55), và đã trở nên trung lập trong sự điều tra—đây được gọi là xả tuệ (vipassanupekkhā).

AI Translation Nissaya

yadatthi.la. paṭilabhatīti=as in 'Whatever is, whatever has come to be, that he leaves behind, he attains equanimity'. ; evaṃ=thus. ; āgatā=which comes in (Ma. 3, 51; A. 2, 450). ; vicinane=in investigation. ; vā=in contemplation. ; majjhattabhūtā=which has become neutral. ; yā upekkhā=whatever equanimity. ; atthi=there is. ; ayaṃ upekkhā=this equanimity. ; vipassanupekkhānāma=is called 'equanimity of insight'. ; yaṃ=Whatever five aggregates. ; atthi=exist. ; yaṃ=whatever phenomena. ; bhūtaṃ=has manifestly come to be. ; taṃ=that phenomena. ; pajahati=one abandons with the knowledge of desire for deliverance. ; upekkhaṃ=equanimity in investigating the characteristics of formations. ; paṭilabhati=one attains. ;

Myanmar Nissaya

yadatthi.la. paṭilabhatīti=ဟူ၍။ ; evaṃ=သို့။ ; āgatā=(မ-၃၊ ၅၁။ အံ့-၂၊ ၄၅၀။တို့၌) လာသော။ ; vicinane=စူးစမ်းဆင်ခြင်ခြင်း၌။ ; vā=သုံးသပ်ခြင်း၌။ ; majjhattabhūtā=ဖြစ်သော။ ; yā upekkhā=သည်။ ; atthi=၏။ ; ayaṃ upekkhā=သည်။ ; vipassanupekkhānāma=၏။ ; yaṃ=အကြင်ခန္ဓာငါးပါး တရားသည်။ ; atthi=၏။ ; yaṃ=တရားသည်။ ; bhūtaṃ=ထင်ရှားဖြစ်၏။ ; taṃ=တရားကို။ ; pajahati=မုစ္စိတုကမျတာဉာဏ်ဖြင့် ပယ်၏။ ; upekkhaṃ=သင်္ခါရလက္ခဏာကို စူးစမ်းဆင်ခြင်ခြင်း၌ လျစ်လျူရှုခြင်းကို။ ; paṭilabhati=ရ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3478 | Chunk: 58

Yā pana chandādīsu yevāpanakesu āgatā sahajātānaṃ samavāhitabhūtā upekkhā, ayaṃ tatramajjhattupekkhā nāma.

AI Translation based on Nissaya

That equanimity which is included among the 'facultative' mental factors, such as intention, etc., and which becomes the cause for the balance of co-arisen states—this is called specific neutrality (tatramajjhattupekkhā).

Vietnamese AI Translation

Xả được bao gồm trong số các tâm sở 'biến hành', chẳng hạn như tác ý, v.v., và trở thành nguyên nhân cho sự cân bằng của các trạng thái đồng sanh—đây được gọi là hành xả (tatramajjhattupekkhā).

AI Translation Nissaya

pana=Furthermore. ; chandādīsu=such as intention, etc.. ; yevāpanakesu=among the 'facultative' mental factors. ; āgatā=that has come. ; sahajātānaṃ=of co-arisen states. ; samavāhitabhūtā=which has become the cause for being well-balanced. ; yā upekkhā=whatever equanimity. ; atthi=there is. ; ayaṃ upekkhā=this equanimity. ; tatramajjhattupekkhā nāma=is called 'specific neutrality'. ;

Myanmar Nissaya

pana=ထိုမှတပါး။ ; chandādīsu=အစရှိကုန်သော။ ; yevāpanakesu=ယေဝါပနကစေတသိက်တို့၌။ ; āgatā=လာမသာ။ ; sahajātānaṃ=သဟဇာတ်တရားတို့၏။ ; samavāhitabhūtā=အညီအညွတ်ဖြစ်ခြင်း၏ အကြောင်းဖြစ်၍ ဖြစ်သော။ ; yā upekkhā=သည်။ ; atthi=၏။ ; ayaṃ upekkhā=သည်။ ; tatramajjhattupekkhā nāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3479 | Chunk: 58

Yā pana ‘‘upekkhako ca viharatī’’ ti ( dha. sa. 163; dī. ni. 1.230) evamāgatā aggasukhepi tasmiṃ apakkhapātajananī upekkhā, ayaṃ jhānupekkhā nāma.

AI Translation based on Nissaya

That equanimity which has come down as: 'and abides equanimous' (Dha. Sa. 163; Dī. Ni. 1.230), and which generates non-partiality even in the face of that supreme happiness [of the third jhāna]—this is called equanimity of jhāna (jhānupekkhā).

Vietnamese AI Translation

Xả được truyền lại như sau: 'và an trú xả' (Dha. Sa. 163; Dī. Ni. 1.230), và tạo ra sự không thiên vị ngay cả khi đối mặt với lạc tối thượng đó [của tam thiền]—đây được gọi là xả thiền (jhānupekkhā).

AI Translation Nissaya

pana=Furthermore. ; upekkhākoca=and being equanimous. ; viharati=abides. ; itievaṃ=thus. ; āgatā=which comes (in the Pāḷi for the third jhāna). ; aggasukhepi=which is also the supreme happiness. ; tasmiṃ=in that third jhāna. ; apakkhapātajananī=which generates non-partiality between excess and deficiency. ; yā upekkhā=whatever equanimity. ; atthi=there is. ; ayaṃ upekkhā=this equanimity. ; jhānupekkhānāma=is called 'equanimity of jhāna'. ;

Myanmar Nissaya

pana=ထိုမှ တပါး။ ; upekkhākoca=လျစ်လျူရှုသည်ဖြစ်၍လည်း။ ; viharati=နေ၏။ ; itievaṃ=ဤသို့။ ; āgatā=(တတိယဈာန်ပါဠိ၌) လာသော။ ; aggasukhepi=မြတ်သော သုခလည်းဖြစ်သော။ ; tasmiṃ=ထိုတတိယဈာန်၌။ ; apakkhapātajananī=လွန်ခြင်းယုတ်ခြင်းတို့၏ အဖို့၌ မကျခြင်းကို ဖြစ်စေတတ်သော။ ; yā upekkhā=သည်။ ; atthi=၏။ ; ayaṃ upekkhā=သည်။ ; jhānupekkhānāma=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3480 | Chunk: 58

Yā pana ‘‘upekkhāsatipārisuddhiṃ catutthaṃ jhānan’’ ti ( dha. sa. 165; dī. ni. 1.232) evamāgatā sabbapaccanīkaparisuddhā paccanīkavūpasamanepi abyāpārabhūtā upekkhā, ayaṃ pārisuddhupekkhā nāma.

AI Translation based on Nissaya

That equanimity which has come down as: 'the fourth jhāna, which has purity of mindfulness due to equanimity' (Dha. Sa. 165; Dī. Ni. 1.232), and which is purified of all opposing states and has become without concern even in the stilling of those opposing states—this is called equanimity of purity (pārisuddhupekkhā).

Vietnamese AI Translation

Xả được truyền lại như sau: 'tứ thiền, có sự thanh tịnh của chánh niệm do xả' (Dha. Sa. 165; Dī. Ni. 1.232), và được thanh lọc khỏi tất cả các trạng thái đối nghịch và đã trở nên không quan tâm ngay cả trong sự lắng dịu của các trạng thái đối nghịch đó—đây được gọi là xả thanh tịnh (pārisuddhupekkhā).

AI Translation Nissaya

pana=Furthermore. ; upekkhāsatipārisuddhiṃ=the purity of mindfulness which is due to equanimity. ; catutthaṃ=the fourth. ; jhānaṃ=jhāna. ; iti evaṃ=thus. ; āgatā=which comes (in the Pāḷi for the fourth jhāna). ; sabbapaccanīkaparisuddhā=which is purified from all opposing states (hindrances). ; paccanīkavūpasamanepi=even in the stilling of the opposing hindrances. ; abyāpārabhūtā=which has become without concern. ; vā=or which has reached the state of no concern. ; yā upekkhā=whatever equanimity. ; atthi=there is. ; ayaṃ upeukhā=this equanimity. ; pārisuddhupekkhānāma=is called 'equanimity of purity'. ;

Myanmar Nissaya

pana=ထိုမှတပါး။ ; upekkhāsatipārisuddhiṃ=ဥပေက္ခာသည် ဖြစ်စေအပ်သော သတိ၏ စင်ကြယ်ခြင်းရှိသော။ ; catutthaṃ=လေးကြိမ်မြောက်ရအပ်သော။ ; jhānaṃ=ကို။ ; iti evaṃ=သို့။ ; āgatā=(စတုတ္ထဈာန်ပါဠိ၌) လာသော။ ; sabbapaccanīkaparisuddhā=ဆန့်ကျင်ဘက် နီဝရဏတို့မှ စင်ကြယ်သော။ ; paccanīkavūpasamanepi=ဆန့်ကျင်ဘက်နီဝစရဏ တို့ကို ငြိမ်းစေခြင်း၌လည်း။ ; abyāpārabhūtā=ကြောင့်ကြခြင်းမရှိသော အားဖြင့်ဖြစ်သော။ ; vā=ကြောင့်ကြခြင်း မရှိသည်၏ အဖြစ်သို့ ရောက်သော။ ; yā upekkhā=သည်။ ; atthi=၏။ ; ayaṃ upeukhā=သည်။ ; pārisuddhupekkhānāma=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3481 | Chunk: 58

Tattha [P1.188] chaḷaṅgupekkhā ca brahmavihārupekkhā ca bojjhaṅgupekkhā ca tatramajjhattupekkhā ca jhānupekkhā ca pārisuddhupekkhā ca atthato ekā, tatramajjhattupekkhāva hoti.

AI Translation based on Nissaya

Among these, [P1.188] six-factored equanimity, equanimity as a divine abiding, equanimity as an awakening factor, specific neutrality, equanimity of jhāna, and equanimity of purity are one in essence; they are all just specific neutrality.

Vietnamese AI Translation

Trong số này, [P1.188] xả sáu chi, xả như một phạm trú, xả như một giác chi, hành xả, xả thiền, và xả thanh tịnh là một về bản chất; tất cả chúng chỉ là hành xả.

AI Translation Nissaya

tattha=Among those ten kinds of equanimity. ; chaḷaṅgupekkhāca=six-factored equanimity. ; brahmavihārupekkhāca=equanimity as a divine abiding. ; bojjhaṅgupekkhāca=equanimity as an awakening factor. ; tatramajjhattu pekkhāca=specific neutrality. ; jhānupekkhāca=equanimity of jhāna. ; pārisuddhupekkhāca=and equanimity of purity. ; atthato=in terms of their intrinsic nature. ; ekā=are one. ; tatramajjhattupekkhāva=they are simply specific neutrality. ; hoti=they are. ;

Myanmar Nissaya

tattha=ထိုဆယ်ပါးသော ဥပေက္ခာတို့တွင်။ ; chaḷaṅgupekkhāca=သည်လည်းကောင်း။ ; brahmavihārupekkhāca=သည်လည်းကောင်း။ ; bojjhaṅgupekkhāca=သည်လည်းကောင်း။ ; tatramajjhattu pekkhāca=သည်လည်းကောင်း။ ; jhānupekkhāca=သည်လည်းကောင်း။ ; pārisuddhupekkhāca=သည်လည်းကောင်း။ ; atthato=တရားကိုယ်အားဖြင့်။ ; ekā=တစ်ပါးတည်းသော။ ; tatramajjhattupekkhāva=သည်သာလျှင်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3482 | Chunk: 58

Tena tena avatthābhedena panassāyaṃ bhedo.

AI Translation based on Nissaya

But this distinction of it arises through this or that difference in state.

Vietnamese AI Translation

Nhưng sự phân biệt này của nó khởi lên thông qua sự khác biệt này hay khác biệt kia trong trạng thái.

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3483 | Chunk: 58

Ekassāpi sato sattassa kumārayuvattherasenāpatirājādivasena bhedo viya, tasmā tāsu yattha chaḷaṅgupekkhā, na tattha bojjhaṅgupekkhādayo.

AI Translation based on Nissaya

Just as there are distinctions for a single being by way of being a child, a youth, an elder, a general, a king, and so on, so this distinction of equanimity arises through this or that difference of state. Therefore, among them, where there is six-factored equanimity, there are not equanimity as an awakening factor and so on.

Vietnamese AI Translation

Cũng giống như có những sự phân biệt đối với một chúng sinh duy nhất qua các phương diện là một đứa trẻ, một thanh niên, một người lớn tuổi, một vị tướng, một vị vua, v.v., thì sự phân biệt về tâm xả này cũng khởi lên thông qua sự khác biệt này hay khác biệt kia của trạng thái. Do đó, trong số chúng, ở đâu có tâm xả sáu chi phần, thì ở đó không có tâm xả như là một giác chi, v.v.

AI Translation Nissaya

pana taṃ pākaṭaṃ karomi=I will make this clear. ; ekassāpi=even of a single. ; sattassa=being. ; kumārayuvattherasenāpatarājādivasena=by way of being a child, a youth, an elder, a general, a king, etc.. ; bhedo viya=just as there are distinctions. ; tena tena avatthābhedena=through this or that difference of state. ; assa=of that equanimity. ; ayaṃ bhedo=this distinction. ; hoti=arises. ; tasmā=Therefore. ; tāsu=among those ten equanimities. ; nahonti=they do not occur. ;

Myanmar Nissaya

pana taṃ pākaṭaṃ karomi=အံ့။ ; ekassāpi=တစ်ပါးတည်းလည်းဖြစ်သော။ ; sattassa=အား။ ; kumārayuvattherasenāpatarājādivasena=သူငယ်, လုလင်ပျို၊မထေရ်, စစ်မှူး၊ ပြည့်ရှင်မင်း အစရှိသည်အစွမ်းဖြင့်။ ; bhedo viya=ပြားသကဲ့သို့။ ; tena tena avatthābhedena=ထိုထိုအခိုက်အတန့်အထူးအားဖင့်။ ; assa=ထိုဥပေက္ခာ၏။ ; ayaṃ bhedo=ဤသို့ သော အပြားသည်။ ; hoti=၏။ ; tasmā=ကြောင့်။ ; tāsu=ထိုဆယ်ပါးသော ဥပေက္ခာတို့တွင်။ ; nahonti=မဖြစ်ကုန်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3484 | Chunk: 58

Yattha vā pana bojjhaṅgupekkhā, na tattha chaḷaṅgupekkhādayo hontīti veditabbā.

AI Translation based on Nissaya

Or, where there is equanimity as an awakening factor, six-factored equanimity and the others are not present. Thus it should be understood.

Vietnamese AI Translation

Hoặc, ở đâu có tâm xả như là một giác chi, thì tâm xả sáu chi phần và các loại khác không có mặt. Cần phải được hiểu như vậy.

AI Translation Nissaya

vā pana=Furthermore. ; yattha=wherever. ; bojjhaṅgupekkhā=equanimity as an awakening factor. ; hoti=is present. ; tattha=there. ; chaḷaṅgupekkhādayo=six-factored equanimity and the others. ; nahonti=are not present. ; iti=Thus. ; veditabbā=it should be understood. ;

Myanmar Nissaya

vā pana=ထိုမှ တစ်ပါး။ ; yattha=အကြင်အခါ၌။ ; bojjhaṅgupekkhā=သည်။ ; hoti=၏။ ; tattha=ထိုအခါ၌။ ; chaḷaṅgupekkhādayo=တို့သည်။ ; nahonti=မဖြစ်ကုန်။ ; iti=သို့။ ; veditabbā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3485 | Chunk: 58

Yathā [M1.175] cetāsaṃ atthato ekībhāvo, evaṃ saṅkhārupekkhāvipassanupekkhānampi.

AI Translation based on Nissaya

And [M1.175] just as these are one in essence, so too are equanimity towards formations and equanimity of insight.

Vietnamese AI Translation

Và [M1.175] cũng giống như những loại này là một về bản chất, thì hành xả và tuệ xả cũng vậy.

AI Translation Nissaya

ca=Furthermore. ; etāsaṃ=of these six kinds of equanimity. ; atthato=in terms of their intrinsic nature. ; ekībhāvo=the state of being one. ; hotiyathā=just as it is. ; evaṃ tathā=in the same way. ; saṅkhārupekkhāvipassanupekkhānampi=of equanimity towards formations and equanimity of insight as well. ; ekībhāvo=the state of being one. ; hoti=is. ;

Myanmar Nissaya

ca=ထို မှ တပါး။ ; etāsaṃ=ထိုခြောက်ပါးသော ဥပေက္ခာတို့၏။ ; atthato=တရားကိုယ် အားဖြင့်။ ; ekībhāvo=တစ်ခုတည်း၏ အဖြစ်သည်။ ; hotiyathā=သို့။ ; evaṃ tathā=တူ။ ; saṅkhārupekkhāvipassanupekkhānampi=တို့၏လည်း။ ; ekībhāvo=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3486 | Chunk: 58

Paññā eva hi sā, kiccavasena dvidhā bhinnā.

AI Translation based on Nissaya

Indeed, it is simply wisdom; it is divided in two ways by way of its function.

Vietnamese AI Translation

Thật vậy, nó chỉ đơn thuần là trí tuệ; nó được chia thành hai loại theo phương diện chức năng của nó.

AI Translation Nissaya

hi saccaṃ=Indeed. ; paññāeva=it is just wisdom. ; sā=That equanimity. ; kiccapasena=by way of function. ; dvidhā=in two ways. ; bhinnā=is divided. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; paññāeva=ပညာသာလျှင်ဖြစ်သော။ ; sā=ထိုဥပေက္ခာသည်။ ; kiccapasena=ဖြင့်။ ; dvidhā=ဖြင့်။ ; bhinnā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3487 | Chunk: 58

Yathā hi purisassa sāyaṃ gehaṃ paviṭṭhaṃ sappaṃ ajapadadaṇḍaṃ gahetvā pariyesamānassa taṃ thusakoṭṭhake nipannaṃ disvā ‘‘sappo nu kho, no’’ ti avalokentassa sovatthikattayaṃ [V1.160] disvā nibbematikassa ‘‘sappo, na sappo’’ ti vicinane majjhattatā uppajjati, evameva yā āraddhavipassakassa vipassanāñāṇena lakkhaṇattaye diṭṭhe saṅkhārānaṃ aniccabhāvādivicinane majjhattatā uppajjati, ayaṃ vipassanupekkhā.

AI Translation based on Nissaya

Indeed, just as for a person who, having taken a forked stick, is searching for a snake that entered his house in the evening, and upon seeing it lying in a pile of chaff [V1.160] and looking down at it, thinking, 'Is it a snake, or not?', sees its three coils and becomes free from doubt, and a neutrality arises in the examination of whether 'it is a snake' or 'not a snake'—in the very same way, for a meditator who has undertaken insight practice, when the three characteristics have been seen by means of insight knowledge, whatever neutrality arises in the examination of the nature of formations as impermanent, etc., this is equanimity of insight.

Vietnamese AI Translation

Thật vậy, cũng giống như một người, sau khi lấy một cây gậy có chĩa, đang tìm kiếm một con rắn đã vào nhà mình vào buổi tối, và khi nhìn thấy nó nằm trong một đống trấu [V1.160] và nhìn xuống nó, nghĩ rằng: 'Đây có phải là một con rắn, hay không?', rồi thấy được ba khúc uốn của nó và thoát khỏi nghi ngờ, và một sự trung lập khởi lên trong việc xem xét 'đó là một con rắn' hay 'không phải là một con rắn' — cũng theo cách tương tự, đối với một hành giả đã thực hành tuệ quán, khi tam tướng đã được thấy bằng tuệ minh sát, bất cứ sự trung lập nào khởi lên trong việc xem xét bản chất của các hành là vô thường, v.v., thì đây chính là tuệ xả.

AI Translation Nissaya

hi taṃ pākaṭaṃ karomi=Indeed, I shall make it clear. ; sāyaṃ=In the evening. ; gehaṃ=into the house. ; paviṭṭhaṃ=that has entered. ; sappaṃ=a snake. ; ajapadadaṇḍaṃ=a goat-foot staff (forked stick). ; gahetvā=having taken. ; pariyesamānassa=for one who is searching. ; taṃ=that snake. ; thusakoṭṭhako=in a pile of chaff. ; vā=or a heap of chaff. ; nipannaṃ=lying down. ; disvā=having seen. ; sapponukho='Is it a snake, I wonder?'. ; no='Or not?'. ; iti=thus. ; avalokentassa=for one looking down. ; sovatthi kattayaṃ=the three coils. ; disvā=having seen. ; nibbematikassa=for one who is free from doubt. ; purisassa=for the person. ; sappo='It is a snake'. ; na sappo='It is not a snake'. ; iti=thus. ; vicinane=in the examination. ; majjhattatā=a state of neutrality. ; uppajjatiyathā=just as it arises. ; evameva=in the very same way. ; āraddhavipassakassa=for a meditator who has undertaken insight practice. ; vipassanāñāṇena=by means of insight knowledge. ; lakkhaṇattaye=the three characteristics. ; diṭṭhe=when seen. ; saṅkhārānaṃ=of formations. ; aniccabhāvādivicinane=in the examination of their nature of impermanence, etc. ; vā=or in the consideration of their nature as impermanent, etc.. ; yā ajjhattatā=whatever state of neutrality. ; uppajjati=arises. ; ayaṃ=this state of neutrality. ; vipassanupekkhā=is 'equanimity of insight'. ;

Myanmar Nissaya

hi taṃ pākaṭaṃ karomi=အံ့။ ; sāyaṃ=ညဉ့်ဦးယံ၌။ ; gehaṃ=အိမ်တွင်းသို့။ ; paviṭṭhaṃ=ဝင်လာသော။ ; sappaṃ=မြွေကို။ ; ajapadadaṇḍaṃ=ဆိတ်ခြေသဏ္ဌာန်၌ ပြုအပ်သော လှံတံကို။ ; gahetvā=၍။ ; pariyesamānassa=ရှာဖွေသော။ ; taṃ=ထိုမြွေကို။ ; thusakoṭṭhako=ဖွဲ့အစု၌။ ; vā=ဖွဲ့ပုံ၌။ ; nipannaṃ=အိပ်သည်ကို။ ; disvā=မြင်၍။ ; sapponukho=မြွေလော။ ; no=မြွေမဟုတ်လော။ ; iti=သို့။ ; avalokentassa=ငုံ့၍ကြည့်သော်။ ; sovatthi kattayaṃ=လည်းရေသုံးဆင့်ကို။ ; disvā=မြင်၍။ ; nibbematikassa=ယုံမှားကင်းပြီးသော။ ; purisassa=အား။ ; sappo=မြွေတည်း။ ; na sappo=မြွေမဟုတ်။ ; iti=သို့။ ; vicinane=စူးစမ်းဆင်ခြင်ခြင်း၌။ ; majjhattatā=လျစ်လျူရှုသည်၏ အဖြစ်သည်။ ; uppajjatiyathā=ကဲ့သို့။ ; evameva=လျှင်။ ; āraddhavipassakassa=အားထုတ်အပ်ပြီးသော ဝိပဿနာရှိသော ပုဂ္ဂိုလ်အား။ ; vipassanāñāṇena=ဖြင့်။ ; lakkhaṇattaye=လက္ခဏာ ရေးတို့၏ သုံးပါးတို့၏ အပေါင်းကို။ ; diṭṭhe=သော်။ ; saṅkhārānaṃ=တို့၏။ ; aniccabhāvādivicinane=အနိစ္စ အစရှိသည်ကို စူးစမ်းဆင်ခြင်ခြင်း၌။ ; vā=အနိစ္စသဘောအစရှိသော အားဖြင့် သုံးသပ်ခြင်း၌။ ; yā ajjhattatā=အကြင်လျစ်လျူရှုသည်၏ အဖြစ်သည။ ; uppajjati=၏။ ; ayaṃ=ဤလျစ်လျူရှုသည်၏ အဖြစ်သည်။ ; vipassanupekkhā=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3488 | Chunk: 58

Yathā pana tassa purisassa ajapadadaṇḍena gāḷhaṃ sappaṃ gahetvā ‘‘kintāhaṃ imaṃ sappaṃ aviheṭhento attānañca iminā aḍaṃsāpento muñceyyan’’ ti muñcanākārameva pariyesato gahaṇe majjhattatā hoti, evameva yā lakkhaṇattayassa diṭṭhattā āditte viya tayo bhave passato saṅkhāragahaṇe majjhattatā, ayaṃ saṅkhārupekkhā.

AI Translation based on Nissaya

And just as for that person who, having firmly pinned the snake with the forked stick, searches only for a way to release it, thinking, 'How can I release this snake without harming it and without being bitten by it myself?', and a neutrality arises in the act of grasping; in the very same way, for a meditator who, having seen the three characteristics, sees the three realms of existence as if on fire, whatever neutrality there is in the grasping of formations, this is equanimity towards formations.

Vietnamese AI Translation

Và cũng giống như người đó, sau khi đã ghim chặt con rắn bằng cây gậy có chĩa, chỉ tìm cách để thả nó ra, nghĩ rằng: 'Làm thế nào để ta có thể thả con rắn này ra mà không làm hại nó và cũng không bị nó cắn?', và một sự trung lập khởi lên trong hành động nắm giữ; cũng theo cách tương tự, đối với một hành giả, sau khi đã thấy tam tướng, thấy ba cõi hữu như đang bốc cháy, bất cứ sự trung lập nào có trong việc nắm giữ các hành, thì đây chính là hành xả.

AI Translation Nissaya

pana=Now I will speak about equanimity towards formations. ; ajapadadaṇḍena=with a goat-foot staff (forked stick). ; pāḷhaṃ=firmly. ; sappaṃ=the snake. ; gahetvā=having caught. ; kinti=How could it be that. ; ahaṃ=I. ; imaṃsappaṃ=this snake. ; aviheṭhento=not harming it. ; hutvā=being. ; attānañṇa=my own body. ; iminā=by this snake. ; vā=it. ; aṭaṃsāpento=not causing it to bite. ; hutvā=being. ; muñceyya=could release it?. ; iti=thus. ; muñcanākārameva=only the manner of release. ; pariyesato=for one searching. ; tassa purisassa=for that man who found the snake. ; gahaṇe=in the act of catching. ; majjhattatā=a state of neutrality. ; hoti yathā=just as there is. ; evameva=in the very same way. ; lakkhaṇattayassa=the three characteristics. ; diṭṭhattā=because of having been seen. ; āditteviya=like a great blazing fire. ; tayobhave=the three realms of existence. ; passato=for one who sees. ; saṅkhāragahaṇe=in the grasping of formations. ; yā majjhattatā=whatever neutrality. ; atthi=there is. ; ayaṃ ajjhattatā=this neutrality. ; saṅkhārupekkhā=is 'equanimity towards formations'. ;

Myanmar Nissaya

pana=သင်္ခါရုပေက္ခာကို ဆိုအံ့။ ; ajapadadaṇḍena=ဆိတ်ခြေ သဏ္ဌာန်ပြုအပ်သော လှံတံဖြင့်။ ; pāḷhaṃ=ကြပ်ကြပ်။ ; sappaṃ=မြွေကို။ ; gahetvā=ဖမ်း၍။ ; kinti=အတီသို့ မူ၍လည်း။ ; ahaṃ=သည်။ ; imaṃsappaṃ=ဤမြွေကို။ ; aviheṭhento=မညှဉ်းဆဲသည်။ ; hutvā=၍။ ; attānañṇa=ငါ၏ ကိုယ်ကိုလည်း။ ; iminā=ဤမြွေသည်။ ; vā=ကို။ ; aṭaṃsāpento=မထိုက်စေသည်။ ; hutvā=၍။ ; muñceyya=လွတ်ပါရအံ့နည်း။ ; iti=သို့။ ; muñcanākārameva=လွတ်ရအံ့သော အခြင်းအရာကိုသာလျှင်။ ; pariyesato=ရှာသော။ ; tassa purisassa=ထိုမြွေကို တွေ့သော ယောင်္ကျားအား။ ; gahaṇe=ဖမ်းယူခြင်း၌။ ; majjhattatā=လျစ်လျူရှုသည်၏ ဖြစ်သည်။ ; hoti yathā=ကဲ့သို့။ ; evameva=သာလျှင်။ ; lakkhaṇattayassa=လက္ခဏာရေးတို့၏ သုံးပါးတို့၏ အပေါင်းကို။ ; diṭṭhattā=မြင်အပ်သည်၏ အဖြစ်ကြောင့်။ ; āditteviya=တပြောင်ပြောင် တောက်လောင်သော မီးပုံကြီးကဲ့သို့။ ; tayobhave=ဘုံသုံးပါးတို့ကို။ ; passato=ရှုသော ယောဂီ ပုဂ္ဂိုလ်အား။ ; saṅkhāragahaṇe=သင်္ခါရတရားတို့ကို သိမ်းဆည်းခြင်း၌။ ; yā majjhattatā=သည်။ ; atthi=၏။ ; ayaṃ ajjhattatā=သည်။ ; saṅkhārupekkhā=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3489 | Chunk: 58

Iti vipassanupekkhāya siddhāya saṅkhārupekkhāpi siddhāva hoti.

AI Translation based on Nissaya

Thus, when equanimity of insight is accomplished, equanimity towards formations is also accomplished.

Vietnamese AI Translation

Do đó, khi tuệ xả được thành tựu, hành xả cũng được thành tựu.

AI Translation Nissaya

iti=Thus. ; vipassanupekkhāya=equanimity of insight. ; siddhāya=when accomplished. ; saṅkhāru pekkhāpi=equanimity towards formations also. ; siddhāva=is certainly accomplished. ; hoti=is. ;

Myanmar Nissaya

iti=သို့။ ; vipassanupekkhāya=သည်။ ; siddhāya=သော်။ ; saṅkhāru pekkhāpi=သည်လည်း။ ; siddhāva=ပြီးပြီသည်သာလျှင်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3490 | Chunk: 58

Iminā panesā vicinanagahaṇesu majjhattasaṅkhātena kiccena dvidhā bhinnāti.

AI Translation based on Nissaya

Nevertheless, this wisdom is distinguished in two ways by this function, which is called neutrality in investigating and grasping.

Vietnamese AI Translation

Tuy nhiên, trí tuệ này được phân biệt thành hai loại bởi chức năng này, được gọi là sự trung lập trong việc thẩm xét và nắm giữ.

AI Translation Nissaya

pana tathāpi=Nevertheless, though it is accomplished. ; esā paññā=this wisdom. ; vicinanagahaṇesu=in investigating and grasping. ; majjhatta saṅkhātena=which is called neutrality. ; iminā kiccena=by this function. ; dvidhā=in two ways. ; bhinnā=is distinguished. ; hoti=it is. ; iti=Thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

pana tathāpi=ထိုသို့ ပြီးသော်လည်း။ ; esā paññā=ဤပညာသည်။ ; vicinanagahaṇesu=ဆင်ခြင်ခြင်း သုံးသပ်ခြင်းတို့၌။ ; majjhatta saṅkhātena=လျစ်လျူရှုခြင်းဟု ဆိုအပ်သော။ ; iminā kiccena=ဖြင့်။ ; dvidhā=ဖြင့်။ ; bhinnā=သည်။ ; hoti=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3491 | Chunk: 58

Vīriyupekkhā pana vedanupekkhā ca aññamaññañca avasesāhi ca atthato bhinnā evāti.

AI Translation based on Nissaya

Equanimity of energy and equanimity of feeling, however, are certainly distinct in essence from each other and from the remaining eight kinds. Thus it should be understood.

Vietnamese AI Translation

Tuy nhiên, tinh tấn xả và thọ xả chắc chắn khác biệt về bản chất với nhau và với tám loại còn lại. Cần phải được hiểu như vậy.

AI Translation Nissaya

pana=Furthermore. ; vīriyupekkhā=equanimity of energy. ; vedanupekkhāca=and equanimity of feeling. ; aññamaññañca=from each other, and. ; avasesāhica=from the remaining eight kinds of equanimity. ; atthato=in terms of their intrinsic nature. ; bhinnāeva=are certainly distinct. ; iti=Thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

pana=ထိုမှတပါး။ ; vīriyupekkhā=သည်လည်းကောင်း။ ; vedanupekkhāca=သည်လည်းကောင်း။ ; aññamaññañca=အချင်းချင်းသည်လည်းကောင်း။ ; avasesāhica=ကြွင်းသော ဥပေက္ခာ ရှစ်ပါးတို့နှင့်လည်းကောင်း။ ; atthato=တရားကိုယ်အားဖြင့်။ ; bhinnāeva=သာလျှင်တည်း။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3492 | Chunk: 58

‘‘Majjhattabrahmabojjhaṅgachaḷaṅgajhānasuddhiyo;

AI Translation based on Nissaya

“Neutrality, divine abiding, awakening factor, six-factored, jhāna, and purity;

Vietnamese AI Translation

“Trung lập, phạm trú, giác chi, sáu chi phần, thiền, và thanh tịnh;

AI Translation Nissaya

ca=Now I will recite a summary verse. ; ettha=In these ten kinds of equanimity. ; majjhattabrahmabojjhaṅga.la.=Neutrality, divine abiding, awakening factor.... ;

Myanmar Nissaya

ca=အကျဉ်း သင်္ဂဟ ဂါထာကို ဆိုအံ့။ ; ettha=ဤဆယ်ပါးသော ဥပေက္ခာ၌။ ; majjhattabrahmabojjhaṅga.la.= ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3493 | Chunk: 58

Duve paññā tato dvīhi, catassova bhavantimā’’ ti.

AI Translation based on Nissaya

Two are wisdom, and from the other two, there are just these four.”

Vietnamese AI Translation

Hai là trí tuệ, và từ hai loại kia, chỉ có bốn loại này.”

AI Translation Nissaya

bhavantimātigāthādvayaṃ=these two summary verses. ; āha=were said. ; ajjhattabrahmābojjhaṅgachaḷaṅgajhānasuddhiyo=Specific neutrality, equanimity as a divine abiding, as an awakening factor, six-factored, of jhāna, and of purity. ; vipassanāca=and equanimity of insight. ; saṅkhāravedanāvīriyaṃ=equanimity towards formations, of feeling, and of energy. ; iti=Thus. ; vitthārato=in detail. ; upekkhā=the equanimities. ; dasa=are ten. ; tato=Among them. ; majjhattādito=starting from specific neutrality. ; cha=six kinds of equanimity. ; ekā=are one in essence. ; tato=From those ten equanimities. ; duve=two. ; ime paññā=these wisdoms, equanimity of insight and equanimity towards formations. ; dvihi=with the two, equanimity of feeling and equanimity of energy. ; saha=together. ; catassova=only four. ; bhavanti=there are. ;

Myanmar Nissaya

bhavantimātigāthādvayaṃ=ဟူသော ဂါထာနှစ်ခုတို့၏ အပေါင်းကို။ ; āha=၏။ ; ဂါထာအနက်။ ။ ; ajjhattabrahmābojjhaṅgachaḷaṅgajhānasuddhiyo=တတြမဇ္ဈတတ္တုပေက္ခာ ဗြဟ္မဝိဟာရုပေက္ခာ ဗောဇ္ဈင်္ဂုပေက္ခာ ဆဠင်္ဂုပေက္ခာ ဈာနုပေက္ခာ ပါရိသုဒ္ဓုပေက္ခာတို့သည်လည်းကောင်ဂ။ ; vipassanāca=ဝိပဿနုပေက္ခာလည်းကောင်း။ ; saṅkhāravedanāvīriyaṃ=သင်္ခါရပေက္ခာ ဝေဒနုပေက္ခာ ဝီရိသုပေက္ခာ လည်းကောင်း။ ; iti=သို့။ ; vitthārato=အားဖြင့်။ ; upekkhā=တို့သည်။ ; dasa=တို့တည်း။ ; tato=မှ။ ; majjhattādito=တတြမဇ္ဈတ္တုပေက္ခာ အစရှိသော အားဖြင့်။ ; cha=ခြောက်ပါးသော ဥပေက္ခာတို့သ်ည။ ; ekā=တရားကိုယ် တူကုန်၏။ ; tato=ထိုဆယ်ပါးသော ဥပေက္ခာမှ။ ; duve=ကုန်သော။ ; ime paññā=ဤဝိပဿ နုပေက္ခာ သင်္ခါရုပေက္ခာ ပညာတိုသည်။ ; dvihi=နှစ်ပါးကုန်သော ဝေဒနုပေက္ခာ ဝီရိယုပေက္ခာတို့နှင့်။ ; saha=တကွ။ ; catassova=သာလျှင်။ ; bhavanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3494 | Chunk: 58

Iti [P1.189] imāsu upekkhāsu jhānupekkhā idha adhippetā.

AI Translation based on Nissaya

Thus, [P1.189] among these equanimities, equanimity of jhāna is intended here.

Vietnamese AI Translation

Như vậy, [P1.189] trong số các loại tâm xả này, thiền xả là loại được nói đến ở đây.

AI Translation Nissaya

iti=Thus. ; imasu upekkhāsu=among these ten equanimities. ; jhānupekkhā=equanimity of jhāna. ; idha=here, in the phrase 'upekkhako ca viharati'. ; adhippetā=is intended. ;

Myanmar Nissaya

iti=သို့။ ; imasu upekkhāsu=ဤဆယ်ပါးသော ဥပေက္ခာတို့တွင်။ ; jhānupekkhā=ကို။ ; idha=ဤဥပေက္ခကောစ ဝိဟရတ ဟူသော ပုဒ်၌။ ; adhippetā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3495 | Chunk: 58

Sā majjhattalakkhaṇā.

AI Translation based on Nissaya

It has the characteristic of neutrality.

Vietnamese AI Translation

Nó có đặc tính trung lập.

AI Translation Nissaya

sā=That equanimity of jhāna. ; ajjhattalakkhaṇā=has the characteristic of neutrality. ;

Myanmar Nissaya

sā=ထိုဈာနုပေက္ခာသည်။ ; ajjhattalakkhaṇā=လျစ်လျူရှုခြင်း သဘောလက္ခဏာရှိ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3496 | Chunk: 58

Etthāha –

AI Translation based on Nissaya

Here, an objector might say:

Vietnamese AI Translation

Ở đây, một người chất vấn có thể nói:

AI Translation Nissaya

ettha=In this phrase 'upekkhako ca viharati'. ; ṭhatvā=pausing. ; codako=an objector. ; āha=says. ;

Myanmar Nissaya

ettha=ဤဥပေက္ခာကော စ ဝိဟရတိဟူသော စကား၌။ ; ṭhatvā=တန့်ရပ်၍။ ; codako=သည်။ ; āha=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3497 | Chunk: 58

‘‘nanu cāyaṃ atthato tatramajjhattupekkhāva hoti, sā ca paṭhamadutiyajjhānesupi atthi, tasmā tatrapi ‘ upekkhako ca viharatī ’ ti evamayaṃ vattabbā siyā, sā kasmā na vuttā’’ ti ?

AI Translation based on Nissaya

“But isn't this, in essence, just specific neutrality? And that specific neutrality is also present in the first and second jhānas. Therefore, in those jhānas too, the phrase 'and abides equanimous' should be stated. Why is it not stated?”

Vietnamese AI Translation

“Nhưng về bản chất, đây chẳng phải chỉ là sự trung lập chuyên biệt sao? Và sự trung lập chuyên biệt đó cũng có mặt trong thiền thứ nhất và thứ hai. Do đó, trong các thiền ấy, cụm từ 'và an trú xả' cũng nên được nêu ra. Tại sao nó không được nêu ra?”

AI Translation Nissaya

kiṃ=What?. ; nanuca codami=Surely, I object. ; ayaṃ=This equanimity. ; atthato=in terms of its intrinsic nature. ; tatra majjhattupekkhāva=is just specific neutrality. ; hoti=it is. ; sāca=And that specific neutrality. ; paṭhama dutiyajjhānesupi=in the first and second jhānas as well. ; atthi=is present. ; tasmā=Therefore. ; tatrapi=in those first and second jhānas as well. ; upekkhato ca viharatīti=as 'and abides equanimous'. ; evaṃ=thus. ; ayaṃ=this specific neutrality. ; vattabbā=should be stated. ; siyā nanu=shouldn't it?. ; sā=That specific neutrality. ; kasmā=why. ; na vuttā=was it not stated?. ; iti=Thus. ; codako=the objector. ; āha=says. ;

Myanmar Nissaya

kiṃ=ကား။ ; nanuca codami=အံ့။ ; ayaṃ=ဤဥပေက္ခာသည်။ ; atthato=တရားကိုယ်အားဖြင့်။ ; tatra majjhattupekkhāva=သည်သာလျှင်။ ; hoti=၏။ ; sāca=ထိုတတြမဇ္ဈတ္တုပေက္ခာသည်လည်း။ ; paṭhama dutiyajjhānesupi=တို့၌လည်း။ ; atthi=၏။ ; tasmā=ကြောင့်။ ; tatrapi=ထိုပဌမဈာန် ဒုတိယဈာန််တို့၌လည်း။ ; upekkhato ca viharatīti=ဟူ၍။ ; evaṃ=သို့။ ; ayaṃ=ဤတတြမဇ္ဈတ္တုပေက္ခာကို။ ; vattabbā=သင့်သည်။ ; siyā nanu=တုံလော။ ; sā=ထိုတတြမဇ္ဈတ္တုပေက္ခာကို။ ; kasmā=ကြောင့်။ ; na vuttā=နည်း။ ; iti=သို့။ ; codako=သည်။ ; āha=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3498 | Chunk: 58

Aparibyattakiccato.

AI Translation based on Nissaya

[The reply is:] Because its function is not manifest.

Vietnamese AI Translation

[Câu trả lời là:] Bởi vì chức năng của nó không hiển lộ.

AI Translation Nissaya

aparibyattakiccato=Because its function is not manifest. ; na vuttā=it was not stated. ;

Myanmar Nissaya

aparibyattakiccato=မထင်ရှားသော ကိစ္စရှိခြင်းကြောင့်။ ; na vuttā=အပ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3499 | Chunk: 58

Aparibyattañhi tassa tattha kiccaṃ vitakkādīhi abhibhūtattā, idha panāyaṃ vitakkavicārapītīhi anabhibhūtattā ukkhittasirā viya hutvā paribyattakiccā jātā, tasmā vuttāti.

AI Translation based on Nissaya

Indeed, its function is not manifest there because it is overwhelmed by thought and so on. But here, since it is not overwhelmed by thought, examination, and rapture, its function has become manifest, like someone with their head held high. Therefore, it is stated here.

Vietnamese AI Translation

Thật vậy, chức năng của nó không hiển lộ ở đó vì nó bị tầm, v.v., lấn át. Nhưng ở đây, vì nó không bị tầm, tứ, và hỷ lấn át, nên chức năng của nó đã trở nên hiển lộ, giống như một người ngẩng cao đầu. Do đó, nó được nêu ra ở đây.

AI Translation Nissaya

hi vitthāremi=Indeed, I will elaborate. ; tattha=In those first and second jhānas. ; vitakkādihi=by thought, etc.. ; abhibhūtattā=because of being overwhelmed. ; tassa=of that specific neutrality. ; kiccaṃ=the function. ; aparibyattaṃ=is not manifest. ; pana=Now, apart from it being unmanifest, I will speak of it being manifest. ; idha=Here, in this third jhāna. ; ayaṃ=this specific neutrality. ; vitakkavicārapītīhi=by thought, examination, and rapture. ; anabhibhūtakkā=because of not being overwhelmed. ; ukkhittasirāvīya=like one with head held high. ; hutvā=having become. ; paribyattakiccā=its function is manifest. ; jātā=it has become. ; tasmā=Therefore. ; vuttā=it is stated. ; iti=Thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; tattha=ထိုပဌမဈာန် ဒုတိယဈာန်၌။ ; vitakkādihi=တို့သည်။ ; abhibhūtattā=နှိပ်စက်အပ်သည်၏ အဖြစ်ကြောင့်။ ; tassa=ထိုတတြ မဇ္ဈတ္တုပေက္ခာ၏။ ; kiccaṃ=သည်။ ; aparibyattaṃ=မထင်ရှား။ ; pana=မထင်ရှားသည်မှ တပါး ထင်ရှားသည်ကို ဆိုဦးအံ့။ ; idha=ဤတတိယဈာန်၌။ ; ayaṃ=ဤတတြမဇ္ဈတ္တုပေက္ခာသည်။ ; vitakkavicārapītīhi=တို့သည်။ ; anabhibhūtakkā=မနှိပ်စက်အပ်သည်၏ အဖြစ်ကြောင့်။ ; ukkhittasirāvīya=ချီကြွသော ဦးခေါင်းရှိသူကဲ့သို့။ ; hutvā=၍။ ; paribyattakiccā=ထင်းသော ကိစ္စရှိသည်။ ; jātā=ဖြစ်၏။ ; tasmā=ကြောင့်။ ; vuttā=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3500 | Chunk: 58

Idāni sato ca sampajānoti ettha saratīti sato.

AI Translation based on Nissaya

Now, in 'mindful and fully aware' (sato ca sampajāno), one is 'mindful' (sato) because one remembers.

Vietnamese AI Translation

Bây giờ, trong **'chánh niệm và tỉnh giác' (sato ca sampajāno)**, một người là ‘chánh niệm’ (sato) bởi vì người ấy ghi nhớ.

AI Translation Nissaya

idāni=Now. ; sato ca sampajānoti ettha=in 'mindful and fully aware'. ; (attho=the meaning. ; etaṃ=thus. ; veditabbo=should be understood. ; yo puggalo=Whatever person). ; sarati=remembers. ; iti tasmā=therefore. ; sato=is called 'sato' (mindful). ;

Myanmar Nissaya

idāni=၌။ ; sato ca sampajānoti ettha=၌။ ; (attho=ကို။ ; etaṃ=သို့။ ; veditabbo=၏။ ; yo puggalo=သည်။) ; sarati=အောက်မေ့တတ်၏။ ; iti tasmā=ကြောင့်။ ; sato=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3501 | Chunk: 58

Sampajānātīti sampajāno.

AI Translation based on Nissaya

One is 'fully aware' (sampajāno) because one knows clearly and distinctly.

Vietnamese AI Translation

Một người là ‘tỉnh giác’ (sampajāno) bởi vì người ấy biết một cách rõ ràng và phân biệt.

AI Translation Nissaya

(yo puggalo=Whatever person). ; sampajānāti=knows clearly and distinctly. ; ititasmā=therefore. ; sampajāno=is called 'sampajāno' (fully aware). ;

Myanmar Nissaya

(yo puggalo=သည်။) ; sampajānāti=ကောင်းစွာ အပြားအားဖြင့် သိတတ်၏။ ; ititasmā=ကြောင့်။ ; sampajāno=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3502 | Chunk: 58

Iti puggalena sati ca sampajaññañca vuttaṃ.

AI Translation based on Nissaya

Thus, by way of the person, mindfulness and full awareness are stated.

Vietnamese AI Translation

Như vậy, chánh niệm và tỉnh giác được nói theo phương diện của người (hành giả).

AI Translation Nissaya

iti=Thus. ; puggalena=by means of the person. ; satica=mindfulness. ; sampajaññañca=and full awareness. ; vuttaṃ=is stated. ;

Myanmar Nissaya

iti=သို့။ ; puggalena=ဖြင့်။ ; satica=ကိုလည်းကောင်း။ ; sampajaññañca=ကိုလည်းကောင်း။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3503 | Chunk: 58

Tattha saraṇalakkhaṇā [M1.176] sati.

AI Translation based on Nissaya

Therein, mindfulness [M1.176] has the characteristic of remembering.

Vietnamese AI Translation

Trong đó, chánh niệm [M1.176] có đặc tính là ghi nhớ.

AI Translation Nissaya

tattha=Therein. ; sati=mindfulness. ; saraṇalakkhaṇā=has the characteristic of remembering. ;

Myanmar Nissaya

tattha=ထိုနှစ်ပါးတို့တွင်။ ; sati=သည်။ ; saraṇalakkhaṇā=အောက်မေ့ခြင်း လက္ခဏာရှိ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3504 | Chunk: 58

Asammohalakkhaṇaṃ sampajaññaṃ.

AI Translation based on Nissaya

Clear comprehension has the characteristic of non-delusion.

Vietnamese AI Translation

Tỉnh giác có đặc tính là không si mê.

AI Translation Nissaya

sampajaññaṃ=clear comprehension. ; asammohalakkhaṇaṃ=has the characteristic of non-delusion. ;

Myanmar Nissaya

sampajaññaṃ=ပညာသည်။ ; asammohalakkhaṇaṃ=မတွေဝေခြင်း လက္ခဏာရှိ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3505 | Chunk: 59

Tattha kiñcāpi idaṃ satisampajaññaṃ purimajjhānesupi atthi, muṭṭhassatissa hi asampajānassa upacāramattampi na sampajjati, pageva appanā.

AI Translation based on Nissaya

In that context, although this mindfulness and clear comprehension also exist in the preceding jhānas, truly, for a person with lapsed mindfulness and who is not clearly comprehending, even access concentration is not accomplished, let alone absorption.

Vietnamese AI Translation

Trong bối cảnh đó, mặc dù chánh niệm và tỉnh giác này cũng tồn tại trong các thiền trước, nhưng thật sự, đối với một người thất niệm và không tỉnh giác, ngay cả cận định cũng không thể thành tựu, huống chi là an chỉ định.

AI Translation Nissaya

tattha=In that phrase 'mindful and clearly comprehending'. ; idaṃ satisampajaññaṃ=this mindfulness and clear comprehension. ; purimujjhānesupi=also in the preceding jhānas, the first and second jhānas. ; kiñcāpi atthi=although it exists. ; hi saccaṃ=Truly. ; muṭṭhassatissa=for a person with lapsed mindfulness. ; asampajānassa=and who is not clearly comprehending. ; upacāramattampi=even mere access concentration. ; nasampajjati=is not accomplished. ; appanā=absorption concentration. ; pageva=what to speak of. ;

Myanmar Nissaya

tattha=ထိုသတော သမ္ပဇာနော ဟူသော ပုဒ်၌။ ; idaṃ satisampajaññaṃ=ဤသတိပညာသည်။ ; purimujjhānesupi=ရှေ့ဖြစ်သော ပဌမဈာန် ဒုတိယဈာန် တို့၌လည်း။ ; kiñcāpi atthi=ရှင့်။ ; hi saccaṃ=၏။ ; muṭṭhassatissa=ရှိသော ; asampajānassa=ပုဂ္ဂိုလ်အား။ ; upacāramattampi=ဥပစာရ ဈာန်သည်မျှလည်း။ ; nasampajjati=မပြည့်စုံ။ ; appanā=သည်။ ; pageva=အဘယ်ဆိုဖွယ်ရှိအံ့နည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3506 | Chunk: 59

Oḷārikattā pana tesaṃ jhānānaṃ bhūmiyaṃ viya purisassa cittassa gati sukhā hoti, abyattaṃ tattha satisampajaññakiccaṃ.

AI Translation based on Nissaya

However, due to the coarseness of those jhānas, the progression of the mind is easy, just as a person's going is easy on level ground; there, the function of mindfulness and clear comprehension is not manifest.

Vietnamese AI Translation

Tuy nhiên, do sự thô thiển của các thiền ấy, sự tiến triển của tâm dễ dàng, cũng như việc đi lại của một người trên mặt đất bằng phẳng là dễ dàng; ở đó, chức năng của chánh niệm và tỉnh giác không hiển lộ.

AI Translation Nissaya

pana tathāpi=However, although that is so. ; tesaṃ jhānānaṃ=of those first and second jhānas. ; oḷārikattā=due to their coarseness. ; bhūmiyaṃ=on smooth, even, and level ground. ; purisassa=of a person. ; gati=the going. ; sukhā=is easy. ; hotiviya=just as it is. ; cittassa=of the mind. ; gati=the progression. ; sukhā=is easy. ; hoti=is. ; tattha=in those first and second jhānas. ; sati sampajaññakiccaṃ=the function of mindfulness and clear comprehension. ; abyattaṃ=is not manifest. ; hoti=is. ;

Myanmar Nissaya

pana tathāpi=ထိုသို့ပင် ရှိသော်လည်း။ ; tesaṃ jhānānaṃ=ထိုပဌမဈာန်ဒုတိယဈာန်တို့၏။ ; oḷārikattā=ရုန့်ရင်းသည်၏ အဖြစ်ကြောင့်။ ; bhūmiyaṃ=ပြေပြစ်ချောမော ညက်ညောသော မြေအပြင်၌။ ; purisassa=၏။ ; gati=သွားခြင်းသည။ ; sukhā=လွယ်သည်။ ; hotiviya=ကဲ့သို့။ ; cittassa=၏။ ; gati=ဖြစ်ခြင်းသည်။ ; sukhā=သည်။ ; hoti=၏။ ; tattha=ထိုပဌမဈာန် ဒုတိယဈာန်၌။ ; sati sampajaññakiccaṃ=သတိပညာတို့၏ ကိစ္စသည် ။ ; abyattaṃ=မထင်ရှားသည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3507 | Chunk: 59

Oḷārikaṅgappahānena pana sukhumattā imassa jhānassa purisassa khuradhārāyaṃ viya satisampajaññakiccapariggahitā [V1.161] eva cittassa gati icchitabbāti idheva vuttaṃ.

AI Translation based on Nissaya

But, due to the subtlety of this jhāna, resulting from the abandoning of the coarse factors, the mind's progression is desirable only when grasped by the function of mindfulness and clear comprehension, just like a person's [V1.161] progress over a razor's edge is desirable only with care; therefore, it is mentioned only here.

Vietnamese AI Translation

Nhưng, do sự vi tế của thiền này, là kết quả của việc từ bỏ các chi phần thô, sự tiến triển của tâm chỉ có thể mong muốn (thực hiện) được khi được nắm bắt bởi chức năng của chánh niệm và tỉnh giác, cũng giống như việc một người [V1.161] đi qua một lưỡi dao cạo chỉ có thể mong muốn (thực hiện) được với sự cẩn trọng; do đó, nó chỉ được đề cập ở đây.

AI Translation Nissaya

pana=But as for the third jhāna. ; oḷārikaṅgappahānena=through the abandoning of the two coarse jhāna factors, initial and sustained application. ; imassa jhānassa=of this third jhāna. ; sukhumattā=because of its subtlety. ; purisassa=of a person. ; khuradhārāsaṃ=on a razor's edge. ; satisampajaññakiccapariggahitāeva=only when grasped by the function of mindfulness and clear comprehension. ; gati=the going. ; icchitabbāviya=is desirable, just as. ; cittassa=of the mind. ; satisampajaññakicca pariggahitāeva=only when grasped by the function of mindfulness and clear comprehension. ; gati=the progression. ; icchitabbā=is desirable. ; iti tasmā=Therefore. ; idheva=only here in this third jhāna. ; vuttaṃ=mindfulness and clear comprehension are spoken of. ;

Myanmar Nissaya

pana=တတိယဈာန်ကို ဆိုဦးအံ့။ ; oḷārikaṅgappahānena=ရုန့်ရင်းသော ဝိတက် ဝိစာရ ဈာန်အင်္ဂါနှစ်ပါးကို ပယ်သဖြင့်။ ; imassa jhānassa=ဤတတိယဈာန်၏။ ; sukhumattā=သိမ်မွေ့သည်၏ အဖြစ်ကြောင့်။ ; purisassa=၏။ ; khuradhārāsaṃ=သင်တုန်းဓား အတိ စီသော မြေ၌။ ; satisampajaññakiccapariggahitāeva=သတိပညာတို့၏ ကိစ္စဖြင့် သိမ်းဆည်းအပ်သည်သာလျှင်ဖြစ်သော။ ; gati=သွားခြင်းကို။ ; icchitabbāviya=အလိုရှိအပ်သကဲ့သို့။ ; cittassa=၏။ ; satisampajaññakicca pariggahitāeva=သော။ ; gati=ဖြစ်ခြင်းကို။ ; icchitabbā=၏။ ; iti tasmā=ကြောင့်။ ; idheva=ဤတတိယဈာန်၌သာလျှင်။ ; vuttaṃ=သတိပညာကို ဟောတော်မူအပ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3508 | Chunk: 59

Kiñca bhiyyo – yathā dhenupago vaccho dhenuto apanīto arakkhiyamāno punadeva dhenuṃ upagacchati, evamidaṃ tatiyajjhānasukhaṃ pītito apanītampi satisampajaññārakkhena arakkhiyamānaṃ punadeva pītiṃ upagaccheyya, pītisampayuttameva siyā.

AI Translation based on Nissaya

Furthermore, just as a suckling calf, when taken away from its mother but left unguarded, returns to its mother, so too this pleasure of the third jhāna, though separated from rapture, if it is not guarded by the protection of mindfulness and clear comprehension, would return to rapture and become associated with rapture once more.

Vietnamese AI Translation

Hơn nữa, cũng giống như một con bê đang bú, khi bị tách khỏi mẹ nhưng không được canh giữ, sẽ quay trở lại với mẹ nó, thì lạc của thiền thứ ba này cũng vậy, mặc dù đã tách rời khỏi hỷ, nếu không được bảo vệ bởi sự phòng hộ của chánh niệm và tỉnh giác, sẽ quay trở lại với hỷ và một lần nữa liên kết với hỷ.

AI Translation Nissaya

kiñcabhiyyo=Furthermore, there is more to be said. ; dhenupago=a calf that stays near its mother cow. ; dhenuto=from the mother cow. ; apanīto=when taken away. ; vaccho=the calf. ; vā=that is, the calf. ; arakkhiyamāno=if not guarded. ; punadeva=just again. ; dhenuṃ=to the mother cow. ; upagacchatiyathā=approaches, just as. ; evaṃ tathā=so too. ; idaṃ tatiyajjhānasukhaṃ=this pleasure associated with the third jhāna. ; pītito=from the rapture of the second jhāna. ; apanītampi=though separated. ; hutvā=having been. ; taṃ=that pleasure of the third jhāna. ; satisampajaññārakkhena=by the guard of mindfulness and clear comprehension. ; arakkhiyamānaṃ=if not guarded. ; punadeva=just again. ; pītiṃ=to the rapture of the second jhāna. ; upagaccheyyaṃ=it would approach. ; pītisampayuttameva=just associated with rapture. ; siyā=it would be. ;

Myanmar Nissaya

kiñcabhiyyo=တနည်းဆိုဖွယ်ရှိသေး၏။ ; dhenupago=အမိဖြစ်သော နွားမိသို့ကပ်သော။ ; dhenuto=အမိဖြစ်သော နွားမမှ။ ; apanīto=ဖဲခွာ၍ ထားအပ်သော။ ; vaccho=နွားငယ်ကို။ ; vā=နွားငယ်သည်။ ; arakkhiyamāno=မစောင့်ရှောက်အပ်သည်ရှိသော်။ ; punadeva=တဖန်သာလျှင်။ ; dhenuṃ=အမိဖြစ်သော နွားမသို့။ ; upagacchatiyathā=ကပ်သကဲ့သို့။ ; evaṃ tathā=ထို့အတူ။ ; idaṃ tatiyajjhānasukhaṃ=ဤတတိယဈာန်နှင့် ယှဉ်သော သုခသည်။ ; pītito=ဒုတိယဈာန်ပီတိမှ။ ; apanītampi=ဖဲကြဉ်သည်လည်း။ ; hutvā=၍။ ; taṃ=ထိုတတိယဈာန်သုခကို။ ; satisampajaññārakkhena=ဖြင့်။ ; arakkhiyamānaṃ=မစောင့်ရှောက်အပ်သည်ရှိသော်။ ; punadeva=လျှင်။ ; pītiṃ=ဒုတိယဈာန်ပီတိသို့။ ; upagaccheyyaṃ=ကပ်ရာ၏။ ; pītisampayuttameva=သာလျှင်။ ; siyā=ဖြစ်ရာ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3509 | Chunk: 59

Sukhe vāpi sattā sārajjanti, idañca atimadhuraṃ sukhaṃ tato paraṃ sukhābhāvā.

AI Translation based on Nissaya

Moreover, beings are intensely attached to pleasure, and this pleasure of the third jhāna is an extremely sweet pleasure, because there is no pleasure higher than it.

Vietnamese AI Translation

Hơn nữa, chúng sinh dính mắc mãnh liệt vào lạc, và lạc của thiền thứ ba này là một niềm lạc vô cùng ngọt ngào, bởi vì không có niềm lạc nào cao hơn nó.

AI Translation Nissaya

vā=Moreover. ; sukhepi=in pleasure. ; sattā=beings. ; sārajjanti=are intensely attached. ; idañca=And this pleasure of the third jhāna. ; atimadhuraṃ=is an extremely sweet. ; sukhaṃ=pleasure. ; kasmā=Why?. ; tato=than that pleasure of the third jhāna. ; paraṃ=higher. ; sukhābhāvā=because there is no pleasure. ;

Myanmar Nissaya

vā=ကား။ ; sukhepi=သုခသည်လည်း။ ; sattā=သတ္တဝါတို့သည်။ ; sārajjanti=လွန်စွာတပ်ကုန်၏။ ; idañca=ဤတတိယဈာန် သုခ၌လည်း။ ; atimadhuraṃ=အလွန်သာယာအပ်သော။ ; sukhaṃ=သုခတည်း။ ; kasmā=ကား။ ; tato=ထိုတတိယဈာန် သုခထက်။ ; paraṃ=အလွန်။ ; sukhābhāvā=ချမ်းသာခြင်း မရှိခြင်းကြောင့်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3510 | Chunk: 59

Satisampajaññānubhāvena panettha sukhe asārajjanā hoti, no aññathāti imampi atthavisesaṃ dassetuṃ idaṃ idheva vuttanti veditabbaṃ.

AI Translation based on Nissaya

It should be understood that, through the power of mindfulness and clear comprehension, non-attachment to pleasure occurs in this jhāna, and not otherwise. And it should be known that to show this special meaning, this was stated only here.

Vietnamese AI Translation

Cần phải được hiểu rằng, nhờ vào năng lực của chánh niệm và tỉnh giác, sự không dính mắc vào lạc xảy ra trong thiền này, chứ không phải cách nào khác. Và cần phải biết rằng để chỉ ra ý nghĩa đặc biệt này, điều này chỉ được nêu ra ở đây.

AI Translation Nissaya

pana tathāpi=However, although it is so pleasant. ; ettha=in this third jhāna. ; satisampajaññānubhāvena=through the power of mindfulness and clear comprehension. ; sukhe=in pleasure. ; asārajjanā=non-attachment. ; hoti=occurs. ; aññathā=Otherwise, by means other than the power of mindfulness and clear comprehension. ; no hoti=it does not occur. ; iti=Thus. ; veditabbaṃ=it should be known. ; idampi atthavisesaṃ=This special meaning also. ; dassetuṃ=In order to show. ; idaṃ=this phrase 'mindful and clearly comprehending'. ; idheva=only here in this third jhāna. ; vuttaṃ=was said. ; iti=Thus. ; veditabbaṃ=it should be known. ;

Myanmar Nissaya

pana tathāpi=ထိုသို့ သာယာအပ်သော်လည်း။ ; ettha=ဤတတိယဈာန်၌။ ; satisampajaññānubhāvena=သတိပညာတို့၏ အာနုဘော်ကြောင့်။ ; sukhe=သုခ၌။ ; asārajjanā=မတပ်ခြင်းသည်။ ; hoti=၏။ ; aññathā=သတိပညာတို့၏ အာနုဘော်မှ တပါးသော အခြင်းအရာအားဖြင့်။ ; no hoti=မဖြစ်။ ; iti=သို့။ ; veditabbaṃ=၏။ ; idampi atthavisesaṃ=ဤသို့သော အကျိုးထူးကိုလည်း။ ; dassetuṃ=ငှါ။ ; idaṃ=ဤသတော သမ္ပဇာနောဟူသော ပုဒ်ကို။ ; idheva=ဤတတိယဈာန်၌သာလျှင်။ ; vuttaṃ=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3511 | Chunk: 59

Idāni sukhañca kāyena paṭisaṃvedetīti ettha kiñcāpi tatiyajjhānasamaṅgino sukhapaṭisaṃvedanābhogo natthi, evaṃ santepi yasmā tassa nāmakāyena sampayuttaṃ sukhaṃ, yaṃ vā taṃ nāmakāyasampayuttaṃ sukhaṃ, taṃsamuṭṭhānenassa yasmā atipaṇītena rūpena rūpakāyo phuṭṭho, yassa phuṭṭhattā [P1.190] jhānā vuṭṭhitopi sukhaṃ paṭisaṃvedeyya, tasmā etamatthaṃ dassento ‘‘sukhañca kāyena paṭisaṃvedehī’’ ti āha.

AI Translation based on Nissaya

Now, regarding the phrase 'and he experiences pleasure with the body': although one endowed with the third jhāna has no intention of experiencing pleasure, still, because there is pleasure associated with his mental body, and because his physical body is pervaded by the extremely sublime materiality originating from that pleasure, and because of this pervasion, [P1.190] he would experience pleasure even after emerging from the jhāna. Therefore, to show this meaning, it was said, 'and he experiences pleasure with the body.'

Vietnamese AI Translation

Bây giờ, về cụm từ 'và vị ấy cảm thọ lạc bằng thân': mặc dù người đắc thiền thứ ba không có ý định cảm thọ lạc, nhưng vì có lạc liên kết với thân tâm của vị ấy, và vì thân vật chất của vị ấy được thấm nhuần bởi sắc pháp cực kỳ vi diệu phát sinh từ lạc đó, và vì sự thấm nhuần này, [P1.190] vị ấy sẽ cảm thọ lạc ngay cả sau khi xuất thiền. Do đó, để chỉ ra ý nghĩa này, đã có lời nói rằng, 'và vị ấy cảm thọ lạc bằng thân.'

AI Translation Nissaya

idāni=Now. ; sukhañca kāyena paṭisaṃvedetītiettha=in the phrase 'and he experiences pleasure with the body'. ; (attho=the meaning. ; evaṃ=thus. ; veditabbo=should be known.). ; tatiyajjhānasamaṅgino=for one endowed with the third jhāna. ; sukhapaṭisaṃvedanābhogo=the intention to experience the feeling of pleasure. ; kiñcāpi natthi=although there is not. ; evaṃ santepi=even though there is no such intention. ; yasmā=because. ; tassa puggalassa=for that person. ; nāmakāyena=with the mental body. ; sampayuttaṃ=associated. ; sukhaṃ=pleasure. ; atthi=exists. ; vā=or. ; nāmakāya sampayuttaṃ=associated with the mental body. ; yaṃ taṃ sukhaṃ=whatever that pleasure is. ; uppajjati=arises. ; assa=of that person endowed with jhāna. ; yasmā=because. ; taṃ samuṭṭhānena=which has that pleasure associated with the mental body as its cause. ; atipaṇītena=with extremely sublime. ; rūpena=materiality. ; rūpakāyo=the physical body. ; vā=or. ; phuṭṭho=is pervaded. ; hoti=is. ; yassa rūpakāyassa=of which physical body. ; phuṭṭhattā=because of being pervaded. ; jhānā=from the jhāna. ; vuṭṭhitopi=even after having emerged. ; vā=that is, the person who has emerged. ; sukhaṃ=pleasure. ; paṭisaṃvedeyya=he would experience. ; tasmā=Therefore. ; etamatthaṃ=this meaning. ; dassento=showing. ; (hutvā=being. ; sukhañca kāyena paṭisaṃvedetīti=‘and he experiences pleasure with the body’. ; āha=he said. ;

Myanmar Nissaya

idāni=၌။ ; sukhañca kāyena paṭisaṃvedetītiettha=၌။ ; (attho=ကို။ ; evaṃ=သို့။ ; veditabbo=၏။) ; tatiyajjhānasamaṅgino=အား။ ; sukhapaṭisaṃvedanābhogo=သုခ ဝေဒနာကို ခံစားအံ့ဟူသော နှလုံးသွင်းခြင်းသည်။ ; kiñcāpi natthi=ရှင့်။ ; evaṃ santepi=ဤသို့ နှလုံးသွင်းခြင်း မရှိသော်လည်း။ ; yasmā=ကြောင့်။ ; tassa puggalassa=အား။ ; nāmakāyena=နာမ ကာယနှင့်။ ; sampayuttaṃ=သော။ ; sukhaṃ=သည်။ ; atthi=၏။ ; vā=ကား။ ; nāmakāya sampayuttaṃ=နာမ ကာယနှင့် ယှဉ်သော။ ; yaṃ taṃ sukhaṃ=သည်။ ; uppajjati=၏။ ; assa=ထိုဈာန်နှင့် ပြည့်စုံသော ပုဂ္ဂိုလ်၏။ ; yasmā=ကြောင့်။ ; taṃ samuṭṭhānena=ထိုနာမကာယနှင့် ယှဉ်သော သုခလျှင် ဖြစ်ကြောင်း ရှိသော။ ; atipaṇītena=အလွန်မွန်မြတ်သော။ ; rūpena=ရုပ်ဖြင့်။ ; rūpakāyo=သည်။ ; vā=ကို။ ; phuṭṭho=နံ့သည်။ ; hoti=၏။ ; yassa rūpakāyassa=၏။ ; phuṭṭhattā=နှံ့သည်၏ အဖြစ်ကြောင့်။ ; jhānā=ဈာန်မှ။ ; vuṭṭhitopi=ထပြီးသော်လည်း။ ; vā=ထပြီးသော ပုဂ္ဂိုလ်သည်လည်း။ ; sukhaṃ=ကို။ ; paṭisaṃvedeyya=ခံစားရာ၏။ ; tasmā=ကြောင့်။ ; etamatthaṃ=ဤအနက်ကို။ ; dassento=သည်။ ; (hutvā=၍။) ; sukhañca kāyena paṭisaṃvedetīti=ဟူ၍။ ; āha=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3512 | Chunk: 59

Idāni yaṃ taṃ ariyā ācikkhanti upekkhako satimā sukhavihārīti ettha yaṃjhānahetu yaṃjhānakāraṇā taṃ tatiyajjhānasamaṅgipuggalaṃ buddhādayo ariyā ācikkhanti desenti paññapenti paṭṭhapenti vivaranti vibhajanti uttānīkaronti pakāsenti, pasaṃsantīti adhippāyo.

AI Translation based on Nissaya

Now, regarding the phrase 'Of which the noble ones declare: He is equanimous, mindful, a pleasant abider', the meaning is this: On account of that third jhāna, for that reason, the noble ones—the Buddhas and others—declare, teach, make known, establish, reveal, analyze, make plain, and proclaim; that is, they praise the person endowed with the third jhāna.

Vietnamese AI Translation

Bây giờ, về cụm từ 'Điều mà các bậc Thánh tuyên bố: Vị ấy là người có tâm xả, chánh niệm, an trú trong lạc', ý nghĩa là thế này: Do nhờ thiền thứ ba đó, vì lý do đó, các bậc Thánh—chư Phật và những vị khác—tuyên bố, giảng dạy, làm cho biết, thiết lập, tiết lộ, phân tích, làm rõ, và công bố; nghĩa là, các ngài tán thán người đã đắc thiền thứ ba.

AI Translation Nissaya

idāni=Now. ; yaṃ taṃ ariyā.la. sukhavihārītiettha=in the phrase 'Of which the noble ones declare: He is equanimous, mindful, a pleasant abider'. ; yaṃ jhānuhetu yaṃ jhānakāraṇā=Because of which third jhāna as the cause, for which reason of the jhāna. ; taṃ tatiyajjhānasamaṅgipuggalaṃ=that person endowed with the third jhāna. ; buddhādayo=the Buddhas and others. ; ariyā=the noble ones. ; ācikkhanti desenti paññāpenti paṭṭhapenti vivaranti vibhajanti=declare, teach, make known, establish, open up, analyze. ; uttānī=clearly. ; karonti=they make. ; pakāsenti=they proclaim. ; pasaṃsanti=they praise. ; itiayaṃ=this. ; adhippāyo=is the intention. ;

Myanmar Nissaya

idāni=၌။ ; yaṃ taṃ ariyā.la. sukhavihārītiettha=၌။ ; yaṃ jhānuhetu yaṃ jhānakāraṇā=အကြင်တတိယဈာန်ဟူသော အကြောင်းကြောင့်။ ; taṃ tatiyajjhānasamaṅgipuggalaṃ=ပုဂ္ဂိုလ်ကို။ ; buddhādayo=ကုန်သော။ ; ariyā=တို့သည်။ ; ācikkhanti desenti paññāpenti paṭṭhapenti vivaranti vibhajanti=ဝေဖန်ကုန်၏။ ; uttānī=ထင်စွာ။ ; karonti=ကုန်၏။ ; pakāsenti=ကုန်၏။ ; pasaṃsanti=ကုန်၏။ ; itiayaṃ=ကား။ ; adhippāyo=ဘုရားရှင်၏ အလိုတော်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3513 | Chunk: 59

Kinti ?

AI Translation based on Nissaya

How so do they praise?

Vietnamese AI Translation

Các ngài tán thán như thế nào?

AI Translation Nissaya

kinti=How. ; pasaṃsanti=do they praise?. ;

Myanmar Nissaya

kinti=သို့လျှင်။ ; pasaṃsanti=သနည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3514 | Chunk: 59

Upekkhako satimā sukhavihārīti.

AI Translation based on Nissaya

As 'equanimous, mindful, a pleasant abider'.

Vietnamese AI Translation

Là ‘người có tâm xả, chánh niệm, an trú trong lạc’.

AI Translation Nissaya

upekkhato satimā sukhavihārīti=as 'equanimous, mindful, a pleasant abider'. ; pasaṃsanti=they praise. ;

Myanmar Nissaya

upekkhato satimā sukhavihārīti=ဟူ၍။ ; pasaṃsanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3515 | Chunk: 59

Taṃ tatiyaṃ jhānaṃ upasampajja viharatīti evamettha yojanā veditabbā.

AI Translation based on Nissaya

It should be understood that the connection here is: 'Having attained that third jhāna, he abides.'

Vietnamese AI Translation

Cần phải hiểu rằng sự liên kết ở đây là: 'Đã đắc thiền thứ ba ấy, vị ấy an trú.'

AI Translation Nissaya

taṃ tatiyajjhānaṃ=that third jhāna. ; upasampajja=having attained. ; viharati=he abides. ; itievaṃ=Thus. ; ettha=here in this phrase 'equanimous, mindful, a pleasant abider'. ; yojanā=the connection. ; veditabbā=should be known. ;

Myanmar Nissaya

taṃ tatiyajjhānaṃ=ကို။ ; upasampajja=ပြည့်စုံစေ၍။ ; viharati=နေ၏။ ; itievaṃ=ဤသို့။ ; ettha=ဤဥပေက္ခကော သတိမာ သုခဝိဟာရီ ဟူသော ပုဒ်၌။ ; yojanā=ကို။ ; veditabbā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3516 | Chunk: 59

Kasmā pana taṃ te evaṃ pasaṃsantīti ?

AI Translation based on Nissaya

But why do those noble ones praise him in this way?

Vietnamese AI Translation

Nhưng tại sao các bậc Thánh lại tán thán vị ấy theo cách này?

AI Translation Nissaya

pana=Now, to state a question for clarification. ; kasmā=Why. ; naṃ=that person endowed with the third jhāna. ; te=do those noble ones, the Buddha and so on. ; evaṃ=thus. ; pasaṃsanti=praise?. ;

Myanmar Nissaya

pana=စောဒနာ သောဓနာပုဒ္ကို ထုတ်၍ဆိုဦးအံံ။ ; kasmā=ကြောင့်။ ; naṃ=ထိုတတိယဈာန်နှင့် ပြည့်စုံသော ပုဂ္ဂိုလ်ကို။ ; te=ထိုဘုရားအစရှိသော အရိယာ ပုဂ္ဂိုလ်တို့သည်။ ; evaṃ=သို့။ ; pasaṃsanti=ကုန်သနည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3517 | Chunk: 59

Pasaṃsārahato.

AI Translation based on Nissaya

Because he is worthy of praise.

Vietnamese AI Translation

Bởi vì vị ấy xứng đáng được tán thán.

AI Translation Nissaya

itiayaṃ=This. ; pucchā=is the question. ; pasaṃsārahato=Because he is worthy of praise. ; pasaṃsanti=they praise. ;

Myanmar Nissaya

itiayaṃ=ကား။ ; pucchā=တည်း။ ; pasaṃsārahato=အဖြစ်ကြောင့်။ ; pasaṃsanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3518 | Chunk: 59

Ayañhi yasmā atimadhurasukhe sukhapāramippattepi tatiyajjhāne upekkhako, na tattha sukhābhisaṅgena ākaḍḍhīyati.

AI Translation based on Nissaya

Indeed, because this person is equanimous in the third jhāna, which has an extremely sweet pleasure that has reached the pinnacle of pleasures, he is not drawn in by attachment to that pleasure.

Vietnamese AI Translation

Thật vậy, bởi vì người này có tâm xả trong thiền thứ ba, một tầng thiền có lạc thú vô cùng ngọt ngào đã đạt đến đỉnh cao của các lạc thú, nên vị ấy không bị lôi cuốn bởi sự dính mắc vào lạc thú đó.

AI Translation Nissaya

hi vitthāremi=To explain. ; yasmā=Because. ; ayaṃ=this person endowed with the third jhāna. ; atimadhurasukhe=in the extremely sweet pleasure. ; sukhapāramippattepi=even though it has reached the pinnacle of pleasures. ; tatiyajjhāne=in the third jhāna. ; upekkhako=is equanimous. ; hoti=is. ; tattha=in that third jhāna. ; sukhābhisaṅgena=by way of attachment to pleasure. ; naākaḍḍhīyati=he is not drawn in. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; yasmā=ကြောင့်။ ; ayaṃ=ဤတတိယဈာန်နှင့် ပြည့်စုံသော ပုဂ္ဂိုလ်သည်။ ; atimadhurasukhe=အလွန်သာယာအပ်သော သုခရှိသော။ ; sukhapāramippattepi=သုခတို့၏ အထွတ်အထိပ်သို့ ရောက်သော။ ; tatiyajjhāne=၌။ ; upekkhako=လျစ်လျူရှုသည်။ ; hoti=၏။ ; tattha=ထိုတတိယဈာန်နှင့်။ ; sukhābhisaṅgena=သုခ၌ကပ်ငြိသောအားဖြင့်။ ; naākaḍḍhīyati=မကပ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3519 | Chunk: 59

Yathā ca pīti na uppajjati, evaṃ upaṭṭhitassatitāya [M1.177] satimā.

AI Translation based on Nissaya

And because his mindfulness is established in such a way that rapture does not arise [M1.177], he is called 'mindful'.

Vietnamese AI Translation

Và bởi vì chánh niệm của vị ấy được thiết lập theo cách mà hỷ không khởi sinh [M1.177], nên vị ấy được gọi là ‘người có chánh niệm’.

AI Translation Nissaya

ca=And. ; yathā=in such a way that. ; (kariyamāne=when done.) ; pīti=rapture. ; nauppajjati=does not arise. ; evaṃ tathā=in that same way. ; upaṭṭhitassatitāya=because his mindfulness is established. ; satimā=he is called 'mindful'. ;

Myanmar Nissaya

ca=ဆက်။ ; yathā=အကြင်အခြင်းအရာအားဖြင့်။ ; (kariyamāne=သော်။) ; pīti=သည်။ ; nauppajjati=မဖြစ်။ ; evaṃ tathā=ထိုသို့သော အခြင်းအရာအားဖြင့်။ ; upaṭṭhitassatitāya=ထင်သော သတိရှိသည်၏ အဖြစ်ကြောင့်။ ; satimā=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3520 | Chunk: 59

Yasmā ca ariyakantaṃ ariyajanasevitameva ca asaṃkiliṭṭhaṃ sukhaṃ nāmakāyena paṭisaṃvedeti, tasmā pasaṃsāraho hoti.

AI Translation based on Nissaya

And because he experiences with the mental body a pleasure that is undefiled, desired by the noble ones, and practiced only by noble people, therefore he is worthy of praise.

Vietnamese AI Translation

Và bởi vì vị ấy cảm thọ bằng thân tâm một niềm lạc không ô nhiễm, được các bậc Thánh mong muốn, và chỉ được thực hành bởi những người cao thượng, do đó vị ấy xứng đáng được tán thán.

AI Translation Nissaya

ca=Furthermore. ; yasmā=because. ; ariyakantaṃ=desired by the noble ones. ; ariyajanasevitameva=practiced only by noble people. ; asaṃkiliṭṭhaṃ=undefiled. ; sukhaṃ=pleasure. ; vā=that is, the pleasure of the third jhāna. ; nāmakāyena=with the mental body. ; paṭisaṃvedeti=he experiences. ; tasmā=therefore. ; pasaṃsāraho=he is worthy of praise. ; hoti=is. ;

Myanmar Nissaya

ca=ထိုမှ တပါး။ ; yasmā=ကြောင့်။ ; ariyakantaṃ=အပ်သော။ ; ariyajanasevitameva=သာလျှင်ဖြစ်သော။ ; asaṃkiliṭṭhaṃ=ခြင်း မရှိသော။ ; sukhaṃ=သည်။ ; vā=တတိယဈာန် သုခကို။ ; nāmakāyena=ဖြင့်။ ; paṭisaṃvedeti=၏။ ; tasmā=ကြောင့်။ ; pasaṃsāraho=ထိုက်သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3521 | Chunk: 59

Iti pasaṃsārahato naṃ ariyā te evaṃ pasaṃsārahahetubhūte guṇe pakāsentā ‘‘upekkhako satimā sukhavihārī’’ ti evaṃ pasaṃsantīti veditabbaṃ.

AI Translation based on Nissaya

Thus, it should be understood: because he is worthy of praise, the noble ones praise him as 'equanimous, mindful, a pleasant abider', thereby making manifest those qualities that are the very reason for his worthiness of praise.

Vietnamese AI Translation

Như vậy, cần phải được hiểu: bởi vì vị ấy xứng đáng được tán thán, các bậc Thánh tán thán vị ấy là ‘người có tâm xả, chánh niệm, an trú trong lạc’, qua đó làm hiển lộ những phẩm chất chính là lý do cho sự xứng đáng được tán thán của vị ấy.

AI Translation Nissaya

iti=Thus. ; pasaṃsārahato=because he is worthy of praise. ; naṃ=that person endowed with the third jhāna. ; ariyā=the noble ones. ; evaṃ=in this way. ; pasaṃsārahatesubhūte=which are the basis for being worthy of praise. ; te guṇe=those qualities. ; pakāsentā=making manifest. ; hutvā=being. ; upekkhato satimā sukhavihārīti=as 'equanimous, mindful, a pleasant abider'. ; evaṃ=thus. ; pasaṃsanti=they praise. ; iti=Thus. ; veditabbaṃ=it should be known. ;

Myanmar Nissaya

iti=သို့။ ; pasaṃsārahato=ကြောင့်။ ; naṃ=ထိုတတိယဈာန်နှင့် ပြည့်စံဒသော ပုဂ္ဂိုလ်ကို။ ; ariyā=တို့သည်။ ; evaṃ=ဤသို့။ ; pasaṃsārahatesubhūte=ချီးမွမ်းခြင်း၏ အကြောင်းဖြစ်၍ ဖြစ်သော။ ; te guṇe=တို့ကို။ ; pakāsentā=ကုန်သည်။ ; hutvā=ကုန်၏။ ; upekkhato satimā sukhavihārīti=ဟူ၍။ ; evaṃ=သို့။ ; pasaṃsanti=ကုန်၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3522 | Chunk: 59

Tatiyan ti gaṇanānupubbatā tatiyaṃ, tatiyaṃ uppannantipi tatiyaṃ.

AI Translation based on Nissaya

**Third** means third in numerical sequence. It is also 'third' because it arose third.

Vietnamese AI Translation

**Thứ ba** có nghĩa là thứ ba theo thứ tự đếm số. Nó cũng là 'thứ ba' bởi vì nó khởi lên thứ ba.

AI Translation Nissaya

tatiyanti=As for 'third'. ; gaṇanānupubbatā=by way of numerical sequence. ; tatiyaṃ=it is called 'third'. ; tatiyaṃ=third. ; uppannaṃ=it arose. ; iti tasmāpi=for that reason also. ; tatiyaṃ=it is called 'third'. ;

Myanmar Nissaya

tatiyanti=ကား။ ; gaṇanānupubbatā=ဂဏနာနုပုဗ္ဗတာယ အားဖြင့်။ ; tatiyaṃ=မည်၏။ ; tatiyaṃ=မြောက်။ ; uppannaṃ=ဖြစ်၏။ ; iti tasmāpi=ကြောင့်လည်း။ ; tatiyaṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3523 | Chunk: 59

Sukhassa ca pahānā dukkhassa ca pahānāti kāyikasukhassa ca kāyikadukkhassa ca pahānā.

AI Translation based on Nissaya

**With the abandoning of pleasure and pain** means with the abandoning of bodily pleasure and bodily pain.

Vietnamese AI Translation

**Với việc từ bỏ lạc và khổ** có nghĩa là với việc từ bỏ thân lạc và thân khổ.

AI Translation Nissaya

sukhassa ca pahānā dukkhassa ca pahānāti=The phrase 'with the abandoning of pleasure and pain' means. ; kāyikasukhassaca=of bodily pleasure. ; kāyikadukkhassaca=and of bodily pain. ; pahānā=because of the abandoning. ;

Myanmar Nissaya

sukhassa ca pahānā dukkhassa ca pahānāti=ကား။ ; kāyikasukhassaca=ကိုလည်းကောင်း။ ; kāyikadukkhassaca=ကိုလည်းကောင်း။ ; pahānā=ကြောင့်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3524 | Chunk: 59

Pubbevāti tañca kho pubbeva, na catutthajjhānakkhaṇe.

AI Translation based on Nissaya

**Previously** means that this abandoning occurs only before the fourth jhāna, not at the moment of the fourth jhāna itself.

Vietnamese AI Translation

**Từ trước** có nghĩa là việc từ bỏ này chỉ xảy ra trước thiền thứ tư, không phải tại chính thời điểm của thiền thứ tư.

AI Translation Nissaya

pubbevāti=The phrase 'previously' means. ; tañcakho=that abandoning. ; pubbeva=only in the preceding stage of the fourth jhāna. ; hoti=occurs. ; catutthajjhānakkhaṇe=At the moment of the fourth jhāna. ; pahānaṃ=the abandoning. ; nahoti=does not happen. ;

Myanmar Nissaya

pubbevāti=ကား။ ; tañcakho=ထိုပယ်ခြင်းသည်လည်း။ ; pubbeva=စတုတ္ထဈာန်၏ ရှေ့အဖို့၌သာလျှင်။ ; hoti=၏။ ; catutthajjhānakkhaṇe=၌။ ; pahānaṃ=ခြင်းသ်ည။ ; nahoti=မဖြစ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3525 | Chunk: 59

Somanassadomanassānaṃ atthaṅgamāti cetasikasukhassa cetasikadukkhassa cāti imesampi dvinnaṃ pubbeva atthaṅgamā, pahānā [V1.162] icceva vuttaṃ hoti.

AI Translation based on Nissaya

**With the disappearance of joy and grief** means the disappearance of mental pleasure and mental pain. This also refers to their disappearance previously; that is to say, their prior abandoning. [V1.162]

Vietnamese AI Translation

**Với sự biến mất của hỷ và ưu** có nghĩa là sự biến mất của tâm lạc và tâm khổ. Điều này cũng đề cập đến sự biến mất của chúng từ trước; nghĩa là, sự từ bỏ trước đó của chúng. [V1.162]

AI Translation Nissaya

somanassadomanassānaṃ atthaṅgamāti=As for 'with the disappearance of joy and grief'. ; cetasikasukhassaca=of mental pleasure. ; cetasikadukkhassaca=and of mental pain. ; iti=thus. ; dvinnaṃ=of these two. ; imesampi=of these statements as well. ; pubbeva=only previously. ; atthaṅgamā=because of the disappearance. ; pahānā=because of the abandoning. ; icceva=just so. ; vuttaṃ vutto=it is said. ; hoti=is. ;

Myanmar Nissaya

somanassadomanassānaṃ atthaṅgamāti=ကား။ ; cetasikasukhassaca=လည်းကောင်း။ ; cetasikadukkhassaca=လည်းကောင်း။ ; iti=သို့။ ; dvinnaṃ=ကုန်သော။ ; imesampi=ဤဒေသနာတို့၏လည်း။ ; pubbeva=ရှေ့၌သာလျှင်။ ; atthaṅgamā=ခြင်းကြောင့်။ ; pahānā=ခြင်းကြောင့်။ ; icceva=ဤသို့သာလျှင်။ ; vuttaṃ vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3526 | Chunk: 59

Kadā pana nesaṃ pahānaṃ hoti ?

AI Translation based on Nissaya

But when are they abandoned?

Vietnamese AI Translation

Nhưng chúng được từ bỏ khi nào?

AI Translation Nissaya

pana=Now to state a question for clarification. ; kadā=when. ; nesaṃ=of those feelings. ; pahānaṃ=the abandoning. ; hoti=occurs?. ;

Myanmar Nissaya

pana=စောဒနာ သောဓနာပုဒ်ကို ထုတ်၍ဆိုဦးအံ့။ ; kadā=အဘယ်နံရောအခါ၌။ ; nesaṃ=ထိုဝေဒနာတို့ကို။ ; pahānaṃ=ပယ်ခြင်းသည်။ ; hoti=ဖြစ်သနည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3527 | Chunk: 59

Catunnaṃ jhānānaṃ upacārakkhaṇe.

AI Translation based on Nissaya

At the moment of access for the four jhānas.

Vietnamese AI Translation

Tại thời điểm cận định của bốn thiền.

AI Translation Nissaya

catunnaṃ=of the four. ; jhānānaṃ=jhānas. ; upacārakkhaṇe=at the moment of access. ; (pahānaṃ=the abandoning. ; hoti=occurs.). ;

Myanmar Nissaya

catunnaṃ=ကုန်သော။ ; jhānānaṃ=တို့၏။ ; upacārakkhaṇe=၌။ ; (pahānaṃ=သည်။ ; hoti=၏။) ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3528 | Chunk: 59

Somanassañhi catutthassa jhānassa upacārakkhaṇeyeva pahīyati, dukkhadomanassasukhāni paṭhamadutiyatatiyānaṃ upacārakkhaṇesu.

AI Translation based on Nissaya

To explain: joy is abandoned only at the moment of access to the fourth jhāna. Pain, grief, and pleasure are abandoned at the moments of access to the first, second, and third jhānas respectively. This is how it should be understood.

Vietnamese AI Translation

Để giải thích: hỷ (tâm lạc) chỉ được từ bỏ tại thời điểm cận định của thiền thứ tư. Khổ (thân khổ), ưu (tâm khổ), và lạc (thân lạc) được từ bỏ lần lượt tại các thời điểm cận định của thiền thứ nhất, thứ hai, và thứ ba. Cần phải được hiểu như vậy.

AI Translation Nissaya

hi vitthāremi=To explain. ; somanassaṃ=Joy. ; catutthassa jhānassa=of the fourth jhāna. ; upacārakkhaṇeyeva=only at the moment of access. ; pahīyati=is abandoned. ; dukkhadomanassassukhāni=Pain, grief, and pleasure. ; paṭhama dutiyatatiyānaṃ=of the first, second, and third jhānas. ; upacārakkhaṇesu=at the moments of access. ; pahīyanti=are abandoned. ; iti=Thus. ; veditabbaṃ=it should be known. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; somanassaṃ=ကို။ ; catutthassa jhānassa=၏။ ; upacārakkhaṇeyeva=၌သာလျှင်။ ; pahīyati=ပယ်အပ်၏။ ; dukkhadomanassassukhāni=ဝေဒနာတို့ကို။ ; paṭhama dutiyatatiyānaṃ=ဈာန်တို့၏။ ; upacārakkhaṇesu=တို့၌။ ; pahīyanti=ပယ်အပ်ကုန်၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3529 | Chunk: 59

Evametesaṃ pahānakkamena avuttānaṃ indriyavibhaṅge ( vibha. 219 ādayo ) pana indriyānaṃ uddesakkameneva idhāpi vuttānaṃ sukhadukkhasomanassadomanassānaṃ pahānaṃ veditabbaṃ.

AI Translation based on Nissaya

Thus, although they are not stated here according to the order of their abandoning, their abandoning should be understood in the order they are stated here, which is just the order of their exposition in the **Analysis of the Faculties** (Vibh. 219ff.), that is: pleasure, pain, joy, and grief.

Vietnamese AI Translation

Như vậy, mặc dù chúng không được nêu ra ở đây theo thứ tự từ bỏ, việc từ bỏ chúng cần được hiểu theo thứ tự chúng được nêu ra ở đây, vốn chính là thứ tự trình bày của chúng trong **Phân Tích về các Căn** (Vibh. 219ff.), đó là: lạc, khổ, hỷ, và ưu.

AI Translation Nissaya

evaṃ=Thus. ; etesaṃ=of these. ; pahānakkamena=by the order of their abandoning. ; avuttānaṃ=not being stated. ; pana=but indeed. ; indriyavibhaṅge=in the Analysis of the Faculties. ; indriyānaṃ=of the faculties. ; uddesakkameneva=just by the order of their exposition. ; idhāpi=here also in this Pāṭisambhidāmagga text. ; vuttānaṃ=which are stated. ; sukhadukkhasomanassadomanassānaṃ=of pleasure, pain, joy, and grief. ; pahānaṃ=the abandoning. ; veditabbaṃ=should be known. ;

Myanmar Nissaya

evaṃ=သို့။ ; etesaṃ=တို့ကို။ ; pahānakkamena=ပယ်အပ်သော အစဉ်ဖြင့်။ ; avuttānaṃ=မဟောအပ်ကုန်သော။ ; pana=စင်စစ်သော်ကား။ ; indriyavibhaṅge=၌။ ; indriyānaṃ=တို့၏။ ; uddesakkameneva=အကျဉ်းဖြစ်သော အစဉ်ဖြင့်သာလျှင်။ ; idhāpi=ဤပဋိသမ္ဘိဒါမဂ်ပါဠိ၌လည်း။ ; vuttānaṃ=ကုန်သော။ ; sukhadukkhasomanassadomanassānaṃ=ဝေဒနာတို့ကို။ ; pahānaṃ=ကို။ ; veditabbaṃ=သိအပ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3530 | Chunk: 59

Yadi panetāni tassa tassa jhānassa upacārakkhaṇeyeva pahīyanti [P1.191], atha kasmā ‘‘kattha cuppannaṃ dukkhindriyaṃ aparisesaṃ nirujjhati ?

AI Translation based on Nissaya

But if these feelings are abandoned at the moment of access to each respective jhāna [P1.191], then why is their cessation spoken of as occurring only within the jhānas themselves, as in the passage: 'Where does the arisen faculty of pain cease without remainder? Here, monks... having attained the first jhāna, he abides. Here the arisen faculty of pain ceases without remainder.'?

Vietnamese AI Translation

Nhưng nếu những cảm thọ này được từ bỏ tại thời điểm cận định của mỗi thiền tương ứng [P1.191], thì tại sao sự đoạn diệt của chúng lại được nói là chỉ xảy ra bên trong chính các thiền, như trong đoạn kinh: 'Căn khổ đã khởi sinh đoạn diệt không còn dư tàn ở đâu? Này các Tỳ-khưu, ở đây... sau khi đắc thiền thứ nhất, vị ấy an trú. Ở đây, căn khổ đã khởi sinh đoạn diệt không còn dư tàn.'?

AI Translation Nissaya

pana=Now to raise an objection. ; etāni=these four feelings. ; tassa tassa jhānassa=of each respective jhāna. ; upacārakkhaṇeyeva=only at the moment of access. ; yadi pahīyanti=if they are abandoned. ; atha=then. ; kasmā=why. ; katthacuppannaṃ dukkhindriyaṃ aparisesaṃ nirujjhati=as 'Where does the arisen faculty of pain cease without remainder? ... Here, monks ... it ceases without remainder'. ; evaṃ=in this way. ; jhānesveva=only at the moments of jhāna. ; nirodheū=the cessation. ; vutto=was stated?. ; itiayaṃ=This. ; pucchā=is the question. ; katthaca=And where. ; vā=or because of which jhāna. ; (nirujjhati၌ capa) uppannaṃ=the arisen. ; upasampajja=having attained. ; viharati=abides. ; ettha=Here, in this first jhāna. ; vā=or because of it. ; uppannaṃ=the arisen. ; dukkhindriyaṃ=faculty of pain. ; aparisesaṃ=without remainder. ; nirujjhati=ceases. ;

Myanmar Nissaya

pana=စောဒနာသောဓနာပုဒ်ကို ဆောင်ကာထုတ်အံ့။ ; etāni=ထိုလေးပါးသော ဝေဒနာတို့ကို။ ; tassa tassa jhānassa=ထိုထိုဈာန်၏။ ; upacārakkhaṇeyeva=၌သာလျှင်။ ; yadi pahīyanti=အပယ်၌ ပယ်ကုန်သည်ဖြစ်အံ့။ ; atha=လျက်။ ; kasmā=မူ၍။ ; katthacuppannaṃ dukkhindriyaṃ aparisesaṃ nirujjhati=ဣဓဘိက္ခဝေ ။လ။ အပရိသေသံ နိရုဇ္ဈတီတိ ဟူ၍။ ; evaṃ=သို့။ ; jhānesveva=ဈာန်ခဏတို့၌သာလျှင်။ ; nirodheū=ချုပ်ခြင်းကို။ ; vutto=လေသနည်း။ ; itiayaṃ=ကား။ ; pucchā=တည်း။ ; katthaca=အဘယ်ဈာန်၌လည်း။ ; vā=အဘယ်ဈာန်ကြောင့်လည်း။ ; (nirujjhati၌ capa) uppannaṃ=ကို။ ; upasampajja=ပြည့်စုံစေ၍။ ; viharati=၏။ ; ettha=ဤပဌမဈာန်၌။ ; vā=ကြောင့်။ ; uppannaṃ=ဖြစ်သော။ ; dukkhindriyaṃ=သည်။ ; aparisesaṃ=မဲ့။ ; nirujjhati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3531 | Chunk: 59

Idha, bhikkhave, bhikkhu vivicceva kāmehi … pe … paṭhamajjhānaṃ upasampajja viharati.

AI Translation based on Nissaya

Here, monks, a monk, quite secluded from sensual pleasures... abides having attained the first jhāna.

Vietnamese AI Translation

Này các Tỳ-khưu, ở đây, một Tỳ-khưu, hoàn toàn ly dục... an trú sau khi đắc thiền thứ nhất.

AI Translation Nissaya

bhikkhave=Monks. ; idha=here. ; bhikkhu=a monk. ; kāmehi=from the two kinds of sensual pleasures. ; vivicceva=being secluded. ; pa=... ; paṭhamajjhānaṃ=the first jhāna. ; upasampajja=having attained. ; viharati=abides. ;

Myanmar Nissaya

bhikkhave=တို့။ ; idha=၌။ ; bhikkhu=သည်။ ; kāmehi=နှစ်ပါးသော ကာမတို့မှ။ ; vivicceva=၍သာလျှင်။ ; pa= ; paṭhamajjhānaṃ=ကို။ ; upasampajja=၍။ ; viharati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3532 | Chunk: 59

Ettha cuppannaṃ dukkhindriyaṃ aparisesaṃ nirujjhati.

AI Translation based on Nissaya

Here the arisen faculty of pain ceases without remainder.

Vietnamese AI Translation

Ở đây, căn khổ đã khởi sinh đoạn diệt không còn dư tàn.

AI Translation Nissaya

etthaca=Here, in this first jhāna. ; vā=or because of it. ; uppannaṃ=the arisen. ; dukkhindriyaṃ=faculty of pain. ; aparisesaṃ=without remainder. ;

Myanmar Nissaya

etthaca=ဤပဌမဈာန်၌လည်း။ ; vā=ကြောင့်လည်း။ ; uppannaṃ=‌သော။ ; dukkhindriyaṃ=သည်။ ; aparisesaṃ=မဲ့။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3533 | Chunk: 59

Kattha cuppannaṃ domanassindriyaṃ, sukhindriyaṃ, somanassindriyaṃ aparisesaṃ nirujjhati ?

AI Translation based on Nissaya

Where do the arisen faculties of grief, pleasure, and joy cease without remainder?

Vietnamese AI Translation

Các căn ưu, lạc, và hỷ đã khởi sinh đoạn diệt không còn dư tàn ở đâu?

AI Translation Nissaya

katthaca=And where. ; vā=or because of which jhāna. ; uppannaṃ=the arisen. ; somanassindriyaṃ=faculty of joy. ; sukhindriyaṃ=faculty of pleasure. ; domanassindriyaṃ=faculty of grief. ; aparisesaṃ=without remainder. ; nirujjhati=cease?. ;

Myanmar Nissaya

katthaca=အဘယ်ဈာန်၌လည်း။ ; vā=ကြောင့်လည်း။ ; uppannaṃ=သော။ ; somanassindriyaṃ=သည်။ ; sukhindriyaṃ=သည်။ ; domanassindriyaṃ=သည်။ ; aparisesaṃ=မဲ့။ ; nirujjhati=နည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3534 | Chunk: 59

Idha, bhikkhave, bhikkhu sukhassa ca pahānā … pe … catutthaṃ jhānaṃ upasampajja viharati.

AI Translation based on Nissaya

Here, monks, a monk, with the abandoning of pleasure... abides having attained the fourth jhāna.

Vietnamese AI Translation

Này các Tỳ-khưu, ở đây, một Tỳ-khưu, với việc từ bỏ lạc... an trú sau khi đắc thiền thứ tư.

AI Translation Nissaya

bhikkhave=Monks. ; idha=here. ; bhikkhu=a monk. ; sukhassaca=of pleasure. ; pahānā=due to the abandoning. ; pa=... ; catutthaṃ=the fourth. ; jhānaṃ=jhāna. ; upasampajja=having attained. ; viharati=abides. ;

Myanmar Nissaya

bhikkhave=တို့။ ; idha=၌။ ; bhikkhu=သည်။ ; sukhassaca=ကိုလည်း။ ; pahānā=ကြောင့်။ ; pa= ; catutthaṃ=သော။ ; jhānaṃ=ကို။ ; upasampajja=၍။ ; viharati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3535 | Chunk: 59

Ettha cuppannaṃ somanassindriyaṃ aparisesaṃ nirujjhatī’’ ti ( saṃ. ni. 5.510) evaṃ jhānesveva nirodho vuttoti ?

AI Translation based on Nissaya

Here the arisen faculty of joy ceases without remainder.' (S.v.213)?

Vietnamese AI Translation

Ở đây, căn hỷ đã khởi sinh đoạn diệt không còn dư tàn.' (S.v.213)?

AI Translation Nissaya

etthaca=Here, in this fourth jhāna. ; vā=or because of it. ; uppannaṃ=the arisen. ; somanassindriyaṃ=faculty of joy. ; aparisesaṃ=without remainder. ; nirujjhati=ceases. ;

Myanmar Nissaya

etthaca=ဤစတုတ္ထဈာန်၌လည်း။ ; vā=ကြောင့်လည်း။ ; uppannaṃ=သော။ ; somanassindriyaṃ=သည်။ ; aparisesaṃ=မဲ့။ ; nirujjhati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3536 | Chunk: 59

Atisayanirodhattā.

AI Translation based on Nissaya

Because their cessation is superlative.

Vietnamese AI Translation

Bởi vì sự đoạn diệt của chúng là tuyệt đối.

AI Translation Nissaya

atisayanirodhattā=Because of the superlative cessation. ; (jhānesveva=only in the jhānas. ; nirodho=the cessation. ; vutto=is spoken of.). ;

Myanmar Nissaya

atisayanirodhattā=အလွန်ချုပ်သည်၏ အဖြစ်ကြောင့်။ ; (jhānesveva=၌သာလျှင်။ ; nirodho=ကို။ ; vutto=၏။) ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3537 | Chunk: 59

Atisayanirodho hi tesaṃ paṭhamajjhānādīsu, na nirodhoyeva.

AI Translation based on Nissaya

Indeed, their superlative cessation occurs in the first jhāna and so on; it is not merely cessation.

Vietnamese AI Translation

Thật vậy, sự đoạn diệt tuyệt đối của chúng xảy ra trong thiền thứ nhất, v.v.; đó không chỉ đơn thuần là sự đoạn diệt.

AI Translation Nissaya

hi vitthāremi=To explain. ; tesaṃ=of those feelings. ; atisayanirodho=the superlative cessation. ; paṭhamajjhānādīsu=in the first jhāna and so on. ; hoti=occurs. ; nirodhoyeva=It is not merely cessation. ; na=not. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; tesaṃ=ထိုဝေဒနာတို့၏။ ; atisayanirodho=အလွန်ချုပ်ခြင်းသည်။ ; paṭhamajjhānādīsu=တို့၌။ ; hoti=၏။ ; nirodhoyeva=ချုပ်ကာမတ္တသည် သာလျှင်။ ; na=မဟုတ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3538 | Chunk: 59

Nirodhoyeva pana upacārakkhaṇe, nātisayanirodho.

AI Translation based on Nissaya

At the moment of access, there is only mere cessation; superlative cessation does not occur.

Vietnamese AI Translation

Tại thời điểm cận định, chỉ có sự đoạn diệt đơn thuần; sự đoạn diệt tuyệt đối không xảy ra.

AI Translation Nissaya

pana=Now, as for cessation in the access concentration. ; upacārakkhaṇe=At the moment of access. ; nirodhoyeva=there is only mere cessation. ; hoti=is. ; atisayanirodho=superlative cessation. ; nahoti=does not occur. ;

Myanmar Nissaya

pana=ဥပစာရဈာန်၌ ချုပ်သည်ကို ဆိုဦးအံ့။ ; upacārakkhaṇe=၌။ ; nirodhoyeva=ချုပ်ကာမျှသည်သာလျှင်။ ; hoti=၏။ ; atisayanirodho=အလွန်ချုပ်သည်။ ; nahoti=မဖြစ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3539 | Chunk: 59

Tathā hi nānāvajjane paṭhamajjhānūpacāre niruddhassāpi dukkhindriyassa ḍaṃsamakasādisamphassena vā visamāsanūpatāpena vā siyā uppatti, na tveva antoappanāyaṃ.

AI Translation based on Nissaya

This is true. For in the access to the first jhāna, which has various kinds of advertence, even after the faculty of pain has ceased, it may arise again due to the bite of a gadfly or mosquito, or due to the discomfort of an unsuitable posture; but within absorption, it can never arise.

Vietnamese AI Translation

Điều này là đúng. Vì trong cận định của thiền thứ nhất, vốn có nhiều loại tác ý khác nhau, ngay cả sau khi căn khổ đã chấm dứt, nó vẫn có thể khởi lên trở lại do bị ruồi trâu hay muỗi đốt, hoặc do sự khó chịu của một tư thế không phù hợp; nhưng bên trong an chỉ định, nó không bao giờ có thể khởi lên.

AI Translation Nissaya

tathā taṃ vacanaṃ=That statement. ; hi saccaṃ=is true. ; nānāvajjane=which has various advertings. ; paṭhamajjhānūpacāre=in the access to the first jhāna. ; niruddhassāpi=even though it has ceased. ; dukkhindriyassa=of the faculty of pain. ; ḍaṃsamakasādisamphassenavā=due to the touch of gadflies, mosquitos and the like. ; visamāsanūpatāpenavādue to the affliction of an unsuitable posture. ; uppatti=an arising. ; siyā=may occur. ; antoappanāyaṃ=within absorption. ; uppatti=an arising. ; natvevasiyā=can never occur. ;

Myanmar Nissaya

tathā taṃ vacanaṃ=သည်။ ; hi saccaṃ=၏။ ; nānāvajjane=အထူးထူးသော အာဝဇ္ဇန်းရှိသော။ ; paṭhamajjhānūpacāre=၌။ ; niruddhassāpi=ချုပ်ပြီးသည်လည်းဖြစ်သော။ ; dukkhindriyassa=၏။ ; ḍaṃsamakasādisamphassenavā=ခြင် မှတ် အစရှိသည်တို့၏ အတွေ့ကြောင့်လည်းကောင်း။ ; visamāsanūpatāpenavā=မညီညွတ်သော နေရာ၌ နေခြင်းကြောင့် လည်းကောင်း။ ; uppatti=ဖြစ်ခြင်းသည်။ ; siyā=၏။ ; antoappanāyaṃ=၌။ ; uppatti=ခြင်းသည်။ ; natvevasiyā=မဖြစ်သည် သာလျှင်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3540 | Chunk: 59

Upacāre vā niruddhampetaṃ na suṭṭhu [M1.178] niruddhaṃ hoti paṭipakkhena avihatattā.

AI Translation based on Nissaya

Moreover, even when this faculty of pain has ceased in the access state, it is not well and truly ceased [M1.178], because it has not been struck down by its opposite.

Vietnamese AI Translation

Hơn nữa, ngay cả khi căn khổ này đã chấm dứt trong trạng thái cận định, nó vẫn chưa được đoạn diệt hoàn toàn và thực sự [M1.178], bởi vì nó chưa bị đánh bại bởi cái đối nghịch của nó.

AI Translation Nissaya

vā=Moreover. ; upacāre=in the access to the first jhāna. ; niruddhampi=even though it has ceased. ; etaṃ=this faculty of pain. ; suṭṭhu=well. ; niruddhaṃ=ceased. ; na hoti=is not. ; kasmā nahoti=why is it not?. ; paṭipakkhena=by its opposite, the faculty of pleasure. ; avihatattā=because it is not yet struck down. ;

Myanmar Nissaya

vā=ကား။ ; upacāre=ပဌမဈာန်၏ ဥပစာရ၌။ ; niruddhampi=ချုပ်ပြီးသည်လည်းဖြစ်သော။ ; etaṃ=ဤဒုက္ခိန္ဒြေသည်။ ; suṭṭhu=စွာ။ ; niruddhaṃ=ခြင်းသည်။ ; na hoti=မဖြစ်။ ; kasmā nahoti=ကား။ ; paṭipakkhena=ဆန့်ကျင်ဘက် ဖြစ်သော သုခန္ဒြေသည်။ ; avihatattā=မပယ်အပ်သေးသည်၏ အဖြစ်ကြောင့်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3541 | Chunk: 59

Antoappanāyaṃ pana pītipharaṇena sabbo kāyo sukhokkanto hoti, sukhokkantakāyassa ca suṭṭhu niruddhaṃ hoti dukkhindriyaṃ paṭipakkhena vihatattā.

AI Translation based on Nissaya

But within absorption, the entire body is steeped in pleasure through the pervasion of rapture. And for a person whose body is steeped in pleasure, the faculty of pain is well and truly ceased, because it has been struck down by its opposite, the faculty of pleasure.

Vietnamese AI Translation

Nhưng bên trong an chỉ định, toàn bộ thân được thấm đẫm trong lạc thông qua sự thấm nhuần của hỷ. Và đối với một người có thân thể thấm đẫm trong lạc, căn khổ được đoạn diệt hoàn toàn và thực sự, bởi vì nó đã bị đánh bại bởi cái đối nghịch của nó, tức là căn lạc.

AI Translation Nissaya

anto appanāyaṃ pana=But within absorption. ; pītipharaṇena=due to the pervasion of rapture. ; sabbā=the entire. ; kāyo=physical body. ; sukhokkanto=is steeped in pleasure. ; hoti=is. ; ca=And. ; sukhokkamantakāyassaca=for a person whose body is steeped in pleasure. ; dukkhindriyaṃ=the faculty of pain. ; suṭṭhu=well. ; niruddhaṃ=ceased. ; hoti=is. ; kasmā hoti=why is it?. ; paṭipakkhena=by its opposite, the faculty of pleasure. ; vihatattā=because it has been struck down. ;

Myanmar Nissaya

anto appanāyaṃ pana=၌မူကား။ ; pītipharaṇena=ပီတိ၏ နှံ့ခြင်းကြောင့်တည်း။ ; sabbā=သော။ ; kāyo=ရူပကာယသည်။ ; sukhokkanto=သုခသို့ သက်သည်။ ; hoti=၏။ ; ca=ဆက်။ ; sukhokkamantakāyassaca=သုခသို့ သက် သော ကိုယ်ရှိသော ပုဂ္ဂိုလ်အားလည်း။ ; dukkhindriyaṃ=သည်။ ; suṭṭhu=စွာ။ ; niruddhaṃ=သည်။ ; hoti=၏။ ; kasmā hoti=ကား။ ; paṭipakkhena=ဆန့်ကျင်ဘက် ဖြစ်သော သုခိန္ဒြေသည်။ ; vihatattā=ဒုက္ခန္ဒြေကို ပယ်အပ်သည်၏ အဖြစ်ကြောင့်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3542 | Chunk: 59

Nānāvajjaneyeva ca dutiyajjhānūpacāre pahīnassāpi domanassindriyassa, yasmā etaṃ vitakkavicārapaccayepi kāyakilamathe cittūpaghāte ca sati uppajjati, vitakkavicārābhāve neva uppajjati.

AI Translation based on Nissaya

Similarly, in the access to the second jhāna, which has various advertings, even though the faculty of grief is abandoned, it may still arise. This is because this faculty of grief arises when there is bodily fatigue and mental affliction, which are conditioned by initial and sustained application. When there is no initial and sustained application, it does not arise.

Vietnamese AI Translation

Tương tự, trong cận định của thiền thứ hai, vốn có nhiều tác ý khác nhau, mặc dù căn ưu đã được từ bỏ, nó vẫn có thể khởi lên. Điều này là vì căn ưu này khởi lên khi có sự mệt mỏi về thân và phiền muộn về tâm, vốn được tầm và tứ làm duyên. Khi không có tầm và tứ, nó không khởi lên.

AI Translation Nissaya

ca=And. ; nānāvajjaneyeva=which has various advertings. ; tattha dutiyajjhānūpacāre=in that access to the second jhāna. ; pahīnassāpi=even though it is abandoned. ; assadomanassindriyassa=of this faculty of grief. ; yasmā=because. ; etaṃ=this faculty of grief. ; vittavicārapaccayepi=also due to the condition of initial and sustained application. ; kāyikalamathe=when there is bodily fatigue. ; cittūpaghātecaand mental affliction. ; sati=when there is. ; uppajjati=it arises. ; vitakkavicārābhāve=when there is no initial and sustained application. ; vena uppajjatiit does not arise. ;

Myanmar Nissaya

ca=ဆက်။ ; nānāvajjaneyeva=အထူးထူးသော အာဝဇ္ဇန်းရှိသည်သာလျှင်ဖြစ်သော။ ; tattha dutiyajjhānūpacāre=ထိုဒုတိယဈာန်၏ ဥပစာရ၌။ ; pahīnassāpi=ပယ်အပ်သည်လည်းဖြစ်သော။ ; assadomanassindriyassa=၏။ ; (တတ္ထသိယာ၌ တတ္တ သဒ္ဒါနှင့်၊ ဒုတိယဇ္ဈာနူပဇာရေ သဒ္ဒါသည် တုလျာဓိကရဏ၊ အဿ သဒ္ဒါနှင့် ဒေါမနဿိန္ဒြိယဿ သဒ္ဒါသည် တုလျာဓိကရဏ။ ဝိသုဒ္ဓိမဂ်ဋီကာ။ သာရတ္ထဒီပနီ။) ; yasmā=ကြောင့်။ ; etaṃ=ဤဒေါမနဿိန္ဒြေသည်။ ; vittavicārapaccayepi=ဝိတက်ဝိစာရ တည်းဟူသော အကြောင်းကြောင့်လည်း။ ; kāyikalamathe=ကိုယ်၏ ပင်ပန်းခြင်းသည် လည်းကောင်း။ ; cittūpaghāteca=စိတ်၏ ပင်ပန်းခြင်းသည်လည်းကောင်။ ; sati=သော်။ ; uppajjati=၏။ ; vitakkavicārābhāve=ဝိတက်ဝိစာရမရှိသည်ရှိသော်။ ; vena uppajjati=မဖြစ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3543 | Chunk: 59

Yattha pana uppajjati, tattha vitakkavicārabhāve.

AI Translation based on Nissaya

Indeed, in whatever mind the faculty of grief arises, it arises there due to the presence of initial and sustained application.

Vietnamese AI Translation

Thật vậy, trong bất kỳ tâm nào mà căn ưu khởi lên, nó khởi lên ở đó là do sự hiện diện của tầm và tứ.

AI Translation Nissaya

pana=Indeed. ; yattha=in whatever mind. ; uppajjati=the faculty of grief arises. ; tattha=in that mind. ; (vitakkavicārabhāvena=due to the presence of initial and sustained application. ; domanassindriyaṃ=the faculty of grief.) ; uppajjati=arises. ;

Myanmar Nissaya

pana=စင်စစ်သော်ကား။ ; yattha=အကြင်စိတ်၌။ ; uppajjati=ဒေါမနဿိန္ဒြေဖြစ်၏။ ; tattha=ထိုစိတ်၌။ ; (vitakkavicārabhāvena=ဝိတက် ဝိစာရရှိခြင်းကြောင့်။ ; domanassindriyaṃ=သည်။) ; uppajjati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3544 | Chunk: 59

Appahīnāyeva ca dutiyajjhānūpacāre vitakkavicārāti tatthassa siyā uppatti, natveva dutiyajjhāne pahīnapaccayattā.

AI Translation based on Nissaya

And since initial and sustained application are not yet abandoned in the access to the second jhāna, the faculty of grief may arise there. But in the second jhāna itself it can never arise, because its condition has been abandoned.

Vietnamese AI Translation

Và vì tầm và tứ chưa được từ bỏ trong cận định của thiền thứ hai, nên căn ưu có thể khởi lên ở đó. Nhưng trong chính thiền thứ hai, nó không bao giờ có thể khởi lên, bởi vì điều kiện của nó đã được từ bỏ.

AI Translation Nissaya

ca saccaṃ=Truly. ; dutiyajjhānūpacāre=in the access to the second jhāna. ; vitakkavicārā=initial and sustained application. ; appahīnāyeva=are not yet abandoned. ; ititasmā=Therefore. ; tattha=in that access to the second jhāna. ; assa=of that faculty of grief. ; uppatti=an arising. ; siyā=may occur. ; dutiyajjhāne=In the second jhāna. ; pahīnapaccayatthā=because its condition (initial and sustained application) has been abandoned. ; (uppatti=an arising.) ; natveva siyā=can never occur. ;

Myanmar Nissaya

ca saccaṃ=မှန်၏။ ; dutiyajjhānūpacāre=၌။ ; vitakkavicārā=တို့ကို။ ; appahīnāyeva=မပယ်အပ်ကုန်သည်သာလျှင်တည်း။ ; ititasmā=ကြောင့်။ ; tattha=ထိုဒုတိယဈာန်၏ ဥပစာရ၌။ ; assa=ထိုဒေါမနဿိန္ဒြေ၏။ ; uppatti=ဖြစ်ခြင်းသည်။ ; siyā=၏။ ; dutiyajjhāne=၌။ ; pahīnapaccayatthā=ပယ်အပ်ပြီးသော ဝိတက် ဝိစာရတည်းဟူသော အကြောင်းရှိသည်၏ အဖြစ်ကြောင့်။ ; (uppatti=ဖြစ်ခြင်းသည်။) ; natveva siyā=လျှင်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3545 | Chunk: 59

Tathā tatiyajjhānūpacāre pahīnassāpi sukhindriyassa pītisamuṭṭhānapaṇītarūpaphuṭṭhakāyassa siyā uppatti, natveva tatiyajjhāne.

AI Translation based on Nissaya

Similarly, in the access to the third jhāna, even though the faculty of pleasure is abandoned, it may still arise for a person whose body is pervaded by the sublime materiality born of rapture.

Vietnamese AI Translation

Tương tự, trong cận định của thiền thứ ba, mặc dù căn lạc đã được từ bỏ, nó vẫn có thể khởi lên đối với một người có thân thể được thấm nhuần bởi sắc pháp vi diệu sinh ra từ hỷ.

AI Translation Nissaya

tathā=Similarly. ; tatiyajjhānūpacāre=in the access to the third jhāna. ; pahīnassāpi=even though it is abandoned. ; sukhindriyassa=of the faculty of pleasure. ; pītisamuṭṭhānapaṇītarūpaphuṭṭhakāyassa=for a person whose body is pervaded by the sublime matter born of rapture. ; uppatti=an arising. ; siyā=may occur. ;

Myanmar Nissaya

tathā=တူ။ ; tatiyajjhānūpacāre=၌။ ; pahīnassāpi=ပယ်အပ်သည်လည်းဖြစ်သော။ ; sukhindriyassa=၏။ ; pītisamuṭṭhānapaṇītarūpaphuṭṭhakāyassa=ပီတိကြောင့်ဖြစ်သော မြတ်သော ရုပ်နှင့် နှံ့သော ကိုယ်ရှိသော ပုဂ္ဂိုလ်အား။ ; uppatti=သည်။ ; siyā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3546 | Chunk: 59

Tatiyajjhāne hi sukhassa paccayabhūtā pīti sabbaso niruddhā hoti.

AI Translation based on Nissaya

But it can never arise in the third jhāna itself. Indeed, it should be understood that in the third jhāna, rapture, which is the condition for pleasure, has completely ceased.

Vietnamese AI Translation

Nhưng nó không bao giờ có thể khởi lên trong chính thiền thứ ba. Thật vậy, cần phải được hiểu rằng trong thiền thứ ba, hỷ, vốn là điều kiện cho lạc, đã hoàn toàn chấm dứt.

AI Translation Nissaya

tatiyajjhāne=In the third jhāna. ; (uppatti=an arising.) ; natveva siyā=can never occur. ; hi saccaṃ=Truly. ; tatiyajjhāne=in the third jhāna. ; sukhassa=of pleasure. ; paccayabhūtā=which is the condition. ; pīti=rapture. ; sabbaso=completely. ; niruddhā=has ceased. ; hoti=has. ; iti=Thus. ; veditabbaṃ=it should be known. ;

Myanmar Nissaya

tatiyajjhāne=၌။ ; (uppatti=သည်။) ; natveva siyā=လျှင်တည်း။ ; hi saccaṃ=၏။ ; tatiyajjhāne=၌။ ; sukhassa=၏။ ; paccayabhūtā=အကြောင်းဖြစ်၍ ဖြစ်သော။ ; pīti=သည်။ ; sabbaso=အကြွင်းမဲ့။ ; niruddhā=ချုပ်သည်။ ; hoti=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3547 | Chunk: 59

Tathā catutthajjhānūpacāre pahīnassāpi somanassindriyassa āsannattā, appanāppattāya upekkhāya abhāvena sammā anatikkantattā ca siyā uppatti, natveva catutthajjhāne.

AI Translation based on Nissaya

Similarly, in the access to the fourth jhāna, even though the faculty of joy has been abandoned, it may still arise due to its proximity and because it has not yet been fully transcended by the absence of equanimity that has reached absorption. But in the fourth jhāna itself, it can never arise.

Vietnamese AI Translation

Tương tự, trong cận định của thiền thứ tư, mặc dù căn hỷ đã được từ bỏ, nó vẫn có thể khởi lên do sự gần gũi của nó và bởi vì nó chưa được vượt qua hoàn toàn bởi sự vắng mặt của tâm xả đã đạt đến an chỉ định. Nhưng trong chính thiền thứ tư, nó không bao giờ có thể khởi lên.

AI Translation Nissaya

tathā=Similarly. ; catutthajjhānūpacāre=in the access to the fourth jhāna. ; pahīnassāpi=even though it is abandoned. ; somanassindriyassa=of the faculty of joy. ; āsannattā=due to its proximity. ; appanāppattāya=that has reached absorption. ; upekkhāya=of equanimity of feeling. ; abhāvena=due to the absence. ; sammā=completely. ; anatikkantattāca=and because it has not yet been transcended. ; uppatti=an arising. ; siyā=may occur. ; catutthajjhāne=In the fourth jhāna. ; (uppatti=an arising.) ; natveva siyā=can never occur. ;

Myanmar Nissaya

tathā=တူ။ ; catutthajjhānūpacāre=၌။ ; pahīnassāpi=သော။ ; somanassindriyassa=၏။ ; āsannattā=ကြောင့်လည်းကောင်း။ ; appanāppattāya=အပ္ပနာသို့ ရောက်သော။ ; upekkhāya=ဝေဒနုပေက္ခာ၏။ ; abhāvena=မရှိသေးသည်၏ အဖြစ်ကြောင့်။ ; sammā=စွာ။ ; anatikkantattāca=မလွန်သည်၏ အဖြစ်ကြောင့်လည်းကောင်း။ ; uppatti=သည်။ ; siyā=၏။ ; catutthajjhāne=၌။ ; (uppatti=သည်။) ; natveva siyā=လျှင်တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3548 | Chunk: 59

Tasmā eva ca ‘‘etthuppannaṃ dukkhindriyaṃ aparisesaṃ nirujjhatī’’ ti tattha tattha aparisesaggahaṇaṃ katanti.

AI Translation based on Nissaya

And for this very reason, the Blessed One included the phrase 'without remainder' in each case, such as, 'here the arisen faculty of pain ceases without remainder.' This is the resolution.

Vietnamese AI Translation

Và chính vì lý do này, Đức Thế Tôn đã bao gồm cụm từ 'không còn dư tàn' trong mỗi trường hợp, chẳng hạn như, 'ở đây, căn khổ đã khởi sinh đoạn diệt không còn dư tàn.' Đây là lời giải quyết.

AI Translation Nissaya

tasmāevaca=Therefore. ; etthuppannaṃ dukkhindriyaṃ aparisesaṃ nirujjhatīti=as 'here the arisen faculty of pain ceases without remainder'. ; tattha tattha=in each respective jhāna. ; aparisesaggahaṇaṃ=the taking up of 'without remainder'. ; (mahāvaggasaṃyutte=in the Mahāvagga Saṃyutta.) ; bhagavatā=by the Blessed One. ; kataṃ=was made. ; itiayaṃ=This. ; parihāro=is the resolution. ;

Myanmar Nissaya

tasmāevaca=သာလျှင်။ ; etthuppannaṃ dukkhindriyaṃ aparisesaṃ nirujjhatīti=ဟူ၍။ ; tattha tattha=ထိုထိုဈာန်၌။ ; aparisesaggahaṇaṃ=အကြွင်းမဲ့ယူခြင်းကို။ ; (mahāvaggasaṃyutte=၌။) ; bhagavatā=သည်။ ; kataṃ=ပြုတော်မူအပ်၏။ ; itiayaṃ=ကား။ ; parihāro=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3549 | Chunk: 59

Etthāha –

AI Translation based on Nissaya

Here, an objector might say:

Vietnamese AI Translation

Ở đây, một người chất vấn có thể nói:

AI Translation Nissaya

ettha=At this point. ; codako=an objector. ; āha=says. ; āha=that is. ;

Myanmar Nissaya

ettha=ဤဝေဒနာကို ပယ်ရာ၌။ ; codako=သည်။ ; āha=၏။ ; āha=ကား။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3550 | Chunk: 59

‘‘athevaṃ tassa tassa jhānassūpacāre pahīnāpi etā vedanā idha kasmā samāharī’’ ti [V1.163] ?

AI Translation based on Nissaya

'If these feelings are abandoned in the access state of each respective jhāna, why are they all gathered together and mentioned here [V1.163] in the context of the fourth jhāna?'

Vietnamese AI Translation

'Nếu những cảm thọ này được từ bỏ trong trạng thái cận định của mỗi thiền tương ứng, tại sao tất cả chúng lại được tập hợp lại và đề cập ở đây [V1.163] trong bối cảnh của thiền thứ tư?'

AI Translation Nissaya

atha=Then. ; evaṃ=in this way. ; tassa tassa jhānassa=of each respective jhāna. ; upacāra=in the access state. ; pahīnāpi=although they are abandoned. ; etā vedanā=these feelings. ; idha=here in the fourth jhāna. ; kasmā=why. ; samāharī=are they gathered together?. ; iti=Thus. ; (codako=the objector. ; āha=says.). ;

Myanmar Nissaya

atha=ထိုသို့ ဈာန်လေးပါးကို ပယ်သည်ဖြစ်လျက်။ ; evaṃ=သို့။ ; tassa tassa jhānassa=၏။ ; upacāra=၌။ ; pahīnāpi=ကုန်သော။ ; etā vedanā=ထိုလေးပါးသော ဝေဒနာတို့ကို။ ; idha=ဤစတုတ္ထဈာန်၌။ ; kasmā=အတီသို့ မူ၍။ ; samāharī=ပေါင်း၍ ဆောင်အပ်ကုန်သနည်း။ ; iti=သို့။ ; (codako=သည်။ ; āha=၏။) ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3551 | Chunk: 59

Sukhaggahaṇatthaṃ [P1.192].

AI Translation based on Nissaya

For the sake of easy comprehension. [P1.192]

Vietnamese AI Translation

Vì mục đích dễ hiểu. [P1.192]

AI Translation Nissaya

sukhaggahaṇatthaṃ=For the sake of easy comprehension. ; samāharā=they are gathered. ;

Myanmar Nissaya

sukhaggahaṇatthaṃ=ယူလွယ်ခြင်းငှါ။ ; samāharā=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3552 | Chunk: 59

Yā hi ayaṃ ‘‘adukkhamasukhan’’ ti ettha adukkhamasukhā vedanā vuttā, sā sukhumā dubbiññeyyā na sakkā sukhena gahetuṃ, tasmā yathā nāma duṭṭhassa yathā tathā vā upasaṅkamitvā gahetuṃ asakkuṇeyyassa goṇassa gahaṇatthaṃ gopo ekasmiṃ vaje sabbā gāvo samāharati, athekekaṃ nīharanto paṭipāṭiyā āgataṃ ‘‘ayaṃ so gaṇhatha nan’’ ti tampi gāhāpeti, evamevaṃ sukhaggahaṇatthaṃ sabbāpi etā samāhari.

AI Translation based on Nissaya

To explain: The feeling spoken of as 'neither-painful-nor-pleasant' is subtle and difficult to discern; it cannot be easily grasped. Therefore, just as a cowherd, in order to catch a fierce bull that cannot be approached and caught in just any old way, first gathers all the cattle into one pen and then, letting them out one by one, points out the fierce one as it comes out in turn, saying, 'This is him, catch him!' and so has it caught; in the very same way, for the sake of easy comprehension, all these feelings were gathered together.

Vietnamese AI Translation

Để giải thích: Cảm thọ được gọi là 'không khổ không lạc' rất vi tế và khó nhận biết; nó không thể được nắm bắt một cách dễ dàng. Do đó, cũng giống như một người chăn bò, để bắt một con bò đực hung dữ không thể tiếp cận và bắt theo bất kỳ cách thông thường nào, trước tiên tập hợp tất cả gia súc vào một chuồng và sau đó, để chúng ra từng con một, chỉ vào con bò hung dữ khi nó đi ra, nói rằng, 'Đây là nó, bắt nó đi!' và nhờ đó bắt được nó; cũng theo cách tương tự, vì mục đích dễ hiểu, tất cả những cảm thọ này đã được tập hợp lại với nhau.

AI Translation Nissaya

hi vitthāremi=To explain. ; adukkhamasukhanti=as 'neither-painful-nor-pleasant'. ; yā ayaṃ adukkhamasukhā=whatever this neither-painful-nor-pleasant. ; vedanā=feeling. ; vuttā=is spoken of. ; sā=that neither-painful-nor-pleasant feeling. ; sukhumā=is subtle. ; dubbiññeyyā=is difficult to discern. ; sukhena=easily. ; gahetuṃ=to grasp. ; nasakkā=is not possible. ; tasmā=Therefore. ; yathā nāma=just as. ; duṭṭhassa=of a fierce. ; yathā tathā vā=in any old way. ; upasaṅkamitvā=having approached. ; gahetuṃ=to catch. ; asakkuṇeyyassa=who cannot be. ; goṇassa=bull. ; gahaṇatthaṃ=in order to catch. ; gopo=a cowherd. ; ekasmiṃ vaje=into one pen. ; sabbā=all. ; gāvo=the cattle. ; samāharati=gathers together. ; atha pacchā=Then afterwards. ; ekekaṃ=one by one. ; nīharanto=letting out. ; hutvā=being. ; paṭipāṭiyā=in sequence. ; āgataṃ=which has come. ; ayaṃ=this one. ; so=is that fierce bull. ; naṃ=him. ; gaṇhatha=catch him!. ; iti=thus. ; vatvā=having said. ; tampi=that fierce bull also. ; gāhāpetiyatā=he has caught, just as. ; evamevaṃ=in the very same way. ; sukhaggahaṇatthaṃ=for the sake of easy comprehension. ; sabbāpi=all. ; etā=these feelings. ; samāhari=were gathered together. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; adukkhamasukhanti=ဟူ၍။ ; yā ayaṃ adukkhamasukhā=သော။ ; vedanā=ကို။ ; vuttā=၏။ ; sā=ထိုအဒုက္ခမသုခဝေဒနာသည်။ ; sukhumā=သိမ်မွေ့၏။ ; dubbiññeyyā=သိနိုင်ခဲ၏။ ; sukhena=လွယ်ကူသဖြင့်။ ; gahetuṃ=ငှါ။ ; nasakkā=ကောင်း။ ; tasmā=ကြောင့်။ ; yathā nāma=ကား။ ; duṭṭhassa=မကောင်းစွာသော။ ; yathā tathā vā=ဟုတ်ဟုတ်ငြားငြးသော အခြင်းအရာအားဖြင့်။ ; upasaṅkamitvā=ချဉ်းကပ်၍။ ; gahetuṃ=ငှါ။ ; asakkuṇeyyassa=မတတ်ကောင်းသော။ ; goṇassa=ကို။ ; gahaṇatthaṃ=ငှါ။ ; gopo=နွားကျောင်းသားည်။ ; ekasmiṃ vaje=နွားခြံတစ်ခု၌။ ; sabbā=ကုန်သော။ ; gāvo=တို့ကို။ ; samāharati=တပေါင်းတည်း ဆောင်၏။ ; atha pacchā=ထို့နောင်မှ။ ; ekekaṃ=တစ်ကောင် တစ်ကောင်သော နွားကို။ ; nīharanto=ခြံမှ ထုတ်သည်။ ; hutvā=၍။ ; paṭipāṭiyā=အစဉ်အားဖြင့်။ ; āgataṃ=လာသော။ ; ayaṃ=ဤနွားသည်။ ; so=ထိုကြမ်းသောနွားပင်တည်း။ ; naṃ=ကို။ ; gaṇhatha=ဖမ်းကြပါကုန်လော့။ ; iti=သို့။ ; vatvā=၍။ ; tampi=ထိုကြမ်းသော နွားကိုလည်း။ ; gāhāpetiyatā=ဖမ်းစေသကဲ့သို့။ ; evamevaṃ=သာလျှင်။ ; sukhaggahaṇatthaṃ=ယူလွယ်စေခြင်းငှါ။ ; sabbāpi=ကုန်သော။ ; etā=ထိုဝေဒနာတို့ကို။ ; samāhari=ပေါင်း၍ ဆောင်တော်မူ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3553 | Chunk: 59

Evañhi samāhaṭā etā dassetvā ‘‘yaṃ neva sukhaṃ, na dukkhaṃ, na somanassaṃ, na domanassaṃ, ayaṃ adukkhamasukhāvedanā’’ ti sakkā hoti esā gāhayituṃ.

AI Translation based on Nissaya

For when these feelings have been gathered together and shown in this way, it becomes possible to have this feeling of equanimity grasped by saying: 'Whatever is not pleasure, not pain, not joy, and not grief, that is the neither-painful-nor-pleasant feeling.'

Vietnamese AI Translation

Vì khi những cảm thọ này đã được tập hợp và chỉ ra theo cách này, có thể làm cho cảm thọ xả này được nắm bắt bằng cách nói: 'Bất cứ điều gì không phải là lạc, không phải là khổ, không phải là hỷ, và không phải là ưu, đó chính là cảm thọ không khổ không lạc.'

AI Translation Nissaya

evaṃ=Thus. ; samāhaṭā=gathered together. ; etā=these feelings. ; dassetvā=having shown. ; yaṃ=whatever principle. ; nevasukhaṃ=is not pleasure. ; nadukkhaṃ=is not pain. ; nasomanassaṃ=is not joy. ; nadomanassaṃ=is not grief. ; ayaṃ=this feeling. ; adukkhamasukhāvedanā=is the neither-painful-nor-pleasant feeling. ; iti=Thus. ; esā=this feeling of equanimity. ; gāhayituṃ=to have grasped. ; sakkā=is possible. ; hoti=is. ;

Myanmar Nissaya

evaṃ=သို့။ ; samāhaṭā=ပေါင်း၍ ဆောင်ကုန်သော။ ; etā=ထိုဝေဒနာတို့ကို။ ; dassetvā=၍။ ; yaṃ=အကြင်သဘောတရားသည်။ ; nevasukhaṃ=သုခလည်းမဟုတ်။ ; nadukkhaṃ=ဒုက္ခလည်းမဟုတ်။ ; nasomanassaṃ=မဟုတ်။ ; nadomanassaṃ=မဟုတ်။ ; ayaṃ=ဤဝေဒနာသည်။ ; adukkhamasukhāvedanā=မည်၏။ ; iti=သို့။ ; esā=ဤဥပေက္ခာဝေဒနာကို။ ; gāhayituṃ=ယူခြင်းငှါ။ ; sakkā=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3554 | Chunk: 59

Apica adukkhamasukhāya cetovimuttiyā paccayadassanatthañcāpi etā vuttāti veditabbā.

AI Translation based on Nissaya

Moreover, it should be understood that these feelings are mentioned here also for the purpose of showing the conditions for the liberation of mind that is neither-painful-nor-pleasant (i.e., the fourth jhāna).

Vietnamese AI Translation

Hơn nữa, cần phải được hiểu rằng những cảm thọ này được đề cập ở đây cũng nhằm mục đích chỉ ra các điều kiện cho sự giải thoát của tâm mà không khổ không lạc (tức là thiền thứ tư).

AI Translation Nissaya

apica aparo=Another. ; (nayo=method. ; mayā=by me. ; vuccate=will be stated.). ; adukkhamasukhāya=which has the feeling of equanimity. ; cetovimuttiyā=of the fourth jhana, the liberation of mind. ; paccayadassanatthañcāpi=also for the purpose of showing the conditions. ; etā=these feelings. ; vuttā=were spoken of only in the fourth jhāna. ; iti=Thus. ; veditabbā=it should be known. ;

Myanmar Nissaya

apica aparo=သော။ ; (nayo=ကို။ ; mayā=သည်။ ; vuccate=အံ့။) ; adukkhamasukhāya=ဥပေက္ခာ ဝေဒနာရှိသော။ ; cetovimuttiyā=စတုတ္ထဈာန်၏။ ; paccayadassanatthañcāpi=အကြောင်းကို ပြခြင်းငှါလည်း။ ; etā=ထိုဝေဒနာတို့ကို။ ; vuttā=စတုတ္ထဈာန်၌သာ ဟောတော်မူအပ်ကုန်၏။ ; iti=သို့။ ; veditabbā=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3555 | Chunk: 59

Sukhadukkhappahānādayo hi tassā paccayā.

AI Translation based on Nissaya

Indeed, the abandoning of pleasure, pain, and so on are the conditions for that liberation of mind.

Vietnamese AI Translation

Thật vậy, việc từ bỏ lạc, khổ, v.v. là điều kiện cho sự giải thoát của tâm đó.

AI Translation Nissaya

hi saccaṃ=Truly. ; sukhadukkhappahānādayo=the abandoning of pleasure and pain, and so on. ; tassā cetovimuttiyā=of that liberation of mind. ; paccayā=are the conditions. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; sukhadukkhappahānādayo=သုခ ဒုက္ခကို ပယ်ခြင်း အစရှိသည်တို့သည်။ ; tassā cetovimuttiyā=ထိုစတုတ္ထဈာန်၏။ ; paccayā=အကြောင်းတို့တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3556 | Chunk: 59

Yathāha –

AI Translation based on Nissaya

As it is said:

Vietnamese AI Translation

Như có lời nói:

AI Translation Nissaya

yathāha=As it is said. ; kiṃāha=What is said?. ;

Myanmar Nissaya

yathāha= ; kiṃāha=ကား။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3557 | Chunk: 59

‘‘cattāro kho, āvuso, paccayā adukkhamasukhāya cetovimuttiyā samāpattiyā.

AI Translation based on Nissaya

'Friend, there are four conditions for the attainment of the liberation of mind that is neither-painful-nor-pleasant.

Vietnamese AI Translation

'Này hiền giả, có bốn điều kiện để đạt được sự giải thoát của tâm mà không khổ không lạc.

AI Translation Nissaya

cattāro.la. samāpattiyāti='Four conditions... for the attainment...'. ; (mūlapaṇṇāsake=In the Mūlapaṇṇāsaka. ; mahāvedallasutte=in the Mahāvedalla Sutta. ; dhammasenāpatitthero=the Elder, General of the Dhamma.) ; āha=said. ;

Myanmar Nissaya

cattāro.la. samāpattiyāti=ဟူ၍။ ; (mūlapaṇṇāsake=၌။ ; mahāvedallasutte=၌။ ; dhammasenāpatitthero=သည်။) ; āha=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3558 | Chunk: 59

Idhāvuso, bhikkhu sukhassa ca pahānā … pe … catutthaṃ jhānaṃ upasampajja viharati.

AI Translation based on Nissaya

Here, friend, a monk, with the abandoning of pleasure... abides having attained the fourth jhāna.

Vietnamese AI Translation

Này hiền giả, ở đây, một Tỳ-khưu, với việc từ bỏ lạc... an trú sau khi đắc thiền thứ tư.

AI Translation Nissaya

āvuso=Friend. ; koṭṭhika=Koṭṭhika. ; kho=indeed. ; cattāro=four. ; paccayā=conditions. ; adukkhamasukhāya=which has the feeling of equanimity. ; cetovimuttiyā=of the liberation of mind called the fourth jhāna. ; samāpattiyā=for the attainment. ; samāpattiyā=for entering. ; (gaṇṭhi). ; paccayā=are the conditions. ; āvuso=Friend. ; koṭṭhika=Koṭṭhika. ; idha=here. ; bhikkhu=a monk. ; sukhassaca=of pleasure. ; pahānā=because of the abandoning. ; la=... ; catutthaṃ=the fourth. ; jhānaṃ=jhāna. ; upasampajja=having attained. ; viharati=abides. ;

Myanmar Nissaya

āvuso=ငါ့ရှင်။ ; koṭṭhika= ; kho=စင်စစ်။ ; cattāro=ကုန်သော။ ; paccayā=တို့သည်။ ; adukkhamasukhāya=ဥပေက္ခာ ဝေဒနာရှိသော။ ; cetovimuttiyā=စတုတ္ထဈာန်ဟု ဆိုအပ်သော။ ; samāpattiyā=သမာပတ်ကို။ ; samāpattiyā=ဝင်စားခြင်းငှါ။ ; (ဂဏ္ဌိ)။ ; paccayā=အကြောင်းတို့တည်း။ ; āvuso=ငါ့ရှင်။ ; koṭṭhika= ; idha=၌။ ; bhikkhu=သည်။ ; sukhassaca=ကိုလည်း။ ; pahānā=ခြင်းကြောင့်။ ; la= ; catutthaṃ=သော။ ; jhānaṃ=ကို။ ; upasampajja=၍။ ; viharati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3559 | Chunk: 59

Ime kho āvuso, cattāro paccayā adukkhamasukhāya cetovimuttiyā samāpattiyā’’ ti ( ma. ni. 1.458).

AI Translation based on Nissaya

These, friend Koṭṭhika, are the four conditions for the attainment of the liberation of mind that is neither-painful-nor-pleasant.' (M.i.296).

Vietnamese AI Translation

Này hiền giả Koṭṭhika, đó là bốn điều kiện để đạt được sự giải thoát của tâm mà không khổ không lạc.' (M.i.296).

AI Translation Nissaya

āvuso=Friend. ; koṭṭhika=Koṭṭhika. ; ime cattāro=these four. ; kho=indeed. ; adukkhamasukhā=which has the feeling of equanimity. ; cetovimuttiyā=of the liberation of mind. ; samāpattiyā=for the attainment. ; paccayā=are the conditions. ;

Myanmar Nissaya

āvuso=ငါ့ရှင် ။ ; koṭṭhika= ; ime cattāro=တို့သည်။ ; kho=စင်စစ်။ ; adukkhamasukhā=ဥပေက္ခဝေဒနာရှိသော။ ; cetovimuttiyā=ကို။ ; samāpattiyā=ငှါ။ ; paccayā=တို့သည်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3560 | Chunk: 59

Yathā vā aññattha pahīnāpi sakkāyadiṭṭhiādayo tatiyamaggassa vaṇṇabhaṇanatthaṃ tattha pahīnāti vuttā [M1.179], evaṃ vaṇṇabhaṇanatthampetassa jhānassetā idha vuttātipi veditabbā.

AI Translation based on Nissaya

Alternatively, it should also be understood that these feelings are mentioned here for the purpose of praising this jhāna, just as identity view and so on, though abandoned elsewhere [M1.179] (i.e., with the first path), are said to be abandoned at the third path for the purpose of praising it.

Vietnamese AI Translation

Hoặc, cũng cần phải được hiểu rằng những cảm thọ này được đề cập ở đây nhằm mục đích tán thán thiền này, cũng giống như thân kiến, v.v., mặc dù được từ bỏ ở nơi khác [M1.179] (tức là với đạo thứ nhất), nhưng lại được nói là được từ bỏ ở đạo thứ ba nhằm mục đích tán thán nó.

AI Translation Nissaya

vā=Alternatively. ; aññattha=elsewhere, in the path of the stream-enterer, not the non-returner's path. ; pahīnāpi=although abandoned. ; sakkāsadiṭṭhiādayo=identity view and so on. ; tatiyamaggassa=of the third path (of non-returning). ; vaṇṇabhaṇanatthaṃ=for the purpose of praising its virtues. ; tattha=there, in that path of non-returning. ; pahīnā=are abandoned. ; iti=thus. ; vuttāyathā=just as they are spoken of. ; evaṃtathā=in the same way. ; etassa jhānassa=of this fourth jhāna. ; vaṇṇabhaṇanatthaṃ=for the purpose of praising its virtues. ; etā=these feelings. ; idha=here in this fourth jhāna. ; vuttā=are spoken of. ; itipi=thus also. ; veditabbā=it should be known. ;

Myanmar Nissaya

vā=ကား။ ; aññattha=အနာဂါမိမဂ်မှ တပါးသော သေတာပတ္တိမဂ်၌။ ; pahīnāpi=သော။ ; sakkāsadiṭṭhiādayo=တို့ကို။ ; tatiyamaggassa=အနာဂါမိမဂ်မှ တပါးသော သောတာပတ္တမဂ်၌။ ; vaṇṇabhaṇanatthaṃ=ကျေးဇူးကို ဆိုလိုခြင်းငှါ။ ; tattha=ထိုအနာဂါမိ မဂ်၌။ ; pahīnā=ကုန်၏။ ; iti=ဤသို့။ ; vuttāyathā=ဟောတော်မူအပ်ကုန်သကဲ့သို့။ ; evaṃtathā=ထို့အတူ။ ; etassa jhānassa=ထိုစတုတ္ထဈာန်၏။ ; vaṇṇabhaṇanatthaṃ=ငှါ။ ; etā=ထိုဝေဒနာတို့ကို။ ; idha=ဤစတုတ္ထဈာန်၌။ ; vuttā=၏။ ; itipi=ဤသို့လည်း။ ; veditabbā=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3561 | Chunk: 59

Paccayaghātena vā ettha rāgadosānaṃ atidūrabhāvaṃ dassetumpetā vuttāti veditabbā.

AI Translation based on Nissaya

Or again, it should be understood that these feelings are mentioned here also to show how very far this jhāna is from passion and aversion, by way of having destroyed their conditions.

Vietnamese AI Translation

Hoặc một lần nữa, cần phải được hiểu rằng những cảm thọ này được đề cập ở đây cũng để cho thấy thiền này xa rời tham ái và sân hận đến mức nào, bằng cách đã hủy diệt các điều kiện của chúng.

AI Translation Nissaya

vā=Or alternatively. ; paccayaghātena=by destroying the conditions of things like passion. ; ettha=here in this fourth jhāna. ; rāgadosānaṃ=of passion and aversion. ; atidūrabhāvaṃ=the state of being very far from. ; dassetumpi=also to show. ; etā=these feelings. ; vuttā=were spoken of. ; iti=Thus. ; veditabbā=it should be known. ;

Myanmar Nissaya

vā=ကား။ ; paccayaghātena=ရာဂအစရှိသည်တို့၏ အကြောင်းဖြစ်သော သုခအစရှိသည်ကိုပယ်သဖြင့်။ ; ettha=ဤစတုတ္ထဈာန်၌။ ; rāgadosānaṃ=တို့၏။ ; atidūrabhāvaṃ=အလွန်ဝေးသည်၏ အဖြစ်ကို။ ; dassetumpi=ငှါလည်း။ ; etā=ထိုဝေဒနာတို့ကို။ ; vuttā=ကုန်၏။ ; iti=သို့။ ; veditabbā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3562 | Chunk: 59

Etāsu hi sukhaṃ somanassassa paccayo, somanassaṃ rāgassa, dukkhaṃ domanassassa, domanassaṃ dosassa.

AI Translation based on Nissaya

Indeed, among these feelings, pleasure is a condition for joy, and joy is a condition for passion; pain is a condition for grief, and grief is a condition for aversion.

Vietnamese AI Translation

Thật vậy, trong số những cảm thọ này, lạc là điều kiện cho hỷ, và hỷ là điều kiện cho tham ái; khổ là điều kiện cho ưu, và ưu là điều kiện cho sân hận.

AI Translation Nissaya

hi saccaṃ=Truly. ; etāsu=among these feelings. ; sukhaṃ=pleasure. ; somanassassa=of joy. ; paccayo=is a condition. ; somanassaṃ=Joy. ; rāgassa=of passion. ; paccayo=is a condition. ; dukkhaṃ=Pain. ; domanassa=of grief. ; pacṇayo=is a condition. ; domanassaṃ=Grief. ; dosassa=of aversion. ; paccayo=is a condition. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; etāsu=ထိုဝေဒနာတို့တွင်။ ; sukhaṃ=သည်။ ; somanassassa=၏။ ; paccayo=တည်း။ ; somanassaṃ=သည်။ ; rāgassa=၏။ ; paccayo=တည်း။ ; dukkhaṃ=သည်။ ; domanassa=၏။ ; pacṇayo=တည်း။ ; domanassaṃ=သည်။ ; dosassa=၏။ ; paccayo=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3563 | Chunk: 59

Sukhādighātena ca sappaccayā rāgadosā hatāti atidūre hontīti.

AI Translation based on Nissaya

And it should be understood that by the destruction of pleasure and so on, lust and hatred along with their causes are destroyed; therefore, they are very far away.

Vietnamese AI Translation

Và cần phải được hiểu rằng bằng việc hủy diệt lạc, v.v., tham và sân cùng với các nguyên nhân của chúng cũng bị hủy diệt; do đó, chúng ở rất xa.

AI Translation Nissaya

sukhādighātenaca=and by the destruction of pleasure, etc. ; sappaccayā=lust and hatred that arise with their causes. ; hatā=are destroyed. ; ititasmā=therefore. ; atidūre=are very far away. ; honti=they are. ; iti=thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

sukhādighātenaca=သုခအစရှိသည်ကို ပယ်သဖြင့်လည်း။ ; sappaccayā=အကြောင်းနှင့်တကွဖြစ်ကုန်သော ရာဂဒေါသတို့ကို။ ; hatā=ကုန်၏။ ; ititasmā=ကြောင့်။ ; atidūre=အလွန်ဝေးကုန်သည်။ ; honti=ကုန်၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3564 | Chunk: 60

Adukkhamasukhan ti dukkhābhāvena adukkhaṃ.

AI Translation based on Nissaya

Neither-painful-nor-pleasant means 'not-painful' due to the absence of pain.

Vietnamese AI Translation

**Không-khổ-không-lạc** có nghĩa là 'không-khổ' do sự vắng mặt của khổ.

AI Translation Nissaya

adukkhamasukhanti=as for 'neither-painful-nor-pleasant'. ; dukkhābhāvena=by the absence of pain. ; adukkhaṃ=it is called 'not-painful'. ;

Myanmar Nissaya

adukkhamasukhanti=ကား။ ; dukkhābhāvena=ဒုက္ခမဟုတ်သောအားဖြင့်။ ; adukkhaṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3565 | Chunk: 60

Sukhābhāvena asukhaṃ.

AI Translation based on Nissaya

And 'not-pleasant' due to the absence of pleasure.

Vietnamese AI Translation

Và 'không-lạc' do sự vắng mặt của lạc.

AI Translation Nissaya

sukhabhāvena=by the absence of pleasure. ; asukhaṃ=it is called 'not-pleasant'. ;

Myanmar Nissaya

sukhabhāvena=အားဖြင့်။ ; asukhaṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3566 | Chunk: 60

Etenettha dukkhasukhapaṭipakkhabhūtaṃ tatiyavedanaṃ dīpeti, na dukkhasukhābhāvamattaṃ.

AI Translation based on Nissaya

By this, it indicates here the third feeling which is the opposite of pain and pleasure, not the mere absence of pain and pleasure.

Vietnamese AI Translation

Bằng điều này, nó chỉ ra ở đây cảm thọ thứ ba đối nghịch với khổ và lạc, chứ không phải chỉ là sự vắng mặt của khổ và lạc.

AI Translation Nissaya

etena=by this statement of the opposite of pleasure and pain. ; ettha=here, in the context of the fourth jhāna. ; dukkhasukhapaṭipakkhabhūtaṃ=which has become the opposite of pain and pleasure. ; tatiyavedanaṃ=the third feeling, the feeling of equanimity. ; dīpeti=it indicates. ; dukkhasukhābhāvamattaṃ=the mere absence of pain and pleasure. ; nadīpeti=it does not indicate. ;

Myanmar Nissaya

etena=ဤသုခ ဒုက္ခတို့၏ ဆန့်ကျင်ဘက်စကားကို ဆိုသဖြင့်။ ; ettha=ဤစတုတ္ထဈာန်၏ အရာ၌။ ; dukkhasukhapaṭipakkhabhūtaṃ=ဒုက္ခသုခတို့၏ ဆန့်ကျင်ဘက်ဖြစ်၍ ဖြစ်သော။ ; tatiyavedanaṃ=ဥပေက္ခာဝေဒနာကို။ ; dīpeti=၏။ ; dukkhasukhābhāvamattaṃ=ဒုက္ခ သုခမရှိခြင်းမျှကို။ ; nadīpeti=မပြ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3567 | Chunk: 60

Tatiyavedanā nāma adukkhamasukhā, upekkhātipi vuccati.

AI Translation based on Nissaya

The third feeling, namely 'neither-painful-nor-pleasant', is also called 'equanimity'.

Vietnamese AI Translation

Cảm thọ thứ ba, tức là 'không-khổ-không-lạc', cũng được gọi là 'xả'.

AI Translation Nissaya

tatiyavedanānāma=as for the third feeling. ; adukkhamasukhā=it is the feeling that is neither painful nor pleasant. ; upekkhātipi=also as 'equanimity'. ; vuccati=it is called. ;

Myanmar Nissaya

tatiyavedanānāma=ကား။ ; adukkhamasukhā=ဒုက္ခမည်သည်လည်းမဟုတ် သုခမည်သည်လည်း မဟုတ်သော ဝေဒနာတည်း။ ; upekkhātipi=ဟူ၍လည်း။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3568 | Chunk: 60

Sā iṭṭhāniṭṭhaviparītānubhavanalakkhaṇā.

AI Translation based on Nissaya

It has the characteristic of experiencing that which is contrary to the desirable and the undesirable.

Vietnamese AI Translation

Nó có đặc tính là cảm nghiệm cái đối nghịch với cái đáng mong muốn và cái không đáng mong muốn.

AI Translation Nissaya

sā=that feeling of equanimity. ; iṭṭhāniṭṭhaviparītānubhavanalakkhaṇā=has the characteristic of experiencing the neutral object, which is contrary to desirable and undesirable objects. ;

Myanmar Nissaya

sā=ထိုဥပေက္ခာဝေဒနာသည်။ ; iṭṭhāniṭṭhaviparītānubhavanalakkhaṇā=ဣဋ္ဌာရုံ အနိဋ္ဌာရုံတို့မှ ပြန်သော ဣဋ္ဌမဇ္ဈတ္တာရုံကို ခံစားခြင်း လက္ခဏာရှိ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3569 | Chunk: 60

Upekkhāsatipārisuddhin ti upekkhāya janitasatipārisuddhiṃ.

AI Translation based on Nissaya

Purity of mindfulness due to equanimity means the purity of mindfulness produced by equanimity.

Vietnamese AI Translation

**Sự thanh tịnh của chánh niệm do tâm xả** có nghĩa là sự thanh tịnh của chánh niệm được tạo ra bởi tâm xả.

AI Translation Nissaya

upekkhāsatipārisuddhinti=as for 'purity of mindfulness due to equanimity'. ; upekkhāya=by specific neutrality (tatramajjhattatā-upekkhā). ; janitasatipārisuddhiṃ=the purity of mindfulness that is produced. ;

Myanmar Nissaya

upekkhāsatipārisuddhinti=ကား။ ; upekkhāya=တတြမဇ္ဈတ္တုပေက္ခာသည်။ ; janitasatipārisuddhiṃ=ဖြစ်စေအပ်သော သတိ၏ စင်ကြယ်ခြင်းရှိသော။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3570 | Chunk: 60

Imasmiñhi jhāne suparisuddhā sati, yā ca tassā satiyā pārisuddhi, sā upekkhāya katā, na aññena.

AI Translation based on Nissaya

Indeed, in this jhāna, mindfulness is exceedingly pure. And whatever purity that mindfulness has, it is created by equanimity, not by anything else.

Vietnamese AI Translation

Thật vậy, trong thiền này, chánh niệm cực kỳ thanh tịnh. Và bất cứ sự thanh tịnh nào mà chánh niệm đó có được, nó đều được tạo ra bởi tâm xả, chứ không phải bởi bất cứ điều gì khác.

AI Translation Nissaya

hi saccaṃ=truly. ; imasmiṃ jhāne=in this jhāna. ; sati=mindfulness. ; suparisuddhā=is extremely pure. ; ca=and. ; tassā satiyā=of that mindfulness. ; yā pārisuddhiṃ=whatever purity. ; atthi=there is. ; sā pārisuddhi=that purity. ; upekkhāya=by equanimity. ; katā=is made. ; aññena=by another factor. ; nakatā=is not made. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; imasmiṃ jhāne=ဤစတုတ္ထဈာန်၌။ ; sati=သည်။ ; suparisuddhā=အလွန်စင်ကြယ်၏။ ; ca=ဆက်၍ ဆိုဦးအံ့။ ; tassā satiyā=၏။ ; yā pārisuddhiṃ=အကြင်စင်ကြယ်ခြင်းသည်။ ; atthi=၏။ ; sā pārisuddhi=ကို။ ; upekkhāya=တတြမဇ္ဈတ္တုပေက္ခာသည်။ ; katā=စီမံ ထုံးမိန့်အပ်၏။ ; aññena=တစ်ပါးသော တရားသည်။ ; nakatā=မအပ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3571 | Chunk: 60

Tasmā etaṃ ‘‘upekkhāsatipārisuddhin’’ ti vuccati.

AI Translation based on Nissaya

Therefore, this is called 'purity of mindfulness due to equanimity'.

Vietnamese AI Translation

Do đó, điều này được gọi là 'sự thanh tịnh của chánh niệm do tâm xả'.

AI Translation Nissaya

tasmā=therefore. ; etaṃ=this. ; upekkhāsatipārisuddhinti=as 'purity of mindfulness due to equanimity'. ; vuccati=it is called. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; etaṃ=ဤစတုတ္ထဈာန်ကို။ ; upekkhāsatipārisuddhinti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3572 | Chunk: 60

Yāya ca upekkhāya ettha [P1.193] satiyā pārisuddhi hoti, sā atthato tatramajjhattatāti veditabbā.

AI Translation based on Nissaya

And that equanimity by which there is purity of mindfulness here [P1.193] should be understood, in essence, as specific neutrality (tatramajjhattatā).

Vietnamese AI Translation

Và tâm xả mà nhờ đó có sự thanh tịnh của chánh niệm ở đây [P1.193] cần phải được hiểu, về bản chất, là sự trung lập chuyên biệt (tatramajjhattatā).

AI Translation Nissaya

ca=and as for its nature. ; yāya upekkhāya=by which equanimity. ; ettha=here. ; satiyā=of mindfulness. ; pārisuddhi=purity. ; hoti=is. ; sā=that equanimity. ; atthato=in terms of its essence. ; tatramajjhattatāti=as specific neutrality. ; veditabbā=should be known. ;

Myanmar Nissaya

ca=တရားကိုယ်ကို ဆိုအံ့။ ; yāya upekkhāya=အကြင် ဥပေက္ခာဖြင့်။ ; ettha=ဤစတုတ္ထဈာန်၌။ ; satiyā=၏။ ; pārisuddhi=သည်။ ; hoti=၏။ ; sā=ထိုဥပေက္ခာကို။ ; atthato=တရားကိုယ်အားဖြင့်။ ; tatramajjhattatāti=ဟူ၍။ ; veditabbā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3573 | Chunk: 60

Na kevalañcettha tāya satiyeva parisuddhā, apica kho sabbepi sampayuttadhammā, satisīsena pana desanā vuttā.

AI Translation based on Nissaya

And not only is mindfulness purified by it here, but rather all associated states are pure; however, the teaching is given with mindfulness as the principal factor.

Vietnamese AI Translation

Và không chỉ có chánh niệm được thanh tịnh bởi nó ở đây, mà đúng hơn là tất cả các pháp tương ưng đều thanh tịnh; tuy nhiên, lời dạy được đưa ra với chánh niệm là yếu tố chính.

AI Translation Nissaya

ca=and further. ; kevalaṃ=only. ; ettha=here. ; tāya=by that equanimity. ; satiyeva=only mindfulness. ; parisuddhā=is pure. ; na=it is not. ; apica kho=but rather. ; sabbepi=all. ; sampayuttadhammā=associated states. ; parīsuddhā=are pure. ; pana tathāpi=however. ; satisīsena=with mindfulness as the head. ; desanā=the teaching. ; vuttā=is stated. ;

Myanmar Nissaya

ca=ဆိုဖွယ်ရှိသေး၏။ ; kevalaṃ=သက်သက်။ ; ettha=၌။ ; tāya=ထိုဥပေက္ခာဖြင့်။ ; satiyeva=သတိစေတသိက်သည်သာလျှင်။ ; parisuddhā=သည်။ ; na=မဟုတ်သေး။ ; apica kho=စင်စစ်သော်ကား။ ; sabbepi=သော။ ; sampayuttadhammā=တို့သည်။ ; parīsuddhā=ကုန်၏။ ; pana tathāpi=သော်လည်း။ ; satisīsena=သဖြင့်။ ; desanā=ကို။ ; vuttā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3574 | Chunk: 60

Tattha kiñcāpi ayaṃ upekkhā heṭṭhāpi tīsu jhānesu vijjati, yathā pana divā sūriyappabhābhibhavā sommabhāvena ca attano upakārakattena vā sabhāgāya rattiyā alābhā divā [V1.164] vijjamānāpi candalekhā aparisuddhā hoti apariyodātā, evamayampi tatramajjhattupekkhācandalekhā vitakkādipaccanīkadhammatejābhibhavā sabhāgāya ca upekkhāvedanārattiyā alābhā vijjamānāpi paṭhamajjhānādibhede aparisuddhā hoti.

AI Translation based on Nissaya

In this regard, although this equanimity exists in the three lower jhānas, it is not pure. Just as the crescent moon [V1.164], though existing during the day, is not pure and not bright, being overwhelmed by the sun's light and lacking its corresponding night which is helpful to it or of a similar cool nature; so too this 'crescent moon of specific neutrality,' though existing in the classifications of the first jhāna and so on, is not pure, being overwhelmed by the power of opposing factors like applied thought and lacking its corresponding 'night of the feeling of equanimity.'

Vietnamese AI Translation

Về vấn đề này, mặc dù tâm xả này tồn tại trong ba thiền thấp hơn, nhưng nó không thanh tịnh. Giống như mặt trăng lưỡi liềm [V1.164], mặc dù tồn tại vào ban ngày, nhưng không trong sáng và không rực rỡ, bị ánh sáng mặt trời lấn át và thiếu đi màn đêm tương ứng hữu ích cho nó hoặc có bản chất mát mẻ tương tự; thì cũng vậy, 'mặt trăng lưỡi liềm của sự trung lập chuyên biệt' này, mặc dù tồn tại trong các phân loại của thiền thứ nhất, v.v., nhưng không thanh tịnh, bị sức mạnh của các yếu tố đối nghịch như tầm lấn át và thiếu đi 'màn đêm của thọ xả' tương ứng của nó.

AI Translation Nissaya

tattha=among them. ; kiñcāpi=although. ; ayaṃ upekkhā=this equanimity. ; heṭṭhāpi tīsu jhānesu=also in the three lower jhānas. ; vijjati=exists. ; pana=however. ; yathā=just as. ; divā=during the day. ; candalekhā=the crescent moon. ; vijjamānāpi=even though it exists. ; sūriyappabhābhibhavā=due to being overwhelmed by the sun's light. ; ca=and. ; sabhāgāya=of its corresponding. ; rattiyā=night. ; alābhā=due to the lack. ; ca=and. ; sommabhāvena=because of its cool nature. ; vā=or. ; attano=its own. ; upakārakattena=as a helper. ; aparisuddhā=is not pure. ; apariyodātā=is not bright. ; hoti=it is. ; evaṃ=so too. ; ayampi tatramajjhattupekkhācandalekhā=this crescent moon of specific neutrality. ; vitakkādipaccanīkadhammatejābhibhavā=due to being overwhelmed by the power of opposing factors like applied thought. ; ca=and. ; sabhāgāya=of its corresponding. ; upekkhāvedanārattiyā=night of the feeling of equanimity. ; alābhā=due to the lack. ; paṭhamajjhānādibhede=in the divisions of the first jhāna and so on. ; vijjamānāpi=even though it exists. ; aparisuddhā=is not pure. ; hoti=it is. ;

Myanmar Nissaya

tattha=ထိုဝေဒနာအပေါင်းတို့တွင်။ ; ayaṃ upekkhā=ဤတတြမဇ္ဈတ္တုပေက္ခာသည်။ ; heṭṭhāpi=၌လည်း။ ; tīsu=ကုန်သော။ ; jhānesu=တို့၌။ ; kiñcāpi vijjavi=အကယ်၍ ကားရှိ၏ရှင့်။ ; pana thāpi=ယင်းသို့ တပဲရှိလင့်ကစား။ ; divā=နေ့ကာလ၌။ ; sūriyappabhābhibhavā=နေအရောင်ဖြင့်နှိပ်စက်ခြင်းကြောင့် လည်းကောင်း။ ; sommabhāveneca=ချမ်းအေးသည်၏ အဖြစ်ကြောင့်လည်းကောင်း။ ; attano=မိမိဟု ဆိုအပ်သော လ, ရေးအား။ ; upakārakattenavā=လည်းကောင်း။ ; sabhāgāya=သဘောတူသော။ ; rattiyā=ညဉ့်ကို။ ; alābhāca=မရခြင်းကြောင့်လည်းကောင်း။ ; divā=၌။ ; vijjāmānepi=သော်လည်း။ ; candalekhā=လ ရေးသည်။ ; aparisuddhā=မစင်ကြယ်သည်။ ; apariyodātā=ပြိုးပြိုးပြက် မရှိသည်။ ; hoti yathā=ကဲ့သို့။ ; evaṃ thā=အတူ။ ; ayampi tatramajjhattupekkhācandalekhā=ဤတတြမဇ္ဈတ္တုပေက္ခာဟူသော လ ရေးသည်။ ; vitakkadipacca nīkadhammatejābhibhavāca=ဝိတက် အစရှိသော ဆန့်ကျင်ဘက် ဖြစ်သော တရားတို့၏ အစွမ်းသတ္တိသည် နှိပစက်အပ်သည်၏ အဖြစ်ကြောင့် လည်းကောင်း။ ; sabhāgāya=တူသော။ ; upekkhā vedanārattiyā=ဥပေက္ခာ ဝေဒနာတည်းဟူသော ညဉ့်ကို။ ; alābhāca=ကြောင့်လည်းကောင်း။ ; paṭhamājjhānādibhede=အပြား၌။ ; vijjāmānapi=တတြမဇ္ဈတ္တုပေက္ခာ ထင်ရှားရှိသော်လည်း။ ; aparisuddhā=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3575 | Chunk: 60

Tassā ca aparisuddhāya divā aparisuddhacandalekhāya pabhā viya sahajātāpi satiādayo aparisuddhāva honti.

AI Translation based on Nissaya

And due to its impurity, just like the light of an impure crescent moon in the daytime, the co-arisen factors like mindfulness are also impure.

Vietnamese AI Translation

Và do sự không thanh tịnh của nó, giống như ánh sáng của mặt trăng lưỡi liềm không trong sáng vào ban ngày, các pháp đồng sinh như chánh niệm cũng không thanh tịnh.

AI Translation Nissaya

tassāca aparisuddhāya=and due to its being impure. ; divā aparisuddhacandalekhāya pabhā viya=like the light of an impure crescent moon during the day. ; sahajātāpi satiādayo=even the co-arisen factors of mindfulness and so on. ; aparisuddhāva=are likewise impure. ; honti=they are. ;

Myanmar Nissaya

tassāca=ထိုတတြမဇ္ဈတ္တု ပေက္ခာ၏လည်း။ ; aparisuddhāya=ခြင်းကြောင့်။ ; divā=၌။ ; aparisuddhacandaloya=၏။ ; pabhāviya=ကဲ့သို့။ ; sahajātāpi=သဟဇာတ် လည်းဖြစ်ကုန်သော။ ; satiādayo=တို့သည်။ ; aparisuddhāva=သာလျှင်။ ; honti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3576 | Chunk: 60

Tasmā tesu ekampi ‘‘upekkhāsatipārisuddhin’’ ti na vuttaṃ.

AI Translation based on Nissaya

Therefore, not even one of those [lower jhānas] is called 'purity of mindfulness due to equanimity'.

Vietnamese AI Translation

Do đó, không một thiền nào trong số các thiền thấp hơn đó được gọi là 'sự thanh tịnh của chánh niệm do tâm xả'.

AI Translation Nissaya

tasmā=therefore. ; tesu=among those three lower jhānas. ; ekampi=not even one jhāna. ; upekkhāsatipārisuddhinti=as 'purity of mindfulness due to equanimity'. ; navuttaṃ=is not said. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; tesu=ထိုအောက်ဈာန်သုံးပါးတို့တွင်။ ; ekampi=တစ်ခုသော ဈာန်မျှကိုလည်း။ ; upekkhāsatipārisuddhinti=ဟူ၍။ ; navuttaṃ=မဟောအပ်။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3577 | Chunk: 60

Idha pana vitakkādipaccanīkatejābhibhavābhāvā sabhāgāya ca upekkhāvedanārattiyā paṭilābhā ayaṃ tatramajjhattupekkhācandalekhā ativiya parisuddhā.

AI Translation based on Nissaya

But here, due to the absence of being overwhelmed by the power of opposing factors like applied thought, and due to obtaining its corresponding 'night of the feeling of equanimity,' this 'crescent moon of specific neutrality' is exceedingly pure.

Vietnamese AI Translation

Nhưng ở đây, do không bị sức mạnh của các yếu tố đối nghịch như tầm lấn át, và do có được 'màn đêm của thọ xả' tương ứng, 'mặt trăng lưỡi liềm của sự trung lập chuyên biệt' này cực kỳ thanh tịnh.

AI Translation Nissaya

idha pana=but here, in this fourth jhāna. ; vitakkādipaccanīkatejābhibhavābhāvāca=and due to the absence of being overwhelmed by the power of opposing factors like applied thought. ; sabhāgāya=of the corresponding. ; upekkhā vedanārattiyā=night of the feeling of equanimity. ; paṭilābhāca=and due to obtaining. ; ayaṃ tatra majjhattupekkhācandalekhā=this crescent moon of specific neutrality. ; ativiya=is exceedingly. ; parisuddhā=pure. ;

Myanmar Nissaya

idha pana=ဤစတုတ္ထဈာန်မှာမူကား။ ; vitakkādipaccanīkatejābhibhavābhāvāca=ဝိတက် အစရှိသော ဆန့်ကျင်ဘက်ဖြစ်သော တရားတို့၏ အစွမ်းသတ္တိသည် နှိပ်စက်ခြင်း မရှိသည်၏ အဖြစ်ကြောင့် လည်းကောင်း။ ; sabhāgāya=မသာ။ ; upekkhā vedanārattiyā=ကို။ ; paṭilābhāca=ကြောင့်လည်းကောင်း။ ; ayaṃ tatra majjhattupekkhācandalekhā=သည်။ ; ativiya=လျှင်။ ; parisuddhā=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3578 | Chunk: 60

Tassā parisuddhattā parisuddhacandalekhāya pabhā viya sahajātāpi satiādayo parisuddhā honti pariyodātā.

AI Translation based on Nissaya

Because of its purity, like the light of a pure crescent moon, the co-arisen factors like mindfulness are pure and bright.

Vietnamese AI Translation

Vì sự thanh tịnh của nó, giống như ánh sáng của mặt trăng lưỡi liềm trong sáng, các pháp đồng sinh như chánh niệm cũng thanh tịnh và rực rỡ.

AI Translation Nissaya

tassā=of that specific neutrality. ; parisuddhattā=because of its purity. ; parisuddhacandalekhāya=of a pure crescent moon. ; pabhāviya=like the light. ; sahajātāpi=also the co-arisen. ; satiādayo=mindfulness and so on. ; parisuddhā=are pure. ; pariyodātā=are bright. ; honti=they are. ;

Myanmar Nissaya

tassā=ထိုတတြမဇ္ဈတ္တုပေက္ခာ၏။ ; parisuddhattā=ကြောင့်။ ; parisuddhacandalekhāya=၏။ ; pabhāviya=အရောင်ကဲ့သို့။ ; sahajātāpi=လည်းဖြစ်ကုန်သော။ ; satiādayo=တို့သည်။ ; parisuddhā=ကုန်သည်။ ; pariyodātā=ကုန်သည်။ ; honti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3579 | Chunk: 60

Tasmā idameva ‘‘upekkhāsatipārisuddhin’’ ti vuttanti veditabbaṃ.

AI Translation based on Nissaya

Therefore, it should be understood that only this [fourth jhāna] is called 'purity of mindfulness due to equanimity'.

Vietnamese AI Translation

Do đó, cần phải được hiểu rằng chỉ có thiền này [thiền thứ tư] mới được gọi là 'sự thanh tịnh của chánh niệm do tâm xả'.

AI Translation Nissaya

tasmā=therefore. ; idhameva=only this fourth jhāna. ; upekkhāsatipārisuddhinti=as 'purity of mindfulness due to equanimity'. ; vuttaṃ=was said. ; iti=thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; idhameva=ဤစတုတ္ထဈာန်ကိုသာလျှင်။ ; upekkhāsatipārisuddhinti=ဟူ၍။ ; vuttaṃ=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3580 | Chunk: 60

Catutthan ti gaṇanānupubbatā catutthaṃ, catutthaṃ uppannantipi catutthaṃ.

AI Translation based on Nissaya

Fourth: it is fourth in numerical sequence; it is called 'fourth' also because it arises fourth.

Vietnamese AI Translation

**Thứ tư**: nó là thứ tư theo thứ tự đếm số; nó cũng được gọi là 'thứ tư' bởi vì nó khởi lên thứ tư.

AI Translation Nissaya

catuttanti=as for 'fourth'. ; gaṇānānupubbatā tāya=by way of numerical sequence. ; catutthaṃ=it is fourth. ; catutthaṃ=fourth. ; uppannaṃ=having arisen. ; iti tasmāpi=also for that reason. ; catutthaṃ=it is called fourth. ;

Myanmar Nissaya

catuttanti=ကား။ ; gaṇānānupubbatā tāya=ဖြင့်။ ; catutthaṃ=၏။ ; catutthaṃ=လေးကြိမ်မြောက်။ ; uppannaṃ=၏။ ; iti tasmāpi=ကြောင့်လည်း။ ; catutthaṃ=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3581 | Chunk: 60

Imāni cattāri jhānāni pubbabhāgepi nānā, maggakkhaṇepi.

AI Translation based on Nissaya

These four jhānas are distinct in the preliminary phase, and also at the moment of the path.

Vietnamese AI Translation

Bốn thiền này khác biệt trong giai đoạn chuẩn bị, và cũng khác biệt tại thời điểm của đạo.

AI Translation Nissaya

cattāri=four. ; imāni jhānāni=these jhānas. ; pubbabhāgepi=also in the preliminary phase. ; nānā=are distinct. ; honti=they are. ; maggakkhaṇepi=also at the moment of the path. ; nānā=are distinct. ; honti=they are. ;

Myanmar Nissaya

cattāri=ကုန်သော။ ; imāni jhānāni=တို့သည်။ ; pubbabhāgepi=မဂ်၏ ရှေ့အဖို့၌လည်း။ ; nānā=အသီးအသီ။ ; honti=ကုန်၏။ ; maggakkhaṇepi=မဂ်ခဏ၌လည်း။ ; nānā=အသီးအသီး။ ; honti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3582 | Chunk: 60

Pubbabhāge samāpattivasena nānā, maggakkhaṇe nānāmaggavasena.

AI Translation based on Nissaya

In the preliminary phase, they are distinct by way of attainment; at the moment of the path, they are distinct by way of paths associated with different jhānas.

Vietnamese AI Translation

Trong giai đoạn chuẩn bị, chúng khác biệt về phương diện chứng đắc; tại thời điểm của đạo, chúng khác biệt về phương diện các đạo tương ưng với các thiền khác nhau.

AI Translation Nissaya

pubbabhāge=in the preliminary phase. ; samāpattivasena=by way of attainment. ; nānā=they are distinct. ; honati=they are. ; maggakkhaṇe=at the moment of the path. ; nānāmaggavasena=by way of paths with different jhānas. ; nānā=they are distinct. ; honti=they are. ;

Myanmar Nissaya

pubbabhāge=မဂ်၏ ရှေ့အဖို့၌။ ; samāpattivasena=ဖြင့်။ ; nānā=အသီးအသီ။ ; honati=ကုန်၏။ ; maggakkhaṇe=၌။ ; nānāmaggavasena=အထူးထူးသော ဈာန်ရှိသော မဂ်၏ အစွမ်းဖြင့်။ ; nānā=သီ။ ; honti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3583 | Chunk: 60

Ekassa hi paṭhamamaggo paṭhamajjhāniko [M1.180] hoti, dutiyamaggādayopi paṭhamajjhānikā vā dutiyādīsu aññatarajjhānikā vā.

AI Translation based on Nissaya

Indeed, for one person, the first path is associated with the first jhāna, and the subsequent paths may also be associated with the first jhāna or with one of the other jhānas (second, etc.).

Vietnamese AI Translation

Thật vậy, đối với một người, đạo thứ nhất tương ưng với thiền thứ nhất, và các đạo tiếp theo cũng có thể tương ưng với thiền thứ nhất hoặc với một trong các thiền khác (thứ hai, v.v.).

AI Translation Nissaya

hi vitthāremi=to elaborate. ; ekassa=for one person. ; paṭhamamaggo=the first path. ; paṭhamajjhāniko=is of the first jhāna. ; vā=or. ; hoti=it is. ; dutiyamaggā dayopi=the second path and so on. ; paṭhamajjhānikāvā=are of the first jhāna. ; vā=or. ; honti=they are. ; dutiyādīsu=among the second and so on. ; aññatarajjhānikāvā=are of some other jhāna. ; honti=they are. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; ekassa=တစ်ယောက်သော ပုဂ္ဂိုလ်၏။ ; paṭhamamaggo=သောတာပတ္တိမဂ်သည်။ ; paṭhamajjhāniko=ရှိသည်။ ; vā=နှင့်တူသည်။ ; hoti=၏။ ; dutiyamaggā dayopi=တို့သည်လည်း။ ; paṭhamajjhānikāvā=ကုန်သည်လည်း။ ; vā=နှင်တူကုန်သည်လည်း။ ; honti=ကုန်၏။ ; dutiyādīsu=တို့တွင်။ ; aññatarajjhānikāvā=တစ်ပါးပါးသော ဈာန်ရှိကုန်သည်လည်း။ ; honti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3584 | Chunk: 60

Ekassa paṭhamamaggo dutiyādīnaṃ aññatarajjhāniko hoti, dutiyādayopi dutiyādīnaṃ aññatarajjhānikā vā paṭhamajjhānikā vā.

AI Translation based on Nissaya

For another person, the first path is associated with one of the jhānas from the second onwards, and the subsequent paths may also be associated with one of the jhānas from the second onwards, or with the first jhāna.

Vietnamese AI Translation

Đối với một người khác, đạo thứ nhất tương ưng với một trong các thiền từ thiền thứ hai trở đi, và các đạo tiếp theo cũng có thể tương ưng với một trong các thiền từ thiền thứ hai trở đi, hoặc với thiền thứ nhất.

AI Translation Nissaya

ekassa=for one person. ; paṭhamamaggo=the first path. ; dutiyādīnaṃ=of the second and so on. ; aññatarajjhāniko=is of some other jhāna. ; hoti=it is. ; dutiyādayopi=the second path and so on. ; dutiyādīnaṃ=of the second and so on. ; aññatarajjhānikāvā=are of some other jhāna. ; paṭhamajjhānikāvā=or are of the first jhāna. ; honti=they are. ;

Myanmar Nissaya

ekassa=ပုဂ္ဂိုလ်၏။ ; paṭhamamaggo=သည်။ ; dutiyādīnaṃ=တို့တွင်။ ; aññatarajjhāniko=သည်။ ; hoti=၏။ ; dutiyādayopi=ဒုတိယမဂ် အစရှိသည်တို့သည်လည်း။ ; dutiyādīnaṃ=ဒုတိယဈာန်အစရှိသည်တို့တွင်။ ; aññatarajjhānikāvā=ရှိကုန်သည်လည်း။ ; paṭhamajjhānikāvā=ရှိကုန်သည်လည်း။ ; honti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3585 | Chunk: 60

Evaṃ cattāropi maggā jhānavasena sadisā vā asadisā vā ekaccasadisā vā honti.

AI Translation based on Nissaya

In this way, by means of jhāna, all four paths can be similar, dissimilar, or partly similar.

Vietnamese AI Translation

Theo cách này, bằng phương tiện của thiền, tất cả bốn đạo có thể tương tự nhau, không tương tự nhau, hoặc một phần tương tự nhau.

AI Translation Nissaya

evaṃ=in this way. ; cattāropi=all four. ; maggā=paths. ; jhānavasena=by way of the mundane jhāna. ; sadisāvā=can be similar. ; honti=they are. ; asadisāvā=or dissimilar. ; honti=they are. ; ekaccasadisāvā=or partly similar. ; honti=they are. ;

Myanmar Nissaya

evaṃ=ဤသို့ ဆိုအပ်ပြီးသော နည်းဖြင့်။ ; cattāropi=ကုန်သော။ ; maggā=မဂ်စိတ်တို့သည်။ ; jhānavasena=လောကီဈာန်၏ အစွမ်းဖြင့်။ ; sadisāvā=တူကုန်သည်လည်း။ ; honti=ကုန်၏။ ; asadisāvā=သည်လည်း။ ; honti=ကုန်၏။ ; ekaccasadisāvā=အချို့တူကုန်သည်လည်း။ ; honti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3586 | Chunk: 60

Ayaṃ panassa viseso pādakajjhānaniyamena hoti.

AI Translation based on Nissaya

However, this distinction of the path occurs through determination by the foundation jhāna.

Vietnamese AI Translation

Tuy nhiên, sự phân biệt này của đạo xảy ra thông qua sự quyết định bởi thiền nền tảng.

AI Translation Nissaya

pana=however. ; assa=of this path. ; ayaṃviseso=this distinction. ; pādakajjhānaniyamena=by the determination of the foundation jhāna. ; hoti=occurs. ;

Myanmar Nissaya

pana=စင်စစ်သော်ကား။ ; assa=ထိုမဂ်၏။ ; ayaṃviseso=သည်။ ; pādakajjhānaniyamena=ပါဒကဈာန်ဖြင့် မှတ်အပ်သော အားဖြင့်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3587 | Chunk: 60

Paṭhamajjhānalābhino hi paṭhamajjhānā vuṭṭhāya vipassantassa uppannamaggo paṭhamajjhāniko hoti, maggaṅgabojjhaṅgāni panettha paripuṇṇāneva honti.

AI Translation based on Nissaya

Indeed, for one who has attained the first jhāna, the path that arises when practicing insight after emerging from the first jhāna is associated with the first jhāna; in this case, the path factors and enlightenment factors are both fully complete.

Vietnamese AI Translation

Thật vậy, đối với người đã đắc thiền thứ nhất, đạo khởi lên khi thực hành tuệ quán sau khi xuất khỏi thiền thứ nhất sẽ tương ưng với thiền thứ nhất; trong trường hợp này, các đạo chi và giác chi đều hoàn toàn đầy đủ.

AI Translation Nissaya

hi vitthāremi=to elaborate. ; paṭhamajjhānā=from the first jhāna. ; vuṭṭhāya=having emerged. ; vipassantassa=for one practicing insight. ; paṭhamajjhānalābhino=of a person who has attained the first jhāna. ; uppannamaggo=the path that has arisen. ; paṭhamajjhāniko=is of the first jhāna. ; hoti=it is. ; pana=and as for the completeness. ; ettha=in this path associated with the first jhāna. ; maggaṅgabojjhaṅgāni=the path factors and enlightenment factors. ; paripuṇṇāneva=are fully complete as eight and seven respectively. ; honti=they are. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; paṭhamajjhānā=မှ။ ; vuṭṭhāya=၍။ ; vipassantassa=ဝိပဿနာရှုသော။ ; paṭhamajjhānalābhino=ပုဂ္ဂိုလ်၏။ ; uppannamaggo=ဖြစ်ပြီးသော မဂ်သည်။ ; paṭhamajjhāniko=သည်။ ; hoti=၏။ ; pana=ပြည့်စုံသည်ကို ဆိုအံံ။ ; ettha=ဤပထမဈာန်နှင့်တူစွာဖြစ်သော မဂ်၌။ ; maggaṅgabojjhaṅgāni=တို့သည်။ ; paripuṇṇāneva=ရှစ်ပါးနှစ်ပါး ရှိကုန်သည်ဖြစ်၍ ပြည့်စုံကုန်သည်သာလျှင်။ ; honti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3588 | Chunk: 60

Dutiyajjhānato vuṭṭhāya vipassantassa uppanno dutiyajjhāniko hoti, maggaṅgāni [P1.194] panettha satta honti.

AI Translation based on Nissaya

The path that arises for one practicing insight after emerging from the second jhāna is associated with the second jhāna; [P1.194] here, there are seven path factors.

Vietnamese AI Translation

Đạo khởi lên đối với người thực hành tuệ quán sau khi xuất khỏi thiền thứ hai sẽ tương ưng với thiền thứ hai; [P1.194] ở đây, có bảy đạo chi.

AI Translation Nissaya

dutiyajjhānato=from the second jhāna. ; vuṭṭhāya=having emerged. ; vipassantassa=for one practicing insight. ; uppannā=the path that has arisen. ; dutiyajjhāniko=is of the second jhāna. ; hoti=it is. ; pana=and as for the incompleteness. ; ettha=in this path associated with the second jhāna. ; maggaṅgāni=the path factors. ; satta=are seven, excluding right thought. ; honti=they are. ;

Myanmar Nissaya

dutiyajjhānato=မှ။ ; vuṭṭhāya=ထ၍။ ; vipassantassa=၏။ ; uppannā=ဖြစ်သော မဂ်သည်။ ; dutiyajjhāniko=ရှိသည်။ ; hoti=၏။ ; pana=မပြည့်စုံသည်ကို ဆိုဦးအံ့။ ; ettha=ဤဒုတိယဈာန်နှင့်တူစွာဖြစ်သော မဂ်၌။ ; maggaṅgāni=တို့သည်။ ; satta=သမ္မာသင်္ကပ္ပ ကြဉ်သော (၇) ပါးတို့သည် ; honti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3589 | Chunk: 60

Tatiyajjhānato vuṭṭhāya vipassantassa uppanno tatiyajjhāniko, maggaṅgāni panettha satta, bojjhaṅgāni cha honti.

AI Translation based on Nissaya

The path that arises for one practicing insight after emerging from the third jhāna is associated with the third jhāna; here, there are seven path factors and six enlightenment factors.

Vietnamese AI Translation

Đạo khởi lên đối với người thực hành tuệ quán sau khi xuất khỏi thiền thứ ba sẽ tương ưng với thiền thứ ba; ở đây, có bảy đạo chi và sáu giác chi.

AI Translation Nissaya

tatiyajjhānato=from the third jhāna. ; vuṭṭhāya=having emerged. ; vipassantassa=for one practicing insight. ; uppanno=the path that has arisen. ; tatiyajjhāniko=is of the third jhāna. ; hoti=it is. ; pana=and as for the incompleteness. ; ettha=in this path with the third jhāna. ; maggaṅgāni=the path factors. ; satta=are seven, excluding right thought. ; honti=they are. ; bojjhaṅgāni=the enlightenment factors. ; cha=are six, excluding the enlightenment factor of zest. ; honti=they are. ;

Myanmar Nissaya

tatiyajjhānato=မှ။ ; vuṭṭhāya=၍။ ; vipassantassa=၏။ ; uppanno=ဖြစ်သော မဂ်သည်။ ; tatiyajjhāniko=တူသည်။ ; hoti=၏။ ; pana=မပြည့်စုံသည်ကို ဆိုဦးအံ့။ ; ettha=ဤတတိယဈာန်ရှိသော မဂ်၌။ ; maggaṅgāni=တို့သည်။ ; satta=သမ္မာသင်္ကပ္ပမှ တပါး (၇) ပါးတို့သည်။ ; honti=ကုန်၏။ ; bojjhaṅgāni=တို့သည်။ ; cha=ပီတိ သမ္ဗောဇ္ဈင်မှ တပါး (၆) ပါးတို့သည်။ ; honti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3590 | Chunk: 60

Esa nayo catutthajjhānato paṭṭhāya yāva nevasaññānāsaññāyatanā.

AI Translation based on Nissaya

This same principle should be understood as applying from the fourth jhāna up to the base of neither-perception-nor-non-perception.

Vietnamese AI Translation

Nguyên tắc tương tự này cần được hiểu là áp dụng từ thiền thứ tư cho đến phi tưởng phi phi tưởng xứ.

AI Translation Nissaya

catutthajjhānato=from the fourth jhāna. ; paṭṭhāya=beginning. ; yāva=up to. ; tanaññaḥ=. ; yāva nevasaññānāsaññāyatanā=the attainment of neither perception nor non-perception. ; esa eso=this same. ; nayo=principle. ; veditabbo=should be understood. ;

Myanmar Nissaya

catutthajjhānato=မှ။ ; paṭṭhāya=စ၍။ ; yāva=အကြင်ရွေ့လောက်။ ; tanaññaḥ= ; yāva nevasaññānāsaññāyatanā=ဈာန်တိုင်အောင်။ ; esa eso=ဤသို့ သဘောရှိသော။ ; nayo=ကို။ ; veditabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3591 | Chunk: 60

Āruppe catukkapañcakajjhānaṃ uppajjati, tañca kho lokuttaraṃ, na lokiyanti vuttaṃ.

AI Translation based on Nissaya

In the formless realms, the fourth and fifth jhānas arise, and it is said that they are supramundane, not mundane.

Vietnamese AI Translation

Trong các cõi vô sắc, thiền thứ tư và thứ năm khởi lên, và được nói rằng chúng là siêu thế, không phải thế gian.

AI Translation Nissaya

āruppe=in the four formless realms. ; catukkapañcakajjhānaṃ=the fourth and fifth jhāna. ; uppajjati=arises. ; tañca kho=and that jhāna of the fourfold and fivefold system. ; lokuttaraṃ=is supramundane. ; na lokiyaṃ=it is not mundane. ; iti=thus. ; vuttaṃ=it is said. ;

Myanmar Nissaya

āruppe=အရူပလေးဘုံ၌။ ; catukkapañcakajjhānaṃ=သည်။ ; uppajjati=၏။ ; tañca kho=ထိုစတုက္က ပဉ္စကဈာန်သည်လည်း။ ; lokuttaraṃ=ဈာန်သာတည်း။ ; na lokiyaṃ=မဟုတ်။ ; iti=သို့။ ; vuttaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3592 | Chunk: 60

Ettha kathanti ?

AI Translation based on Nissaya

How is this possible here? (This is the question).

Vietnamese AI Translation

Làm thế nào điều này có thể xảy ra ở đây? (Đây là câu hỏi).

AI Translation Nissaya

ettha=in this statement (from the Aṭṭhasālinī). ; vā=or, in the formless realm. ; kathaṃ hoti=how can it happen by the power of the foundation jhāna? ; iti ayaṃ=this is. ; pucchā=the question. ;

Myanmar Nissaya

ettha=ဤ (အဋ္ဌသာလိနီ) စကား၌။ ; vā=အရူပဘုံ၌။ ; kathaṃ hoti=ပါဒကဈာန်၏ အစွမ်းဖြင့် အတီသို့ ဖြစ်နိုင်လေအံ့နည်း။ ; iti ayaṃ=ကား။ ; pucchā=တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3593 | Chunk: 60

Etthapi paṭhamajjhānādīsu yato vuṭṭhāya sotāpattimaggaṃ paṭilabhitvā arūpasamāpattiṃ bhāvetvā yo āruppe uppanno, taṃjhānikāva tassa tattha tayo maggā uppajjanti.

AI Translation based on Nissaya

Here too, in the formless realm: for whichever stream-enterer is reborn in the formless realm after having attained the path of stream-entry by emerging from one of the jhānas (from the first onwards) and then developing a formless attainment, for that person, the three higher paths that arise there will be associated with that same jhāna which was the foundation for their path of stream-entry.

Vietnamese AI Translation

Ở đây cũng vậy, trong cõi vô sắc: đối với bất kỳ vị Nhập lưu nào tái sinh vào cõi vô sắc sau khi đã chứng đắc đạo Nhập lưu bằng cách xuất khỏi một trong các thiền (từ thiền thứ nhất trở đi) rồi sau đó phát triển một chứng đắc vô sắc, thì đối với vị đó, ba đạo cao hơn khởi lên ở đó sẽ tương ưng với chính thiền đã làm nền tảng cho đạo Nhập lưu của họ.

AI Translation Nissaya

etthapi=also in this formless realm. ; paṭhamajjhānādīsu=among the first jhāna and so on. ; yato=from whichever unmarked jhāna. ; vuṭṭhāya=having emerged. ; sotāpattimaggaṃ=the path of stream-entry. ; paṭilabhitvā=having attained. ; arūpasamāpattiṃ=the formless attainment. ; bhāvetvā=having developed. ; āruppe=in the formless realm. ; yo=whichever stream-enterer. ; uppanno=is reborn. ; taṃ jhānikāva=only having that jhāna which was the basis of the path of stream-entry. ; tassa=for that stream-enterer who is reborn in the formless realm. ; tattha=in that formless realm. ; tayo=three. ; maggā=higher paths. ; uppajjanti=arise. ; tanaññaḥ=. ; tassa=for that stream-enterer who is reborn in the formless realm. ; tattha=in that formless realm. ; tayo=three. ; maggā=higher paths. ; uppajjanti=arise. ; tanaññaḥ=. ; tassa=for that stream-enterer who is reborn in the formless realm. ; tattha=in that formless realm. ; tayo=three. ; maggā=paths. ; taṃ jhānikāva=only having that jhāna which was the basis of the path of stream-entry. ; hutvā=having become. ; uppajjanti=arise. ;

Myanmar Nissaya

etthapi=ဤအရူပဘုံ၌လည်း။ ; paṭhamajjhānādīsu=တို့တွင်။ ; yato=အကြင်အမှတ်မရှိသော ဈာန်မှ။ ; vuṭṭhāya=ထ၍။ ; sotāpattimaggaṃ=ကို။ ; paṭilabhitvā=ရပြီး၍။ ; arūpasamāpattiṃ=ကို။ ; bhāvetvā=ပွားစေ၍။ ; āruppe=၌။ ; yo=အကြင်သောတာပန် ပုဂ္ဂိုလ်သည်။ ; uppanno=သော်။ ; taṃ jhānikāva=ထိုသောတာပတတိမဂ်၏ အခြေဖြစ်သော ဈာန်ရှိသည်သာလျှင် ဖြစ်ကုန်သော။ ; tassa=ထိုအရူပလေးဘုံ၌ ဖြစ်သော သောတာပန်ပုဂ္ဂိုလ်၏။ ; tattha=ထိုအရူပလေးဘုံ၌။ ; tayo=သော။ ; maggā=အထက်မဂ် တို့သည်။ ; uppajjanti=ကုန်၏။ ; တနည်း။ ; tassa=ထိုအရူပလေးဘုံ၌ဖြစ်သော သောတာပန် ပုဂ္ဂိုလ်၏။ ; tattha=ထိုအရူပဘုံ၌။ ; tayo=သော။ ; maggā=အထက်မဂ်တို့သည်။ ; uppajjanti=ကုန်၏။ ; tanaññaḥ= ; tassa=ထိုအရူပလေးဘုံ၌ဖြစ်သော သောတပန်ပုဂ္ဂိုလ်၏။ ; tattha=ထိုအရူပဘုံ၌။ ; tayo=သော။ ; maggā=တို့သည်။ ; taṃ jhānikāva=ထိုသောတာပတ္တမဂ်၏ အခြေဖြစ်သော ဈာန်ရှိကုန်သည်သာ လျှင်။ ; hutvā=၍။ ; uppajjanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3594 | Chunk: 60

Evaṃ pādakajjhānameva niyameti.

AI Translation based on Nissaya

Thus, only the foundation jhāna determines it.

Vietnamese AI Translation

Như vậy, chỉ có thiền nền tảng quyết định nó.

AI Translation Nissaya

evaṃ=in this way. ; pādakajjhānameva=only the foundation jhāna. ; niyameti=determines it. ;

Myanmar Nissaya

evaṃ=ဤသို့ ဆိုအပ်ပြီးသော နည်းဖြင့်။ ; pādakajjhānameva=သာလျှင်။ ; niyameti=မှတ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3595 | Chunk: 60

Keci pana therā ‘‘vipassanāya ārammaṇabhūtā khandhā niyamentī’’ ti vadanti.

AI Translation based on Nissaya

However, some elders say, "The aggregates that are the object of insight determine it."

Vietnamese AI Translation

Tuy nhiên, một số trưởng lão nói, "Các uẩn là đối tượng của tuệ quán quyết định nó."

AI Translation Nissaya

pana=however, to state a different view. ; keci=some. ; therā=elders. ; vipassanāya=of insight. ; arammaṇabhūtā=which have become the object. ; khandhā=the aggregates of the three planes of existence that are contemplated. ; niyamenti=determine it. ; iti=thus. ; vadanti=they say. ;

Myanmar Nissaya

pana=ဝါဒအထူး အမိန့်ဆိုဦးအံ့။ ; keci=အချို့သော ။ ; therā=တို့သည်။ ; vipassanāya=၏။ ; arammaṇabhūtā=ကုန်သော။ ; khandhā=သုံးသပ်အပ်သော တေဘူမက ခန္ဓာတို့သည်။ ; niyamenti=ကုန်၏။ ; iti=သို့။ ; vadanti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3596 | Chunk: 60

Keci ‘‘puggalajjhāsayo niyametī’’ ti vadanti.

AI Translation based on Nissaya

Some say, "A person's inclination determines it."

Vietnamese AI Translation

Một số nói, "Khuynh hướng của một người quyết định nó."

AI Translation Nissaya

keci=some elders. ; puggalajjhāsayo=a person's inclination. ; niyameti=determines it. ; iti=thus. ; vadanti=they say. ;

Myanmar Nissaya

keci=တို့သည်။ ; puggalajjhāsayo=သည်။ ; niyameti=၏။ ; iti=သို့။ ; vadanti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3597 | Chunk: 60

Keci ‘‘vuṭṭhānagāminī vipassanā niyametī’’ ti vadanti.

AI Translation based on Nissaya

Some say, "The insight leading to emergence determines it."

Vietnamese AI Translation

Một số nói, "Tuệ quán dẫn đến sự xuất khởi quyết định nó."

AI Translation Nissaya

keci=some elders. ; vuṭṭhānagāminīvipassanā=the insight leading to emergence. ; niyameti=determines it. ; iti=thus. ; vadanti=they say. ;

Myanmar Nissaya

keci=တို့သည်။ ; vuṭṭhānagāminīvipassanā=သည်။ ; niyameti=၏။ ; iti=သို့။ ; vadanti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3598 | Chunk: 60

Tatrāyaṃ anupubbikathā – vipassanāniyamena hi sukkhavipassakassa uppannamaggopi, samāpattilābhino jhānaṃ pādakaṃ akatvā uppannamaggopi, paṭhamajjhānaṃ pādakaṃ katvā pakiṇṇakasaṅkhāre sammasitvā uppāditamaggopi paṭhamajjhānikova hoti, sabbesu satta bojjhaṅgāni [V1.165] aṭṭha maggaṅgāni pañca jhānaṅgāni honti.

AI Translation based on Nissaya

Herein is the sequential explanation: Indeed, according to the determination by insight, the path that has arisen for a dry-insight practitioner; the path that has arisen for one who has attainment but without making a jhāna the basis; and the path produced after making the first jhāna the basis and contemplating miscellaneous formations—all are associated with the first jhāna. In all these cases, there are seven factors of enlightenment, [V1.165] eight path factors, and five jhāna factors.

Vietnamese AI Translation

Sau đây là lời giải thích tuần tự: Thật vậy, theo sự quyết định bởi tuệ quán, đạo đã khởi lên đối với một hành giả thuần quán; đạo đã khởi lên đối với người có chứng đắc nhưng không lấy thiền làm cơ sở; và đạo được tạo ra sau khi lấy thiền thứ nhất làm cơ sở và quán chiếu các hành tạp — tất cả đều tương ưng với thiền thứ nhất. Trong tất cả các trường hợp này, có bảy giác chi, [V1.165] tám đạo chi, và năm thiền chi.

AI Translation Nissaya

tatra=in those three views along with the view of determination by insight. ; ayaṃ=this which will be stated. ; anupubbikathā=is the sequential explanation. ; hi vitthāremi=to elaborate. ; vipassanāniyamena=by the determination of insight. ; sukkhavipassakassa=for a dry-insight practitioner. ; vā=or. ; uppannamaggopi=the path that has arisen. ; samāpattilābhino=for a person who has attained attainment. ; vā=or. ; jhānaṃ=a jhāna. ; pādakaṃ=as a base. ; akatvā=without making. ; uppannamaggopi=and the path that has arisen. ; paṭhamajjhānaṃ=the first jhāna. ; pādakaṃ=as a base. ; katvā=having made. ; pakiṇṇakasaṅkhāre=miscellaneous mental formations of the sense-sphere. ; sammasitvā=having contemplated. ; uppāditamaggopi=and the path that has been produced. ; paṭhamajjhānikova=is only of the first jhāna. ; hoti=it is. ; sabbesu=in all cases of the path of a dry-insight practitioner, the path without a jhāna as a base, and the path produced by contemplating miscellaneous formations. ; satta=seven. ; bojjhaṅgāni=factors of enlightenment. ; honti=there are. ; aṭṭha=eight. ; maggaṅgāni=path factors. ; honti=there are. ; pañca=five. ; jhānaṅgāni=jhāna factors. ; honti=there are. ;

Myanmar Nissaya

tatra=ထိုဝိပဿနာနိယမနှင့်တကွ သုံးပါးသော ထေရဝါဒတို့၌။ ; ayaṃ=ဤဆိုလတ္တံ့သည်ကား။ ; anupubbikathā=တည်း။ ; hi vitthāremi=အံ့။ ; vipassanāniyamena=ဝိပဿနာဖြင့် မှတ်ခြင်းဖြင့်။ ; sukkhavipassakassa=သုခဝိပဿက ပုဂ္ဂိုလ်၏။ ; vā=အား။ ; uppannamaggopi=လည်းကောင်း။ ; samāpattilābhino=ပုဂ္ဂိုလ်၏။ ; vā=အား။ ; jhānaṃ=ကို။ ; pādakaṃ=အခြေကို။ ; akatvā=မပြုမူ၍။ ; uppannamaggopi=လည်းကောင်း။ ; paṭhamajjhānaṃ=ကို။ ; pādakaṃ=ကို။ ; katvā=၍။ ; pakiṇṇakasaṅkhāre=ပြိုးပြွမ်းသော ကာမာဝစရ သင်္ခါရတို့ကို။ ; sammasitvā=သုံးသပ်၍။ ; uppāditamaggopi=ဖြစ်စေအပ်သော မဂ်သည်လည်းကောင်း။ ; paṭhamajjhānikova=သာလျှင်။ ; hoti=၏။ ; sabbesu=အလုံးစုံကုန်သော သုက္ခဝိပဿကပုဂ္ဂိုလ်၏ မဂ်ဈာန်ကို အခြေမပြုမူ၍ ပကိဏ္ဏကသင်္ခါရကို သုံးသပ်၍ ဖြစ်သောမဂ်တို့၌။ ; satta=ကုန်သော။ ; bojjhaṅgāni=တို့သည်။ ; honti=ကုန်၏။ ; aṭṭha=ကုန်သော။ ; maggaṅgāni=တို့သည်။ ; honti=ကုန်၏။ ; pañca=ကုန်သော။ ; jhānaṅgāni=တို့သည်။ ; honti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3599 | Chunk: 60

Tesañhi pubbabhāgavipassanā somanassasahagatāpi upekkhāsahagatāpi hutvā vuṭṭhānakāle saṅkhārupekkhābhāvaṃ pattā somanassasahagatāva hoti.

AI Translation based on Nissaya

Indeed, for them, the preliminary insight—whether it was accompanied by joy or by equanimity—having reached the state of equanimity towards formations, at the time of emergence becomes accompanied only by joy.

Vietnamese AI Translation

Thật vậy, đối với họ, tuệ quán chuẩn bị—dù đi kèm với hỷ hay với xả—khi đạt đến trạng thái hành xả, vào lúc xuất khởi sẽ chỉ đi kèm với hỷ.

AI Translation Nissaya

hi saccaṃ=truly. ; tesaṃ=of those dry-insight practitioners. ; pubbabhāgavipassanā=the insight in the preliminary phase of the path. ; vā=or, the insight that precedes the impulsion-moment that is near the breakthrough. ; somanassasahagatāpi=although accompanied by joy. ; hutvā=having been. ; upekkhāsahagatāpi=and although accompanied by equanimity. ; hutvā=having been. ; vuṭṭhānakāle=at the time of emergence from the path. ; vā=or, at the time of emergence from the sign of formations and the arising of the path. ; vā=or, at the time of the insight leading to emergence. ; saṅkhārupekkhābhāvaṃ=the state of insight of equanimity towards formations. ; pattā=having reached. ; hutvā=having been. ; somanassasahagatāva=is only accompanied by joy. ; hoti=it is. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; tesaṃ=ထိုသုက္ခဝိပဿကပုဂ္ဂိုလ်တို့၏။ ; pubbabhāgavipassanā=မဂ်၏ ရှေ့အဖို့၌ ဖြစ်သော ဝိပဿနာတို့သည်။ ; vā=အနုလုံ၏ အနီးဖြစ်သော အရှေ့အဖို့၌ ဖြစ်သော ဇောဝါရမှ ရှေ့ဖြစ်သော ဝိပဿနာတို့သည်။ ; somanassasahagatāpi=သောမနဿနှင့် တကွဖြစ်ကုန်သည်လည်း။ ; hutvā=၍။ ; upekkhāsahagatāpi=ကုန်သည်လည်း။ ; hutvā=၍။ ; vuṭṭhānakāle=မဂ်မှ ထသော အခါ၌။ ; vā=သင်္ခါရနိမိတ်မှ ထ၍ မဂ်ဥပါဒ်သော အခါ၌။ ; vā=ဝုဋ္ဌာနဂါမိနီဝိပဿနာဖြစ်သော အခါ၌။ ; saṅkhārupekkhābhāvaṃ=သင်္ခါရုပေက္ခာဝိပဿနာ၏ အဖြစ်သို့။ ; pattā=ကုန်သည်။ ; hutvā=ကုန်၍။ ; somanassasahagatāva=သာလျှင်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3600 | Chunk: 60

Pañcakanaye dutiyatatiyacatutthajjhānāni pādakāni katvā uppāditamaggesu yathākkameneva jhānaṃ caturaṅgikaṃ tivaṅgikaṃ duvaṅgikañca hoti, sabbesu pana satta maggaṅgāni honti, catutthe cha bojjhaṅgāni.

AI Translation based on Nissaya

In the five-fold system, in the paths produced by making the second, third, and fourth jhānas their respective bases, the jhāna has four, three, and two factors respectively. In all of them, however, there are seven path factors, and in the fourth, there are six enlightenment factors.

Vietnamese AI Translation

Trong hệ thống năm thiền, trong các đạo được tạo ra bằng cách lấy thiền thứ hai, thứ ba và thứ tư làm cơ sở tương ứng, thiền có lần lượt bốn, ba và hai chi. Tuy nhiên, trong tất cả chúng, có bảy đạo chi, và trong thiền thứ tư, có sáu giác chi.

AI Translation Nissaya

pañcakaniye=in the five-fold system. ; dutiya tatiya catutthajjhānāni=the second, third, and fourth jhānas. ; pādakāni=as bases. ; katvā=having made. ; uppāditamaggesu=in the paths that have been produced. ; yathākkameneva=only in sequential order. ; jhānaṃ=the jhāna. ; caturaṅgitaṃ=has four factors. ; hoti=it is. ; duvaṅgikaṃ=and has two factors. ; hoti=it is. ; duvaṅgikañca=and has two factors. ; hoti=it is. ; pana=and as for the incompleteness. ; sabbesu=in all minds having four, three, or two jhāna factors. ; satta=seven. ; maggaṅgāni=path factors. ; honti=there are. ; catutthe=in the path associated with the fourth jhāna. ; cha=six. ; bojjhaṅgāni=enlightenment factors. ; honti=there are. ;

Myanmar Nissaya

pañcakaniye=၌။ ; dutiya tatiya catutthajjhānāni=တို့ကို။ ; pādakāni=အခြေတို့ကို။ ; katvā=၍။ ; uppāditamaggesu=ဖြစ်စေအပ်သော မဂ်တို့၌။ ; yathākkameneva=အစဉ်အားလျော်သဖြင့် သာလျှင်။ ; jhānaṃ=သည်။ ; caturaṅgitaṃ=လေးပါးသော အင်္ဂါရှိသည်။ ; hoti=၏။ ; duvaṅgikaṃ=သည်လည်း။ ; hoti=၏။ ; duvaṅgikañca=သည်လည်း။ ; hoti=၏။ ; pana=မပြည့်စုံသည်ကိိုဆိုအံ့။ ; sabbesu=ဥဿုံကုန်သော လေးပါးသော ဈာန်သုံးပါးသော ဈာန် နှစ်ပါးသော ဈာန်ရှိသော စိတ်တို့၌။ ; satta=ကုန်သော။ ; maggaṅgāni=တို့သည်။ ; honti=ကုန်၏။ ; catutthe=စတုတ္ထဈာန်ရှိသော မဂ်၌။ ; cha=ကုန်သော။ ; bojjhaṅgāni=တို့သည်။ ; honti=ကုန်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3601 | Chunk: 60

Ayaṃ viseso pādakajjhānaniyamena ceva vipassanāniyamena ca hoti.

AI Translation based on Nissaya

This distinction occurs both by the determination of the foundation jhāna and by the determination of insight.

Vietnamese AI Translation

Sự phân biệt này xảy ra cả bởi sự quyết định của thiền nền tảng và bởi sự quyết định của tuệ quán.

AI Translation Nissaya

ayaṃ viseso=this aforesaid distinction. ; pādakajjhānaniyamenaceva=by the determination of the foundation jhāna. ; vipassanāniyamenaca=and by the determination of insight. ; hoti=occurs. ;

Myanmar Nissaya

ayaṃ viseso=ဤဆိုအပ်ပြီးသော အထူးသည်။ ; pādakajjhānaniyamenaceva=ပါဒကဈာန်ဖြင့် မုတ်ခြင်းဖြင့်လည်းကောင်း။ ; vipassanāniyamenaca=ဖြင့်လည်းကောင်း။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3602 | Chunk: 60

Tesampi [M1.181] hi pubbabhāgavipassanā somanassasahagatāpi upekkhāsahagatāpi hoti, vuṭṭhānagāminī somanassasahagatāva.

AI Translation based on Nissaya

Indeed, for them [M1.181] too, the preliminary insight is either accompanied by joy or by equanimity, but the insight leading to emergence is only accompanied by joy.

Vietnamese AI Translation

Thật vậy, đối với họ [M1.181] cũng vậy, tuệ quán chuẩn bị hoặc đi kèm với hỷ hoặc với xả, nhưng tuệ quán dẫn đến sự xuất khởi chỉ đi kèm với hỷ.

AI Translation Nissaya

hi saccaṃ=truly. ; tesampi=also for those paths produced based on the second, third, and fourth jhānas in the five-fold system. ; pubbabhāgavipassanā=the insight in the preliminary phase of the path. ; vā=or, the insight that precedes the insight leading to emergence. ; somanassassahagatāpi=is accompanied by joy. ; hoti=it is. ; upekkhāsahagatāpi=and is also accompanied by equanimity. ; hoti=it is. ; vuṭṭhānagāminī=the insight leading to emergence. ; somanassasahagatāva=is only accompanied by joy. ; hoti=it is. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; tesampi=ထိုပဉ္စကနည်း၌ ဒုတိယဈာန် တတိယဈာန် စတုတ္ထဈာန်ကို အခြေပြု၍ ဖြစ်စေအပ်သော မဂ်တို့၏လည်း။ ; pubbabhāgavipassanā=မဂ်၏ ရှေ့ ဖို့၌ဖြစ်သော ဝိပဿနာသည်။ ; vā=ဝုဋ္ဌာနဂါမီနီဝိပဿနာ၏ ရှေ့အဖို့၌ဖြစ်သော ဝိပဿနာသည်။ ; somanassassahagatāpi=သောမနဿဝေဒနာနှင့် တကွဖြစ်သည်လည်း။ ; hoti=၏။ ; upekkhāsahagatāpi=သည်လည်း။ ; hoti=၏။ ; vuṭṭhānagāminī=ဝုဋ္ဌာနဂါမိနီ ဝိပဿနာသည်။ ; somanassasahagatāva=သည်သာလျှင်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3603 | Chunk: 60

Pañcamajjhānaṃ pādakaṃ katvā nibbattitamagge pana upekkhācittekaggatāvasena dve jhānaṅgāni, bojjhaṅgamaggaṅgāni cha satta ceva.

AI Translation based on Nissaya

However, in the path generated by making the fifth jhāna the foundation, there are two jhāna factors by way of equanimity and one-pointedness; and there are six enlightenment factors and seven path factors.

Vietnamese AI Translation

Tuy nhiên, trong đạo được tạo ra bằng cách lấy thiền thứ năm làm nền tảng, có hai thiền chi là xả và nhất tâm; và có sáu giác chi và bảy đạo chi.

AI Translation Nissaya

pana=to speak of when the path is accompanied by equanimity, as opposed to joy. ; pañcamajjhānaṃ=the fifth jhāna. ; pādakaṃ=as a base. ; katvā=having made. ; nibbattitamagge=in the path that is generated. ; upekkhācittekaggatāvasena=by way of equanimity and one-pointedness of mind. ; dve jhānaṅgāni=there are two jhāna factors. ; hoti=there is. ; jojjhaṅgamaggaṅgāni=the factors of enlightenment and path factors. ; cha sattaceva=are only six and seven respectively. ; honti=they are. ; (Six, by excluding the enlightenment factor of zest; seven, by excluding the path factor of right thought.) ;

Myanmar Nissaya

pana=မဂ်သော မနဿဖြစ်သည်မှ တပါး မဂ်ဥပေက္ခာဖြစ်သည်ကို ဆိုအံ့။ ; pañcamajjhānaṃ=ကို။ ; pādakaṃ=ကို။ ; katvā=၍။ ; nibbattitamagge=ဖြစ်စေအပ်သော မဂ်၌။ ; upekkhācittekaggatāvasena=အစွမ်းဖြင့်။ ; dve jhānaṅgāni=နှစ်ပါးသော ဈာန်အင်္ဂါရှိကုန်သည်။ ; hoti=၏။ ; jojjhaṅgamaggaṅgāni=တို့သည်။ ; cha sattaceva=ခြောက်ပါး ခုနစ်ပါးတို့သည်သာလျှင်။ ; honti=ကုန်၏။ ; (ဆ, သတ္တအရ ပီတိသမ္ဗောဇ္ဈင်ကို ကြဉ်၍ ခြောက်ပါး၊ သမ္မာသင်္ကပ္ပမဂ္ဂင်ကို ကြဉ်၍ ခုနစ်ပါးယူ။) ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3604 | Chunk: 60

Ayampi viseso ubhayaniyamavasena hoti.

AI Translation based on Nissaya

This distinction also occurs by way of the twofold determination.

Vietnamese AI Translation

Sự phân biệt này cũng xảy ra bằng cách quyết định hai mặt.

AI Translation Nissaya

ayampi viseso=this distinction also. ; ubhayaniyamavasena=by way of the two determinations: of insight and of jhāna. ; hoti=occurs. ;

Myanmar Nissaya

ayampi viseso=သည်လည်း။ ; ubhayaniyamavasena=နှစ်ပါးသော ဝိပဿနာနိယမ ဈာနနိယမ၏ အစွမ်းဖြင့်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3605 | Chunk: 60

Imasmiñhi naye pubbabhāgavipassanā somanassasahagatā vā upekkhāsahagatā vā hoti, vuṭṭhānagāminī upekkhāsahagatāva hoti.

AI Translation based on Nissaya

Indeed, in this method, the preliminary insight is either accompanied by joy or by equanimity, but the insight leading to emergence is only accompanied by equanimity.

Vietnamese AI Translation

Thật vậy, trong phương pháp này, tuệ quán chuẩn bị hoặc đi kèm với hỷ hoặc với xả, nhưng tuệ quán dẫn đến sự xuất khởi chỉ đi kèm với xả.

AI Translation Nissaya

hi saccaṃ=truly. ; imasmiṃ naye=in this method. ; pubababhāgavipassanā=the insight in the preliminary phase of the path. ; vā=or, the insight that precedes the insight leading to emergence. ; somanassasahagatāvā=is accompanied by joy. ; hoti=it is. ; upekkhāsahagatāvā=or is accompanied by equanimity. ; hoti=it is. ; vuṭṭhānagāminī=the insight leading to emergence. ; upekkhāsahagatāva=is only accompanied by equanimity. ; hoti=it is. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; imasmiṃ naye=၌။ ; pubababhāgavipassanā=မဂ်၏ ရှေ့အဖို့၌ ဖြစ်သော ဝိပဿနာသည်။ ; vā=ဝုဋ္ဌာနဂါမိနီဝိပဿနာ၏ ရှေ့အဖို့၌ဖြစ်သော ဝိပဿနာသည်။ ; somanassasahagatāvā=သည်လည်း။ ; hoti=၏။ ; upekkhāsahagatāvā=သည်လည်း။ ; hoti=၏။ ; vuṭṭhānagāminī=ဝုဋ္ဌာနဂါမိနီဝိပဿနာသည်။ ; upekkhāsahagatāva=တကွဖြစ်သည် သာလျှင်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3606 | Chunk: 60

Arūpajjhānāni [P1.195] pādakāni katvā uppāditamaggepi eseva nayo.

AI Translation based on Nissaya

Even in a path produced by making the formless jhānas [P1.195] the foundation, this same principle should be understood.

Vietnamese AI Translation

Ngay cả trong một đạo được tạo ra bằng cách lấy các thiền vô sắc [P1.195] làm nền tảng, nguyên tắc tương tự này cũng cần được hiểu.

AI Translation Nissaya

arūpajjhānāni=the formless jhānas. ; pādakāni=as foundations. ; katvā=having made. ; uppāditamaggepi=also in the path that is produced. ; eseva eso iva=just like this method stated for the fifth jhāna. ; nayo=the principle. ; veditabbo=should be understood. ;

Myanmar Nissaya

arūpajjhānāni=တို့ကို။ ; pādakāni=တို့ကို။ ; katvā=၍။ ; uppāditamaggepi=၌လည်း။ ; eseva eso iva=ဤပဉ္စမဈာန်၌ ဆိုအပ်ပြီးသော နည်းကဲ့သို့သော။ ; nayo=နည်းကို။ ; veditabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3607 | Chunk: 60

Idha pana catukkanaye avitakkavicāramattassa dutiyajjhānassa abhāvā taṃ apanetvā sesānaṃ vasena yojetabbaṃ.

AI Translation based on Nissaya

Here, however, in the four-fold system, since there is no second jhāna that is merely without applied thought but with sustained thought, one should apply this by removing that [jhāna from the five-fold analysis] and considering it by way of the remaining jhānas.

Vietnamese AI Translation

Tuy nhiên, ở đây, trong hệ thống bốn thiền, vì không có thiền thứ hai chỉ đơn thuần không có tầm nhưng có tứ, nên người ta nên áp dụng điều này bằng cách loại bỏ [thiền đó khỏi phân tích năm thiền] và xem xét nó theo phương diện của các thiền còn lại.

AI Translation Nissaya

pana=to speak of the method to be applied in the four-fold jhāna system. ; idha=here, in the matter of determination by foundation jhāna. ; avitakkavicāramattassa=of that which is merely without applied thought but with sustained thought. ; dutiyajjhānassa=of the second jhāna which appears in the five-fold system. ; catukkanaye=in the four-fold system. ; abhāvā=due to the absence. ; taṃ=that second jhāna which appears in the five-fold system. ; apanetvā=having removed. ; sesānaṃ=of the remaining four jhānas. ; vasena=by way of. ; yojetabbaṃ=it should be applied. ;

Myanmar Nissaya

pana=စတုက္ကဈာန်၌ ယှဉ်ရသော နည်းကိုဆိုအံ့။ ; idha=ဤပါဒကဇ္ဈာနနိယမ၏ အရာ၌။ ; avitakkavicāramattassa=ဝိတက်ကားမရှိ ဝိစာရမျှသာရှိသော။ ; dutiyajjhānassa=ပဉ္စကနည်း၌လာ်သော ဒုတိယဈာန်၏။ ; catukkanaye=၌။ ; abhāvā=ကြောင့်။ ; taṃ=ထို ပဉ္စကနည်း၌လာသော ဒုတိယဈာန်ကို။ ; apanetvā=ပယ်၍။ ; sesānaṃ=ကြွင်းသော လေးပါးသော ဈာန်တို့၏။ ; vasena=ဖြင့်။ ; yojetabbaṃ=ယှဉ်အပ်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3608 | Chunk: 60

Evaṃ pādakajjhānato vuṭṭhāya ye keci saṅkhāre sammasitvā nibbattitamaggassa āsannapadese vuṭṭhitasamāpatti attanā sadisabhāvaṃ karoti bhūmivaṇṇo viya godhāvaṇṇassa.

AI Translation based on Nissaya

Thus, the attainment from which one has emerged in the vicinity of the produced path—a path produced by contemplating any formations after emerging from a foundation jhāna—makes that path similar to itself, just as the color of the earth makes the color of a lizard similar to it.

Vietnamese AI Translation

Như vậy, chứng đắc mà từ đó người ta đã xuất ra ở gần đạo được sinh khởi—một đạo được sinh khởi bằng cách quán chiếu bất kỳ hành nào sau khi xuất khỏi một thiền nền tảng—làm cho đạo đó trở nên tương tự như chính nó, cũng giống như màu sắc của đất làm cho màu sắc của một con thằn lằn trở nên tương tự như nó.

AI Translation Nissaya

evaṃ=in this way just stated. ; pādakajjhānato=from any foundation jhāna. ; vuṭṭhāya=having emerged. ; yekeci=any. ; saṅkhāre=formations, whether with or without the foundation jhāna. ; sammasitvā=having contemplated by way of impermanence, etc. ; nibbattitamaggassa=of the produced path. ; āsannapadese=in the near vicinity. ; vuṭṭhitasamapatti=the attainment from which one has emerged. ; attānā=with itself. ; sadisabhāvaṃ=the state of being similar. ; karoti=makes. ; kimiva=just as. ; bhūmivaṇṇo=the color of the earth. ; godhāvaṇṇassa=for the color of a lizard. ; sadisabhāvaṃ=a state of similarity. ; karoti vīya=as if it makes. ;

Myanmar Nissaya

evaṃ=ဤသို့ ဆိုအပ်ပြီးသော နည်းဖြင့။ ; pādakajjhānato=အမှတ်မရှိသော ပါဒကဈာန်မှ။ ; vuṭṭhāya=၍။ ; yekeci=ကုန်သော။ ; saṅkhāre=ပါဒကဈာန်ရှိသော သင်္ခါရ ပါဒက ဈာန်မရှိသော သင်္ခါရတို့ကို။ ; sammasitvā=အနိစ္စ အစရှိသော အားဖြင့် သုံးသပ်၍။ ; nibbattitamaggassa=ဖြစ်စေအပ်သော မဂ်၏။ ; āsannapadese=အနီးဖြစ်သော အရပ်၌။ ; vuṭṭhitasamapatti=ထသော သမာပတ်သည်။ ; attānā=မိမိနှင့်။ ; sadisabhāvaṃ=တူသည်၏ အဖြစ်ကို။ ; karoti=၏။ ; kimiva=ကား။ ; bhūmivaṇṇo=မြေအဆင်းသည်။ ; godhāvaṇṇassa=ဖွတ်အဆင်းအား။ ; sadisabhāvaṃ=ကို။ ; karoti vīya=ကဲ့သို့တည်း။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3609 | Chunk: 60

Dutiyattheravāde pana yato yato samāpattito vuṭṭhāya ye ye samāpattidhamme sammasitvā maggo nibbattito hoti, taṃtaṃsamāpattisadisova hoti.

AI Translation based on Nissaya

However, in the second Elder's view, from whichever attainment one emerges and contemplates its states, the path produced is similar to that very attainment.

Vietnamese AI Translation

Tuy nhiên, theo quan điểm của vị Trưởng lão thứ hai, từ bất kỳ chứng đắc nào mà người ta xuất ra và quán chiếu các trạng thái của nó, thì đạo được sinh khởi sẽ tương tự như chính chứng đắc đó.

AI Translation Nissaya

pana=to speak of the attainment-jhāna. ; dutiyattheravāde=in the second Elder's view. ; yato yato samāpattato=from whichever attainment. ; vuṭṭhāya=having emerged. ; ye ye samāpattidhamme=whichever attainment-states. ; sammasitvā=having contemplated as impermanent, etc. ; maggo=the path. ; nibbattito=is produced. ; hoti=is. ; taṃ taṃ samāpattisadisova=that path is only similar to that very attainment which was contemplated. ; hoti=it is. ;

Myanmar Nissaya

pana=သမာပတ္တိဈာန်ကိုဆိုအံ့။ ; dutiyattheravāde=၌။ ; yato yato samāpattato=မှ။ ; vuṭṭhāya=၍။ ; ye ye samāpattidhamme=အကြင် အကြင်သမာပတ်တရားတို့ကို။ ; sammasitvā=အနိစ္စ အစရှိသည်ဖြင့် သုံးသပ်၍။ ; maggo=ကို။ ; nibbattito=ဖြစ်စေအပ်သည်။ ; hoti=၏။ ; taṃ taṃ samāpattisadisova=ထိုထိုသုံးသပ်အပ်သော သမာပတ်နှင့်တူသော မဂ်သည်သာလျှင်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3610 | Chunk: 60

Tatrāpi ca vipassanāniyamo vuttanayeneva veditabbo.

AI Translation based on Nissaya

And there too, the determination by insight should be understood according to the method already stated.

Vietnamese AI Translation

Và ở đó cũng vậy, sự quyết định bởi tuệ quán cần được hiểu theo phương pháp đã nêu.

AI Translation Nissaya

tatrāpica=also in that second Elder's view. ; vipassanāniyamo=the determination by insight. ; vuttanayeneva=only by the method already stated. ; veditabbo=should be understood. ;

Myanmar Nissaya

tatrāpica=ထိုဒုတိယ ထေရဝါဒါ၌လည်း။ ; vipassanāniyamo=ဝိပဿနာဖြင့် မှတ်ခြင်းကို။ ; vuttanayeneva=ဖြင့်သာလျှင်။ ; veditabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3611 | Chunk: 60

Tatiyattheravāde attano ajjhāsayānurūpena yaṃ yaṃ jhānaṃ pādakaṃ katvā ye ye jhānadhamme sammasitvā maggo nibbattito, taṃtaṃjhānasadisova hoti.

AI Translation based on Nissaya

In the third Elder's view, in accordance with one's own inclination, whichever jhāna is made the foundation and whichever jhāna-states are contemplated, the path produced is similar to that very jhāna.

Vietnamese AI Translation

Theo quan điểm của vị Trưởng lão thứ ba, tùy theo khuynh hướng của chính mình, bất kể thiền nào được lấy làm nền tảng và bất kể trạng thái-thiền nào được quán chiếu, thì đạo được sinh khởi sẽ tương tự như chính thiền đó.

AI Translation Nissaya

tatiyattheravāde=in the third Elder's view. ; attano=one's own. ; ajjhāsayānurūpena=in accordance with one's inclination. ; yaṃ yaṃ jhānaṃ=whichever jhāna. ; pādakaṃ=as a foundation. ; katvā=having made. ; ye ye jhānadhamme=whichever jhāna-states. ; sammasitvā=having contemplated. ; maggo=the path. ; nibbattato=is produced. ; taṃtaṃ jhānasadisova=that path is only similar to that desired foundation jhāna and contemplated jhāna. ; hoti=it is. ;

Myanmar Nissaya

tatiyattheravāde=၌။ ; attano=မိမိ၏။ ; ajjhāsayānurūpena=အလိုအားလျော်သဖြင့်။ ; yaṃ yaṃ jhānaṃ=ကို။ ; pādakaṃ=ကို။ ; katvā=၍။ ; ye ye jhānadhamme=တို့ကို။ ; sammasitvā=၍။ ; maggo=ကို။ ; nibbattato=ဖြစ်စေအပ်၏။ ; taṃtaṃ jhānasadisova=ထိုထို အလိုရှိအပ်သော ပါဒကဈာန် သမ္မသိတဈာန်နှင့် တူသော မဂ်သည်သာလျှင်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3612 | Chunk: 60

Pādakajjhānaṃ pana sammasitajjhānaṃ vā vinā ajjhāsayamatteneva taṃ na ijjhati.

AI Translation based on Nissaya

However, without the foundation jhāna or the contemplated jhāna, this cannot be accomplished by mere inclination alone.

Vietnamese AI Translation

Tuy nhiên, nếu không có thiền nền tảng hoặc thiền được quán chiếu, điều này không thể được thực hiện chỉ bằng khuynh hướng đơn thuần.

AI Translation Nissaya

pana=to state a distinction. ; pādakajjhānaṃ=the foundation jhāna. ; sammasitajjhānaṃ vā=or the contemplated jhāna. ; vinā=without. ; ajjhāsayamatteneva=merely by inclination alone. ; taṃ=that becoming similar to the jhāna. ; naijjhati=is not accomplished. ;

Myanmar Nissaya

pana=အထူးကိုဆိုအံ့။ ; pādakajjhānaṃ=ကိုလည်းကောင်း။ ; sammasitajjhānaṃ vā=ကိုလည်းကောင်း။ ; vinā=ကြဉ်၍။ ; ajjhāsayamatteneva=အလိုရှိကာမျှဖြစ်သည်သာလျှင်။ ; taṃ=ထိုဈာန်နှင့်တူစွာ ဖြစ်ခြင်းသည်။ ; naijjhati=မပြည့်စုံ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3613 | Chunk: 60

Etthāpi ca vipassanāniyamo vuttanayeneva veditabbo.

AI Translation based on Nissaya

Here too, the determination by insight should be understood according to the method already stated.

Vietnamese AI Translation

Ở đây cũng vậy, sự quyết định bởi tuệ quán cần được hiểu theo phương pháp đã nêu.

AI Translation Nissaya

etthāpi ca=and also in this third Elder's view. ; vipassanāniyamo=the determination by insight. ; vuttanayeneva=only by the method already stated. ; veditabbo=should be understood. ;

Myanmar Nissaya

etthāpi ca=ဤတတိယ ထေရဝါဒ၌လည်း။ ; vipassanāniyamo=ကို။ ; vuttanayeneva=လျှင်။ ; veditabbo=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3614 | Chunk: 60

Ayaṃ vuccati sammāsamādhīti yā imesu catūsu jhānesu ekaggatā, ayaṃ pubbabhāge lokiyo, aparabhāge lokuttaro sammāsamādhi nāma vuccati.

AI Translation based on Nissaya

This is called right concentration: It should be understood that whatever one-pointedness exists in these four jhānas, this is called right concentration; in the preliminary phase it is mundane, and in the subsequent phase it is supramundane.

Vietnamese AI Translation

**Đây được gọi là chánh định**: Cần phải hiểu rằng bất cứ sự nhất tâm nào tồn tại trong bốn thiền này, đây được gọi là chánh định; trong giai đoạn chuẩn bị, nó là thế gian, và trong giai đoạn tiếp theo, nó là siêu thế.

AI Translation Nissaya

ayaṃ vuccati sammāsamādhīti=as for 'this is called right concentration'. ; catūsu=four. ; imesu jhānesu=in these jhānas. ; yaṃ ekaggatā=whatever one-pointedness. ; atthi=there is. ; ayaṃ=this concentration. ; pubbabhāge=in the preliminary phase of the path. ; lokiyo=is mundane. ; sammāsamādhināma=called right concentration. ; vuccati=is said to be. ; aparebhāge=in the subsequent phase of the path. ; lokuttaro=is supramundane. ; sammāsamādhināma=called right concentration. ; vuccati=is said to be. ; iti=thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

ayaṃ vuccati sammāsamādhīti=ကား။ ; catūsu=ကုန်သော။ ; imesu jhānesu=တို့၌။ ; yaṃ ekaggatā=အကြင်သမာဓိသည်။ ; atthi=၏။ ; ayaṃ=ဤသမာဓိကို။ ; pubbabhāge=မဂ်၏ ရှေ့အဖို့၌။ ; lokiyo=ဖြစ်သော။ ; sammāsamādhināma=မည်၏ ဟူ၍။ ; vuccati=၏။ ; aparebhāge=နောက်ဖြစ်သော မဂ်၏အဖို့၌။ ; lokuttaro=ဖြစ်သော။ ; sammāsamādhināma=မည်၏ ဟူ၍။ ; vuccati=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3615 | Chunk: 60

Evaṃ lokiyalokuttaravasena dhammasenāpati [V1.166] maggasaccaṃ deseti.

AI Translation based on Nissaya

In this way, the General of the Dhamma [V1.166] teaches the truth of the path by way of the mundane and supramundane.

Vietnamese AI Translation

Theo cách này, vị Tướng quân của Chánh pháp [V1.166] giảng dạy sự thật về con đường bằng phương diện thế gian và siêu thế.

AI Translation Nissaya

evaṃ=in this way just stated. ; lokiyalokuttaravasena=by way of the mundane and supramundane. ; dhammasenāpati=the General of the Dhamma (Venerable Sāriputta). ; maggasaccaṃ=the truth of the path. ; deseti=teaches. ;

Myanmar Nissaya

evaṃ=ဤသို့ ဆိုအပ်ပြီးသောနည်းဖြင့်။ ; lokiyalokuttaravasena=ဖြင့်။ ; dhammasenāpati=အရှင်သာရိပုတ္တရာ မထေရ်သည်။ ; maggasaccaṃ=ကို။ ; deseti=ဟောတော်မူ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3616 | Chunk: 60

Tattha lokiyamagge sabbāneva maggaṅgāni yathānurūpaṃ chasu ārammaṇesu aññatarārammaṇāni honti.

AI Translation based on Nissaya

Therein, in the mundane path, all the path factors accordingly have one or another of the six types of objects as their object.

Vietnamese AI Translation

Trong đó, trong đạo thế gian, tất cả các đạo chi tương ứng có một hoặc một trong sáu loại đối tượng làm đối tượng của chúng.

AI Translation Nissaya

tattha=among those two, mundane and supramundane. ; lokiyamagge=in the mundane path. ; sabbāneva=all. ; maggaṅgāni=path factors. ; yathānurūpaṃ=accordingly. ; chasu=in the six. ; ārammaṇesu=among the objects. ; aññatararammaṇāni=have one or another as their object. ; honti=they are. ;

Myanmar Nissaya

tattha=ထိုလောကုတ္တရာနှစ်ပါးတို့တွင်။ ; lokiyamagge=လောကီဖြစ်သော မဂ္ဂသစ္စာ၌။ ; sabbāneva=ကုန်သော။ ; maggaṅgāni=တို့သည်။ ; yathānurūpaṃ=လျော်စွာ။ ; (လောကုတ္တရာအာရုံကိုနစ်စေ။) ; chasu=ကုန်သော။ ; ārammaṇesu=တို့တွင်။ ; aññatararammaṇāni=ရှိကုန်သည်။ ; honti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3617 | Chunk: 60

Lokuttaramagge pana catusaccappaṭivedhāya pavattassa ariyasāvakassa nibbānārammaṇaṃ avijjānusayasamugghātakaṃ paññācakkhu sammādiṭṭhi, tathā sampannadiṭṭhissa taṃsampayutto tividhamicchāsaṅkappasamugghātako cetaso nibbānapadābhiniropano sammāsaṅkappo, tathā passantassa vitakkentassa ca taṃsampayuttāva catubbidhavacīduccaritasamugghātikā micchāvācāya virati sammāvācā, tathā viramantassa taṃsampayuttāva tividhamicchākammantasamucchedikā micchākammantā virati [M1.182] sammākammanto, tesaṃyeva cassa vācākammantānaṃ vodānabhūtā taṃsampayuttāva kuhanādisamucchedikā micchāājīvā virati sammāājīvo, tassāyevassa sammāvācākammantājīvasaṅkhātāya sīlabhūmiyaṃ patiṭṭhamānassa tadanurūpo taṃsampayuttova kosajjasamucchedako, anuppannuppannānaṃ akusalakusalānaṃ [P1.196] anuppādappahānuppādaṭṭhitisādhako ca vīriyārambho sammāvāyāmo, evaṃ vāyamantassa taṃsampayuttova micchāsativiniddhunako, kāyādīsu kāyānupassanādisādhako ca cetaso asammoso sammāsati.

AI Translation based on Nissaya

Now, in the supramundane path, for the noble disciple practicing for the penetration of the Four Truths, the eye of wisdom which has Nibbāna as its object and which completely uproots the underlying tendency of ignorance is Right View. For one endowed with such a view, the factor associated with it that completely destroys the three kinds of wrong intention and directs the mind towards the state of Nibbāna is Right Intention. For one who is thus seeing and intending, the abstinence from wrong speech—which is associated with them and completely uproots the four kinds of verbal misconduct—is Right Speech. For one thus abstaining, the abstinence from wrong action—which is associated with Right Speech and completely severs the three kinds of wrong action—is Right Action [M1.182]. And the abstinence from wrong livelihood—which is the purification of that very speech and action, is associated with them, and severs hypocrisy and so on—is Right Livelihood. For that noble disciple established in this very ground of virtue, known as Right Speech, Action, and Livelihood, the exertion of energy suitable to and associated with these, which severs laziness and accomplishes the non-arising of unarisen unwholesome states and the abandoning of arisen ones, as well as the arising of unarisen wholesome states and the maintenance of arisen ones [P1.196], is Right Effort. For one striving thus, the non-forgetfulness of mind associated with it, which dispels wrong mindfulness and accomplishes the contemplation of the body in the body and so on, is Right Mindfulness.

Vietnamese AI Translation

Bây giờ, trong đạo siêu thế, đối với vị Thánh đệ tử đang thực hành để thâm nhập Tứ Diệu Đế, tuệ nhãn có Niết-bàn làm đối tượng và nhổ tận gốc tùy miên vô minh chính là Chánh Kiến. Đối với người có được cái thấy như vậy, yếu tố tương ưng với nó, hoàn toàn hủy diệt ba loại tà tư duy và hướng tâm đến trạng thái Niết-bàn, chính là Chánh Tư Duy. Đối với người đang thấy và tư duy như vậy, sự kiêng cữ tà ngữ—vốn tương ưng với chúng và nhổ tận gốc bốn loại ác hạnh về lời nói—chính là Chánh Ngữ. Đối với người đang kiêng cữ như vậy, sự kiêng cữ tà nghiệp—vốn tương ưng với Chánh Ngữ và đoạn tuyệt hoàn toàn ba loại tà nghiệp—chính là Chánh Nghiệp [M1.182]. Và sự kiêng cữ tà mạng—là sự thanh lọc chính lời nói và hành động đó, tương ưng với chúng, và đoạn tuyệt sự giả dối, v.v.—chính là Chánh Mạng. Đối với vị Thánh đệ tử đó đã an trú trong chính nền tảng giới đức này, được biết đến là Chánh Ngữ, Chánh Nghiệp, và Chánh Mạng, sự nỗ lực tinh tấn phù hợp và tương ưng với những điều này, vốn đoạn trừ sự lười biếng và thành tựu việc không cho các pháp bất thiện chưa sinh khởi được sinh khởi và việc từ bỏ các pháp đã sinh khởi, cũng như việc làm sinh khởi các pháp thiện chưa sinh khởi và duy trì các pháp đã sinh khởi [P1.196], chính là Chánh Tinh Tấn. Đối với người đang nỗ lực như vậy, sự không quên của tâm tương ưng với nó, vốn xua tan tà niệm và thành tựu việc quán thân trên thân, v.v., chính là Chánh Niệm.

AI Translation Nissaya

pana=Now, as for the supramundane Path-truth. ; lokuttaramagge=in the supramundane path. ; catusaccappaṭivedhāya=for the sake of the penetration of the Four Truths. ; pavattassa=of one who is practicing. ; ariyasāvakassa=of the noble disciple. ; nibbānārammaṇaṃ=which has Nibbāna as its object. ; avijjānusayasamugghātakaṃ=which completely uproots the underlying tendency of ignorance. ; paññā cakkhu=the eye of wisdom. ; sammādiṭṭhi=is called the path factor of Right View. ; tathā=in that way. ; sammādiṭṭhissa=of the noble disciple endowed with the path factor of Right View. ; taṃsampayutto=associated with that path factor of Right View. ; tividhamicchā saṅkappasamugghātako=which completely destroys the three kinds of wrong intention. ; cetaso=the mind. ; nibbānapadābhiniropano=the state that directs towards the state of Nibbāna. ; sammāsaṅkappo=is called the path factor of Right Intention. ; tathā=in that way. ; passantassa=of the person who is both seeing with the eye of wisdom. ; vibhattentassaca=and also intending with Right Intention. ; taṃ sampayuttāva=which is also associated with that Right View and Right Intention. ; catubbidhavacīduccaritasamugghātikā=which completely uproots the four kinds of verbal misconduct. ; micchāvācāya=from. ; virati=the abstinence. ; sammāvācā=is called the path factor of Right Speech. ; tathā=thus. ; viramantassa=of the person who abstains from wrong speech. ; taṃsampayuttāva=which is associated only with that Right Speech. ; tividhamicchākammantasamucchedikā=which completely severs the three kinds of wrong action. ; micchākammantā=from. ; virati=the abstinence. ; sammākammanto=is called Right Action. ; ca=furthermore. ; tesaṃyeva=of only those four kinds of verbal misconduct and three kinds of wrong action. ; assa=of that noble disciple. ; vācākammantānaṃ=of Right Speech and Right Action. ; vodānabhūtā=which has become pure. ; taṃsampayuttāva=which is associated only with that Right Speech and Right Action. ; kuhanādisamucchedikā=which completely severs hypocrisy and so on. ; micchādijīvā=from wrong livelihood. ; virati=the abstinence. ; sammāājīvo=is called the path factor of Right Livelihood. ; sammāvācā kammantājīvasaṅkhātāya=called Right Speech, Right Action, and Right Livelihood. ; tassāyeva sīlabhūmiyaṃ=only in that ground of virtue. ; patiṭṭhāmānassa=of one who is established. ; assa=of that noble disciple. ; tadanurūpo=suitable for those three abstinences. ; taṃsampayuttova=which is associated only with those three abstinences. ; kosajjasamucchedako=which completely severs laziness. ; anuppannuppannāṃ=of the unarisen and the arisen. ; akusala kusalānaṃ=unwholesome and wholesome states. ; anuppādappahānuppādaṭṭhiti sādhakoca=and which accomplishes the non-arising, abandoning, arising, and maintenance. ; vīriyārambho=the exertion of energy. ; sammāvāyāmo=is Right Effort. ; (It is connected as: accomplishing the non-arising of unarisen unwholesome states, accomplishing the abandoning of arisen unwholesome states, accomplishing the arising of unarisen wholesome states, accomplishing the maintenance of arisen wholesome states.) ; evaṃ=in the way thus described. ; vāyamantassa=of the person who strives. ; taṃ sampayuttova=which is associated only with that path factor of Right Effort. ; micchāsativiniddhunako=which dispels wrong mindfulness. ; kāyādīsu=in the body, such as the hair. ; kāyānupassanādisādhakoca=and which also accomplishes the repeated contemplation of the body and so on. ; cetaso=of the mind. ; asammoso=the non-forgetfulness. ; sammāsati=is called the path factor of Right Mindfulness. ;

Myanmar Nissaya

pana=လောကုတ္တရာ မဂ္ဂသစ္စာကိိုဆိုအံ့။ ; lokuttaramagge=၌။ ; catusaccappaṭivedhāya=ငှါ။ ; pavattassa=ကျင့်သော။ ; ariyasāvakassa=၏။ ; nibbānārammaṇaṃ=နိဗ္ဗာန်လျှင် အာရုံရှိသော။ ; avijjānusayasamugghātakaṃ=အဝိဇ္ဇာနုသယကို အကြွင်းမဲ့ နုတ်ပယ်တတ်သော။ ; paññā cakkhu=သည်။ ; sammādiṭṭhi=မဂ္ဂင်မည်၏။ ; tathā=ထိုအခြင်းအရာအားဖြင့်။ ; sammādiṭṭhissa=ပြည့်စုံသော သမ္မာဒိဋ္ဌိမဂ္ဂင်ရှိသော အရိယာသာဝက၏။ ; taṃsampayutto=ထိုသမ္မာဒိဋ္ဌိမဂ္ဂင်နှင့် ယှဉ်သော။ ; tividhamicchā saṅkappasamugghātako=သုံးပါးအပြားရှိသော မိစ္ဆာသင်္ကပ္ပကို အကြွင်းမဲ့ပယ်သတ်သော။ ; cetaso=စိတ်ကို။ ; nibbānapadābhiniropano=နိဗ္ဗာန်တည်းဟူသော အာရုံသို့ ရှေ့ရှုတတ်တတ်သော တရားသည်။ ; sammāsaṅkappo=မဂ္ဂင်မည်၏။ ; tathā=ထိုအခြင်းအရာအားဖြင့်။ ; passantassa=ပညာ စက္ခုဖြင့် ရှုသည်လည်းဖြစ်သော။ ; vibhattentassaca=သမ္မာသင်္ကပ္ပဖြင့် ကြံသည်လည်းဖြစ်သော ပုဂ္ဂိုလ်၏။ ; taṃ sampayuttāva=ထိုသမ္မာဒိဋ္ဌိ သမ္မာသင်္ကပ္ပနှင့် ယှဉ်သည်လည်းဖြစ်သော။ ; catubbidhavacīduccaritasamugghātikā=လေးပါးအပြားရှိသော ဝစီဒုစရိုက်ကို အကြွင်းမဲ့ နုတ်တတ်သော။ ; micchāvācāya=မှ။ ; virati=ကြဉ်ခြင်းသည်။ ; sammāvācā=မဂ္ဂင်မည်၏။ ; tathā=ဖြင့်။ ; viramantassa=မိစ္ဆာဝါစာမှ ကြဉ်သော ပုဂ္ဂိုလ်၏။ ; taṃsampayuttāva=ထိုသမ္မာဝါစာနှင့် ယှဉ်သည်သာလျှင်ဖြစ်သော။ ; tividhamicchākammantasamucchedikā=သုံးပါးအပြားရှိသော မိစ္ဆာကမ္မန္တကို အကြွင်းမဲ့ဖြတ်တတ်သော။ ; micchākammantā=မှ။ ; virati=ကြဉ်ခြင်းသည်။ ; sammākammanto=မည်၏။ ; ca=ဆက်၍ ဆိုဦးအံ့။ ; tesaṃyeva=ထိုလေးပါးသော ဝစီဒုစရိုက် သုံးပါးသော မိစ္ဆာကမ္မန္တတို့၏သာလျှင်။ ; assa=ထိုအရိယာသာဝက၏။ ; vācākammantānaṃ=သမ္မာဝါစာ သမ္မာကမ္မန္တတို့၏။ ; vodānabhūtā=ဖြူစင်သည်ဖြစ်၍ ဖြစ်သော။ ; taṃsampayuttāva=ထိုသမ္မာဝါစာ သမ္မာကမ္မန္တနှင့်ယှဉ်သည်သာလျှင်ဖြစ်သော။ ; kuhanādisamucchedikā=ကုဟနအစရှိသည်ကို အကြွင်းမဲ့ဖြတ်တတ်သော။ ; micchādijīvā=မိစ္ဆာအာဇီဝမှ။ ; virati=ကြဉ်ခြင်းသည်။ ; sammāājīvo=သမ္မာအာဇီဝမဂ္ဂင်မည်၏။ ; sammāvācā kammantājīvasaṅkhātāya=သမ္မာဝါစာ သမ္မာကမ္မန္တ သမ္မာအာဇီဝ ဟုဆိုအပ်သော။ ; tassāyeva sīlabhūmiyaṃ=ထိုသီလတည်းဟူသော မြေ၌သာလျှင်။ ; patiṭṭhāmānassa=တည်သော။ ; assa=ထိုအရိယာ သာဝက၏။ ; tadanurūpo=ထိုသုံးပါးသော ဝိရတီအားလျော်စွ။ ; taṃsampayuttova=ထိုသုံးပါးသော ဝိရတီနှင့်ယှဉ်သည်သာလျှင်ဖြစ်သော။ ; kosajjasamucchedako=ပျင်းရိခြင်းကို အကြွင်းမဲ့ဖြတ်တတ်သော။ ; anuppannuppannāṃ=မဖြစ်ကုန်သေး ဖြစ်ကုန်ပြီးသော။ ; akusala kusalānaṃ=တို့ကို။ ; anuppādappahānuppādaṭṭhiti sādhakoca=မဖြစ်စေခြင်း ပယ်ခြင်း ဖြစ်စေခြင်း တည်ခြင်းကို ပြီးစေသည်လည်းဖြစ်သော။ ; vīriyārambho=ဝီရိယကို အားထုတ်ခြင်းသည်။ ; sammāvāyāmo=သည်။ ; (အနုပ္ပန္နာံ အကုသလာနံ အနုပ္ပါဒ၊ ဥပ္ပန္နာနံ အကုသလာနံ ပဟာနံ သာဓကော၊ အနုပ္ပန္နာနံ ကုသလာနံ ဥပ္ပါဒသာဓကော၊ ဥပ္ပန္နာနံ ကုသလာနံ ဌိတိသာဓကော ဤသို့ စပ်၍ယူ။) ; evaṃ=ဤသို့ ဆိုအပ်ပြီးသော နည်းဖြင့်။ ; vāyamantassa=လုံ့လပြုသော ပုဂ္ဂိုလ်၏။ ; taṃ sampayuttova=ထိုသမ္မာဝါယာမ မဂ္ဂင်နှင့်ယှဉ်သည်သာလျှင်ဖြစ်သော။ ; micchāsativiniddhunako=မိစ္ဆာသတိကို ဖျက်ဆီးတတ်သော။ ; kāyādīsu=ဆံ အစရှိသော ကာယတို့၌။ ; kāyānupassanādisādhakoca=အဖန်တလဲလဲရှုခြင်း အစရှိသည်ကို ပြီးစေတတ်သည်လည်းဖြစ်သော။ ; cetaso=စိတ်၏။ ; asammoso=မမေ့မလျော့ခြင်းသည်။ ; sammāsati=သမ္မာသတိမဂ္ဂင်မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3618 | Chunk: 61

Evaṃ anuttarāya satiyā suvihitacittārakkhassa taṃsampayuttāva micchāsamādhividdhaṃsikā cittekaggatā sammāsamādhi.

AI Translation based on Nissaya

Thus, for one whose mind is well-guarded by unsurpassed mindfulness, the one-pointedness of mind associated with it, which destroys wrong concentration, is Right Concentration.

Vietnamese AI Translation

Như vậy, đối với người có tâm được hộ trì tốt bởi chánh niệm vô song, sự nhất tâm tương ưng với nó, vốn hủy diệt tà định, chính là Chánh Định.

AI Translation Nissaya

evaṃ=In the way thus described. ; anuttarāya=unsurpassed. ; satiyā=by mindfulness. ; suvihitacittārakkhassa=of the person whose mind is well-guarded. ; taṃsampayuttāva=which is associated only with that mindfulness. ; micchāsamādhi viddhaṃsikā=which destroys wrong concentration. ; cittekaggatā=the one-pointedness of mind. ; sammāsamādhi=is called Right Concentration. ;

Myanmar Nissaya

evaṃ=ဤသို့ ဆိုအပ်ပြီးသောနည်းဖြင့်။ ; anuttarāya=လွန်ကဲသော တရားမရှိသော။ ; satiyā=ဖြင့်။ ; suvihitacittārakkhassa=ကောင်းစွာ စီရင်အပ်သော စိတ်ကိုစောင့်ရှောက်ခြင်းရှိသော ပုဂ္ဂိုလ်၏။ ; taṃsampayuttāva=ထိုသတိနှင့် ယှဉ်သည်သာလျှင် ဖြစ်သော။ ; micchāsamādhi viddhaṃsikā=မိစ္ဆာသမာဓိကို ဖျက်ဆီးတတ်သော။ ; cittekaggatā=သည်။ ; sammāsamādhi=မည်၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3619 | Chunk: 61

Esa lokuttaro ariyo aṭṭhaṅgiko maggo.

AI Translation based on Nissaya

This is the supramundane, noble, eightfold path.

Vietnamese AI Translation

Đây là Bát Chánh Đạo siêu thế, cao quý.

AI Translation Nissaya

iti iminā ākārena=in this manner. ; pavatto=which has occurred. ; lokuttaro=supramundane. ; ariyo=noble. ; aṭṭhaṅgiko=eightfold. ; esa eso maggo=this is the path. ; hoti=is. ;

Myanmar Nissaya

iti iminā ākārena=အားဖြင့်။ ; pavatto=ဖြစ်သော။ ; lokuttaro=ဖြစ်သော။ ; ariyo=မြတ်သော။ ; aṭṭhaṅgiko=သော။ ; esa eso maggo=သည်။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3620 | Chunk: 61

Yo saha lokiyena maggena dukkhanirodhagāminipaṭipadāti saṅkhyaṃ gato, so kho panesa maggo sammādiṭṭhisaṅkappānaṃ vijjāya sesadhammānaṃ caraṇena saṅgahitattā vijjā ceva caraṇañca.

AI Translation based on Nissaya

That path which, together with the mundane path, is designated as 'the practice leading to the cessation of suffering'—that very path, because Right View and Right Intention are included in knowledge (`vijjā`) and the remaining factors in conduct (`caraṇa`), is both knowledge and conduct.

Vietnamese AI Translation

Con đường đó, cùng với con đường thế gian, được chỉ định là 'con đường thực hành đưa đến sự đoạn diệt của khổ'—chính con đường đó, bởi vì Chánh Kiến và Chánh Tư Duy được bao gồm trong minh (`vijjā`) và các yếu tố còn lại trong hạnh (`caraṇa`), nên nó vừa là minh vừa là hạnh.

AI Translation Nissaya

lokiyena=which is mundane. ; maggena=with the path. ; saha=together. ; dukkhanirodhagāmīnipaṭipadāti=as 'the path leading to the cessation of suffering'. ; saṅkhyaṃ=to the designation. ; gato=which has gone. ; yo maggo=whichever path. ; atthi=there is. ; kho pana=indeed. ; so esa eso maggo=that very path. ; sammādiṭṭhisaṅkappānaṃ=of the path factors of Right View and Right Intention. ; vā=them. ; vijjāya=by knowledge. ; saṅgahitattā=because of being included. ; (Connect this from afar.) ; sesadhammānaṃ=of the path factors remaining from Right View and Right Intention. ; vā=them. ; caraṇena=by conduct. ; saṅgahitattā=because of being included. ; vijjāceva=is also called knowledge. ; hoti=is. ; caraṇañca=and is also called conduct. ; hoti=is. ; (Take the verb 'hoti' from afar.) ;

Myanmar Nissaya

lokiyena=လောကီဖြစ်သော။ ; maggena=မဂ်နှင့်။ ; saha=တကွ။ ; dukkhanirodhagāmīnipaṭipadāti=ဟူ၍။ ; saṅkhyaṃ=ခေါ်ဝေါ်ခြင်းသို့။ ; gato=ရောက်သော။ ; yo maggo=သည်။ ; atthi=၏။ ; kho pana=စင်စစ်။ ; so esa eso maggo=ထိုမဂ်သည်။ ; sammādiṭṭhisaṅkappānaṃ=သမ္မာဒိဋ္ဌိမဂ္ဂင် သမ္မသင်္ကပ္ပမဂ္ဂင်တို့၏။ ; vā=တို့ကို။ ; vijjāya=ဖြင့။ ; saṅgahitattā=သင်္ဂြိုဟ်ရေတွက်အပ်သည်၏ အဖြစ်ကြောင့်။ ; (ဤသို့နှင်နှင့်လှမ်း၍ ချည်းယူ။) ; sesadhammānaṃ=သမ္မာဒိဋ္ဌိ သမ္မာသင်္ကပ္ပမှ ကြွင်းကုန်သော မဂ္ဂင်တရားတို့၏။ ; vā=တို့ကို။ ; caraṇena=စရဏဖြင့်။ ; saṅgahitattā=ကြောင့်။ ; vijjāceva=ဝိဇ္ဇာမည်သည်လည်း။ ; hoti=၏။ ; caraṇañca=စရဏမည်သည်လည်း။ ; hoti=၏။ ; (ဟောတိ ကြိယာကို လှမ်း၍ချည်းယူ။) ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3621 | Chunk: 61

Tathā tesaṃ dvinnaṃ vipassanāyānena itaresaṃ samathayānena saṅgahitattā samatho ceva vipassanā ca.

AI Translation based on Nissaya

Likewise, because those two are included in the vehicle of insight (`vipassanā-yāna`) and the others in the vehicle of serenity (`samatha-yāna`), it is both serenity and insight.

Vietnamese AI Translation

Tương tự như vậy, bởi vì hai yếu tố đó được bao gồm trong cỗ xe tuệ quán (`vipassanā-yāna`) và các yếu tố khác trong cỗ xe chỉ (`samatha-yāna`), nên nó vừa là chỉ vừa là quán.

AI Translation Nissaya

tathā=Furthermore. ; dvinnaṃ=of the two. ; tesaṃ=of those, Right View and Right Intention. ; vā=them. ; vipassanāyānena=by the vehicle of insight. ; saṅgahitattā=because of being included. ; itaresaṃ=of the other six path factors apart from these two. ; vā=them. ; samathayānena=by the vehicle of serenity. ; saṅgahitattā=because of being included. ; samathoceva=is also called serenity. ; hoti=is. ; vipassanāca=and is also called insight. ; hoti=is. ;

Myanmar Nissaya

tathā=ထိုမှတပါး။ ; dvinnaṃ=ကုန်သော။ ; tesaṃ=ထိုသမ္မာဒိဋ္ဌိ သမ္မာ သင်္ကပ္ပတို့၏။ ; vā=တို့ကို။ ; vipassanāyānena=ဝိပဿနာယဉ်ဖြင့်။ ; saṅgahitattā=ကြောင့်။ ; itaresaṃ=ဤနှစ်ပါးသော မဂ္ဂင်မှတပါး ခြောက်ပါးသော မဂ္ဂင်တို့၏။ ; vā=တို့ကို။ ; samathayānena=ဖြင့်။ ; saṅgahitattā=ကြောင့်။ ; samathoceva=မည်သည်လည်း။ ; hoti=၏။ ; vipassanāca=မည်သည်လည်း။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3622 | Chunk: 61

Tesaṃ dvinnaṃ paññākkhandhena tadanantarānaṃ tiṇṇaṃ sīlakkhandhena avasesānaṃ tiṇṇaṃ samādhikkhandhena adhipaññāadhisīlaadhicittasikkhāhi ca saṅgahitattā khandhattayañceva sikkhattayañca hoti.

AI Translation based on Nissaya

Because those two (Right View and Right Intention) are included in the aggregate of wisdom, the next three (Right Speech, Right Action, Right Livelihood) in the aggregate of virtue, and the remaining three (Right Effort, Right Mindfulness, Right Concentration) in the aggregate of concentration; and are also included in the trainings in higher wisdom, higher virtue, and higher mind respectively, it is both the three aggregates and the three trainings.

Vietnamese AI Translation

Bởi vì hai yếu tố đó (Chánh Kiến và Chánh Tư Duy) được bao gồm trong tuệ uẩn, ba yếu tố tiếp theo (Chánh Ngữ, Chánh Nghiệp, Chánh Mạng) trong giới uẩn, và ba yếu tố còn lại (Chánh Tinh Tấn, Chánh Niệm, Chánh Định) trong định uẩn; và cũng được bao gồm trong các học phần về tăng thượng tuệ, tăng thượng giới, và tăng thượng tâm tương ứng, nên nó vừa là ba uẩn vừa là ba học phần.

AI Translation Nissaya

dvinnaṃ=of the two. ; tesaṃ=of those, Right View and Right Intention. ; vā=them. ; paññākkhandhena=by the aggregate of wisdom. ; saṅgahitattā=because of being included. ; tadanantarānaṃ=of those that come immediately after that Right View and Right Intention. ; tiṇṇaṃ=of the three, Right Speech, Right Action, and Right Livelihood. ; vā=them. ; sīlakkhandhena=by the aggregate of virtue. ; saṅgahitattā=because of being included. ; avasesānaṃ=of the remaining ones from what has been said. ; tiṇṇaṃ=of the three, Right Effort, Right Mindfulness, and Right Concentration. ; vā=them. ; samādhikkhandhena=by the aggregate of concentration. ; saṅgahitatā=because of being included. ; khandhattayañceva=is also called the three aggregates. ; hoti=is. ; ca=furthermore. ; adhipaññā adhisīla adhicittasikkhāhi=by the trainings in higher wisdom, higher virtue, and higher mind. ; saṅgahitattā=because of being included. ; sikkhattayañca=is also called the three trainings. ; hoti=is. ;

Myanmar Nissaya

dvinnaṃ=ကုန်သော။ ; tesaṃ=ထိုသမ္မာဒိဋ္ဌိသမ္မာသင်္ကပ္ပတို့၏။ ; vā=တို့ကို။ ; paññākkhandhena=ဖြင့်။ ; saṅgahitattā=ကြောင့်။ ; tadanantarānaṃ=ထိုသမ္မာဒိဋ္ဌိ သမ္မာ သင်္ကပ္ပ၏ အခြားမဲ့၌ ဖြစ်ကုန်သော။ ; tiṇṇaṃ=ကုန်သော သမ္မာဝါစာ သမ္မာကမ္မန္တ သမ္မာအာဇီဝ တို့၏။ ; vā=တို့ကို။ ; sīlakkhandhena=ဖြင့်။ ; saṅgahitattā=ကြောင့်။ ; avasesānaṃ=ဆိုသည်ပြီးသည်မှ ကြွင်းကုန်‌သော။ ; tiṇṇaṃ=ကုန်သော သမ္မာဝါယာမ သမ္မာသတိ သမ္မာသမာဓိတို့၏။ ; vā=တို့ကို။ ; samādhikkhandhena=ဖြင့်။ ; saṅgahitatā=ကြောင့်။ ; khandhattayañceva=ခန္ဓာသုံးပါးမည်သည်လည်း။ ; hoti=၏။ ; ca=ထိုမှတပါး။ ; adhipaññā adhisīla adhicittasikkhāhi=တို့ဖြင့်။ ; saṅgahitattā=ကြောင့်။ ; sikkhattayañca=သိက္ခာသုံးပါး မည်သည်လည်း။ ; hoti=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3623 | Chunk: 61

Yena samannāgato ariyasāvako dassanasamatthehi cakkhūhi gamanasamatthehi ca pādehi samannāgato addhiko viya vijjācaraṇasampanno hutvā vipassanāyānena kāmasukhallikānuyogaṃ samathayānena attakilamathānuyoganti antadvayaṃ parivajjetvā majjhimapaṭipadaṃ paṭipanno paññākkhandhena mohakkhandhaṃ, sīlakkhandhena dosakkhandhaṃ, samādhikkhandhena ca lobhakkhandhaṃ padālento adhipaññāsikkhāya paññāsampadaṃ, adhisīlasikkhāya sīlasampadaṃ, adhicittasikkhāya samādhisampadanti tisso sampattiyo patvā amataṃ nibbānaṃ sacchikaroti.

AI Translation based on Nissaya

Endowed with this path, the noble disciple—like a traveler equipped with eyes to see and feet to walk—becomes endowed with knowledge and conduct. By means of the vehicle of insight, he avoids the extreme of indulgence in sensual pleasures, and by means of the vehicle of serenity, the extreme of self-mortification. Having thus entered the middle path, he destroys the aggregate of delusion with the aggregate of wisdom, the aggregate of aversion with the aggregate of virtue, and the aggregate of greed with the aggregate of concentration. Having thereby attained the three accomplishments—the accomplishment of wisdom through the training in higher wisdom, the accomplishment of virtue through the training in higher virtue, and the accomplishment of concentration through the training in higher mind—he realizes the deathless, Nibbāna.

Vietnamese AI Translation

Được trang bị con đường này, vị Thánh đệ tử—giống như một người du hành được trang bị mắt để thấy và chân để đi—trở nên có đủ minh và hạnh. Bằng phương tiện của cỗ xe tuệ quán, vị ấy tránh được cực đoan của việc đắm mình trong dục lạc, và bằng phương tiện của cỗ xe chỉ, tránh được cực đoan của việc tự hành khổ. Sau khi đã đi vào con đường trung đạo, vị ấy hủy diệt si uẩn bằng tuệ uẩn, sân uẩn bằng giới uẩn, và tham uẩn bằng định uẩn. Do đó, sau khi đạt được ba sự thành tựu—sự thành tựu về tuệ thông qua học phần tăng thượng tuệ, sự thành tựu về giới thông qua học phần tăng thượng giới, và sự thành tựu về định thông qua học phần tăng thượng tâm—vị ấy chứng ngộ sự bất tử, Niết-bàn.

AI Translation Nissaya

dassanasamatthehi=which are able to see. ; cakkhūhi=with eyes and. ; gamanasamatthehi=which are able to go. ; pādehica=with feet. ; samannāgato=endowed. ; addhikoviya=like a traveler. ; yena=with which eightfold path. ; samannāgato=endowed. ; ariyasāvako=the noble disciple. ; vijjācaraṇasampanno=is endowed with knowledge and conduct. ; hutvā=having become. ; vipassanāyānena=by the vehicle of insight. ; kālasukhallikānuyogaṃ=the devotion to sensual pleasures and. ; samathayānena=by the vehicle of serenity. ; attakilamathānuyogaṃ=the devotion to self-mortification. ; iti=thus. ; antadvayaṃ=the pair of two extremes. ; parivajjetvā=having avoided. ; majjhimapaṭipadaṃ=the middle path. ; paṭipanno=the person practicing. ; paññākkhandhena=by the aggregate of wisdom. ; mohakkhandhaṃ=the aggregate of delusion and. ; sīlakkhandhena=by the aggregate of virtue. ; dosakkhandhaṃ=the aggregate of aversion and. ; samādhikkhandhena=by the aggregate of concentration. ; lobhakkhandhaṃ=the aggregate of greed. ; padālento=destroys. ; hutvā=having become. ; adhipaññāsikkhāya=by the training in higher wisdom. ; paññāsampadaṃ=the accomplishment of wisdom and. ; adhisīlasikkhāya=by the training in higher virtue. ; sīlasampadaṃ=the accomplishment of virtue. ; adhicittasikkhāya=by the training in higher mind. ; samādhisampadaṃ=the accomplishment of concentration. ; iti=thus. ; tisso=the three. ; sampattiyo=accomplishments. ; patvā=having reached. ; amataṃ=called the deathless. ; nibbānaṃ=Nibbāna. ; sacchikaroti=one realizes. ;

Myanmar Nissaya

dassanasamatthehi=မြင်ခြင်းငှါ စွမ်းနိုင်ကုန်သော။ ; cakkhūhi=မျက်စိတို့နှင့် လည်းကောင်း။ ; gamanasamatthehi=သွားခြင်းငှါ စွမ်းနိုင်ကုန်သော။ ; pādehica=ခြေတို့နှင့်လည်းကေငး်။ ; samannāgato=သော။ ; addhikoviya=ခရီးသွားယောင်္ကျားကဲ့သို့။ ; yena=အကြင်မဂ္ဂင်ရှစ်ပါးနှင့်။ ; samannāgato=သော။ ; ariyasāvako=သည်။ ; vijjācaraṇasampanno=ဝိဇ္ဇာစရဏနှင့် ပြည့်စုံသည်။ ; hutvā=၍။ ; vipassanāyānena=ဖြင့်။ ; kālasukhallikānuyogaṃ=ကိုလည်းကောင်း။ ; samathayānena=ဖင့်။ ; attakilamathānuyogaṃ=ကိုလည်းကောင်း။ ; iti=သို့။ ; antadvayaṃ=အယုတ်တရားနှစ်ပါး အပေါင်းကို။ ; parivajjetvā=ကြဉ်၍။ ; majjhimapaṭipadaṃ=အလယ်အလတ်ဖြစ်သော အကျင့်ကို။ ; paṭipanno=ကျင့်သော ပုဂ္ဂိုလ်သည်။ ; paññākkhandhena=ဖြင့်။ ; mohakkhandhaṃ=မောဟအစုကိုလည်းကောင်း။ ; sīlakkhandhena=ဖြင့်။ ; dosakkhandhaṃ=ဒေါသအစုကိုလည်းကောင်း။ ; samādhikkhandhena=ဖြင့်။ ; lobhakkhandhaṃ=ကိုလည်းကောင်း။ ; padālento=ဖောက်ခွဲသည်။ ; hutvā=၍။ ; adhipaññāsikkhāya=ဖြင့်။ ; paññāsampadaṃ=ပညာ၏ ပြည့်စုံခြင်းကိုလည်းကောင်း။ ; adhisīlasikkhāya=ဖြင့်။ ; sīlasampadaṃ=ကိုလည်းကောင်း။ ; adhicittasikkhāya=ဖြင့်။ ; samādhisampadaṃ=ကိုလည်းကောင်း။ ; iti=သို့။ ; tisso=ကုန်သော။ ; sampattiyo=ပြည့်စုံခြင်းတို့ကို။ ; patvā=ရောက်၍။ ; amataṃ=အမတမည်သော။ ; nibbānaṃ=ကို။ ; sacchikaroti=မျက်မှောက်ပြုရ၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3624 | Chunk: 61

Ādimajjhapariyosānakalyāṇaṃ sattatiṃsabodhipakkhiyadhammaratanavicittaṃ sammattaniyāmasaṅkhātaṃ ariyabhūmiṃ okkanto hotīti.

AI Translation based on Nissaya

Thus, he enters the noble plane, which is good in the beginning, good in the middle, and good in the end, adorned with the jewels of the thirty-seven factors of enlightenment, and known as the certainty of rightness.

Vietnamese AI Translation

Như vậy, vị ấy bước vào cảnh giới thánh, tốt đẹp ở đoạn đầu, tốt đẹp ở đoạn giữa, và tốt đẹp ở đoạn cuối, được trang hoàng bằng những châu báu của ba mươi bảy phẩm trợ đạo, và được biết đến là sự chắc chắn của chánh đạo.

AI Translation Nissaya

ādimajjhapariyosānakalyāṇaṃ=endowed with goodness in the beginning, goodness in the middle, and goodness in the end. ; sattatiṃsabodhipakkhiya dhammaratanavicittaṃ=adorned with the jewels of the thirty-seven factors of enlightenment. ; sammattaniyāmasaṅkhātaṃ=which is called the certainty of rightness. ; ariyabhūmiṃ=into the noble plane. ; okkanto=descends. ; hoti=he is. ; iti=thus. ; veditabbaṃ=it should be known. ;

Myanmar Nissaya

ādimajjhapariyosānakalyāṇaṃ=အစ၏ ကောင်းခြင်း အလယ်၏ ကောင်းခြင်း အဆုံး၏ ကောင်းခြင်းနှင့် ပြည့်စုံသော။ ; sattatiṃsabodhipakkhiya dhammaratanavicittaṃ=သုံးဆယ်ခုနစ်ပါးသော ဗောဓိပက္ခိယတရားတည်းဟူသော ရတနာတို့ဖြင့် ဆန်းကြယ်သော။ ; sammattaniyāmasaṅkhātaṃ=သော။ ; ariyabhūmiṃ=အရိယဘုံသို့။ ; okkanto=သက်သည်။ ; hoti=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3625 | Chunk: 61

Maggasaccaniddesavaṇṇanā niṭṭhitā.

AI Translation based on Nissaya

The commentary on the exposition of the Truth of the Path is finished.

Vietnamese AI Translation

Phần sớ giải về sự trình bày Đạo Đế đã kết thúc.

AI Translation Nissaya

maggasaccaniddesa vaṇṇanā=The commentary on the exposition of the truth of the path. ; niṭṭhitā=is finished. ;

Myanmar Nissaya

maggasaccaniddesa vaṇṇanā=သည်။ ; niṭṭhitā=ပြီ။ ;

📜 Go TOC | ___Samudayasaccaniddesavaṇṇanā | Para: | ID: 3626 | Chunk: 61