📜 __2. Sīlamayañāṇaniddesavaṇṇanā

37. Sīlamayañāṇaniddese [P1.203] pañcāti gaṇanaparicchedo.

AI Translation based on Nissaya

37. In the description of knowledge based on virtue [P1.203], the word **five** is a numerical enumeration.

Vietnamese AI Translation

37. Trong phần mô tả về trí tuệ dựa trên giới [P1.203], từ **năm** là một sự liệt kê bằng số.

AI Translation Nissaya

sīlamayañāniddese=In the description of knowledge based on virtue. ; pañcāti=the word 'five'. ; gaṇanaparicchedo=is a numerical enumeration. ;

Myanmar Nissaya

sīlamayañāniddese=၌။ ; pañcāti=ကား။ ; gaṇanaparicchedo=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3700 | Chunk: 62

Sīlānīti paricchinnadhammanidassanaṃ.

AI Translation based on Nissaya

The word **virtues** indicates the things being enumerated.

Vietnamese AI Translation

Từ **giới** chỉ ra những điều đang được liệt kê.

AI Translation Nissaya

sīlānīti=the word 'virtues'. ; paricchinnadhammanidassanaṃ=is a term indicating the enumerated things. ;

Myanmar Nissaya

sīlānīti=ကား။ ; paricchinnadhammanidassanaṃ=ပိုင်းခြားအပ်သော တရားကို ညွှန်ကြောင်းဖြစ်သော သဒ္ဒါတည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3701 | Chunk: 62

Pariyantapārisuddhisīlan tiādi pañcannaṃ sarūpato dassanaṃ.

AI Translation based on Nissaya

The passage beginning **virtue of limited purity** shows the nature of the five.

Vietnamese AI Translation

Đoạn văn bắt đầu bằng **giới thanh tịnh có giới hạn** cho thấy bản chất của năm loại giới.

AI Translation Nissaya

pariyantapārisuddhisīlantiādi=The passage beginning 'virtue of limited purity'. ; pañcannaṃ=of the five kinds of virtue. ; vā=or them. ; sarūpato=in terms of their nature. ; dassanaṃ=is a term showing. ;

Myanmar Nissaya

pariyantapārisuddhisīlantiādi=ဤသို့ အစရှိသော စကားသည်။ ; pañcannaṃ=သောသီလတို၏။ ; vā=တို့ကို။ ; sarūpato=အားဖြင့်။ ; dassanaṃ=သဒ္ဒါတည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3702 | Chunk: 62

Pariyantapārisuddhītiādīsu yathā nīlavaṇṇayogato vatthampi nīlamassa atthīti nīlanti vuccati, evaṃ gaṇanavasena pariyanto paricchedo assā atthīti pariyantā, upasampannasīle patto anupasampannasīlassa avasānasabbhāvato vā pariyanto avasānaṃ assā atthīti pariyantā.

AI Translation based on Nissaya

In the phrases beginning with `pariyantapārisuddhi`, just as a cloth is called 'blue' because it has the color blue, so too, this purity is called `pariyantā` (limited) because it has a `pariyanta` (limit or boundary) by way of enumeration (e.g., five, eight, ten precepts). Or, it is `pariyantā` because for it there is a `pariyanta` (an end), since the virtue of a non-ordained person comes to an end upon reaching the virtue of an ordained person.

Vietnamese AI Translation

Trong các cụm từ bắt đầu bằng `pariyantapārisuddhi`, cũng như một tấm vải được gọi là 'màu xanh' vì nó có màu xanh, thì sự thanh tịnh này cũng được gọi là `pariyantā` (có giới hạn) vì nó có một `pariyanta` (giới hạn hoặc ranh giới) theo cách liệt kê (ví dụ: năm, tám, mười giới). Hoặc, nó là `pariyantā` bởi vì đối với nó có một `pariyanta` (sự kết thúc), vì giới của người tại gia sẽ kết thúc khi đạt đến giới của người xuất gia.

AI Translation Nissaya

pariyantipārisuddhītiādīsu=In the Pāḷi phrases beginning 'limited purity' and so on. ; (attho=the meaning. ; evaṃ=thus. ; veditabbo=should be known.) ; nīlavaṇṇayogato=due to its connection with the color blue. ; vatthampi=a cloth. ; assa=for that cloth. ; nīlaṃ=blue. ; atthi=is. ; iti iminā vacanatthena=because of this meaning. ; nīlanti=as 'blue'. ; vuccati yathā=is called, just so. ; evaṃ=similarly. ; assā pārisuddhiyā=for this purity. ; gaṇanavasena=by way of enumeration as five, eight, ten, and so on. ; pariyanto paricchedo=a limit, a boundary. ; atthi=there is. ; ititasmā=therefore. ; pariyantā=it is called 'limited'. ; vā=or. ; upasampannasīle=to the virtue of the ordained. ; vā=the virtue. ; patte=when it reaches. ; anupasampannasīlassa=of the virtue of laypeople and novices. ; avasānasabbhāvato=because of the existence of an end. ; assā pārisuddhiyā=for this purity. ; pariyanto avasānaṃ=an end. ; atthi=there is. ; iti tasmā=therefore. ; pariyantā=it is called 'limited'. ;

Myanmar Nissaya

pariyantipārisuddhītiādīsu=ဤသို့ အစရှိသော ပါဠိရပ်တို့၌။ ; (attho=ကို။ ; evaṃ=သို့။ ; veditabbo=၏။) ; nīlavaṇṇayogato=ခြင်းကြောင့်။ ; vatthampi=ကိုလည်းကောင်း။ ; assa=ထိုပုဆိုးအား။ ; nīlaṃ=သည်။ ; atthi=၏။ ; iti iminā vacanatthena=ကြောင့်။ ; nīlanti=ဟူ၍။ ; vuccati yathā=သို့။ ; evaṃ=တူ။ ; assā pārisuddhiyā=အား။ ; gaṇanavasena=ငါးပါး ရှစ်ပါး ဆယ်ပါးအစရှိသော အရေအတွက်၏ အစွမ်းဖြင့်။ ; pariyanto paricchedo=သည်။ ; atthi=၏။ ; ititasmā=ကြောင့်။ ; pariyantā=မည်၏။ ; vā=ကား။ ; upasampannasīle=ရဟန်းတို့၏ သီလသို့။ ; vā=သီလသည်။ ; patte=သော်။ ; anupasampannasīlassa=လူသာမဏေတို့၏ သီလ၏။ ; avasānasabbhāvato=ဆုံးသည်၏ အဖြစ်ကြောင့်။ ; assā pārisuddhiyā=အား။ ; pariyanto avasānaṃ=အဆုံးမည်သည်။ ; atthi=၏။ ; iti tasmā=ကြောင့်။ ; pariyantā=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3703 | Chunk: 62

Sapariyantāti vā vattabbe sakāralopo katoti veditabbo ‘‘dakaṃ dakāsayā pavisantī’’ ti ( saṃ. ni. 3.78; a. ni. 4.33) ettha ukāralopo viya.

AI Translation based on Nissaya

Alternatively, it should be understood that when `sapariyantā` should be said, the letter `sa` has been elided, just as the letter `u` is elided in the passage, “`dakaṃ dakāsayā pavisantī`” (Saṃ. Ni. 3.78; A. Ni. 4.33).

Vietnamese AI Translation

Một cách khác, cần hiểu rằng khi đáng lẽ phải nói là `sapariyantā`, thì chữ `sa` đã bị lược bỏ, giống như chữ `u` bị lược bỏ trong đoạn kinh, “`dakaṃ dakāsayā pavisantī`” (Saṃ. Ni. 3.78; A. Ni. 4.33).

AI Translation Nissaya

vā=Alternatively. ; sapariyantāti=as `sapariyantā`. ; vattabbe=when it should be said. ; sakāralopo=the elision of the letter 'sa'. ; kato=is done. ; iti=thus. ; veditabbo=it should be known. ; kāviya=Just as. ; dakaṃ dakāsayā pavisantītiettha=in this passage 'dakaṃ dakāsayā pavisanti'. ; u -kāralopo viya=like the elision of the letter 'u'. ; dakāsayā=beings that dwell in water. ; dakaṃ=into the water. ; pavisanti=enter. ; (khandhavaggasaṃyuta=Khandhavagga Saṃyutta. ; catukkaaṅguttiura=Catukka Aṅguttara. ; khopamasutta=Khopama Sutta.) ;

Myanmar Nissaya

vā=ကား။ ; sapariyantāti=၍။ ; vattabbe=လျက်။ ; sakāralopo=ကို။ ; kato=အပ်၏။ ; iti=သို့။ ; veditabbo=၏။ ; kāviya=ဟူမူကား။ ; dakaṃ dakāsayā pavisantītiettha=ဟူသော ဤပါဌ်၌။ ; u -kāralopo viya=သို့တည်း။ ; dakāsayā=ရေ၌ ကိန်းကုန်သော သတ္တဝါတို့သည်။ ; dakaṃ=ရေထဲသို့။ ; pavisanti=ပြေးဝင်ကုန်၏။ ; (khandhavaggasaṃyuta=ခဇ္ဇနီယဝဂ်။ ; catukkaaṅguttiura=ခေါပမသုတ်။) ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3704 | Chunk: 62

Parisuddhabhāvo pārisuddhi, pariyantā ca sā pārisuddhi cāti pariyantapārisuddhi, pariyantapārisuddhisaṅkhātaṃ sīlaṃ pariyantapārisuddhisīlaṃ.

AI Translation based on Nissaya

The state of being pure is `pārisuddhi`. It is limited (`pariyantā`) and it is purity (`pārisuddhi`); therefore, it is `pariyantapārisuddhi`. The virtue designated as `pariyantapārisuddhi` is `pariyantapārisuddhisīlaṃ`.

Vietnamese AI Translation

Trạng thái thanh tịnh là `pārisuddhi`. Nó có giới hạn (`pariyantā`) và nó là sự thanh tịnh (`pārisuddhi`); do đó, nó là `pariyantapārisuddhi`. Giới được gọi là `pariyantapārisuddhi` là `pariyantapārisuddhisīlaṃ`.

AI Translation Nissaya

parisuddhabhāvo=The state of being pure. ; pārisuddhi=is `pārisuddhi`. ; pariyantāca=it is limited, and. ; vā=or it has an end. ; vā=or it is together with a limit. ; hoti=it is. ; sā=that thing. ; pārisuddhica=is also the state of being pure. ; hoti=is. ; ivi tasmā=therefore. ; pariyantapārisuddhi=it is `pariyantapārisuddhi`. ; pariyantapārisuddhisaṅkhātaṃ=called 'virtue of limited purity'. ; sīlaṃ=is the virtue. ;

Myanmar Nissaya

parisuddhabhāvo=စင်ကြယ်သည်၏ အဖြစ်သည်။ ; pārisuddhi=မည်၏။ ; pariyantāca=အပိုင်းအခြားရှိသည်လည်း။ ; vā=အဆုံးရှိသည်လည်း။ ; vā=အပိုင်းအခြားနှင့်တကွ ဖြစ်သည်လည်း။ ; hoti=၏။ ; sā=ထိုသူသည်။ ; pārisuddhica=စင်ကြယ်သည်၏ အဖစ်သည်လည်း။ ; hoti=၏။ ; ivi tasmā=ကြောင့်။ ; pariyantapārisuddhi=မည်၏။ ; pariyantapārisuddhisaṅkhātaṃ=ဟုဆိုအပ်သော။ ; sīlaṃ=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3705 | Chunk: 62

Vuttapaṭipakkhena na pariyantāti apariyantā , natthi etissā pariyantotipi apariyantā, vuddho etissā pariyantotipi apariyantā.

AI Translation based on Nissaya

By way of the opposite of what has been said, it is not limited, thus it is **`apariyantā`** (unlimited). Or, for this purity there is no limit, thus it is `apariyantā`. Or, for this purity there is no further limit to be developed, thus it is `apariyantā`.

Vietnamese AI Translation

Theo cách đối nghịch với những gì đã nói, nó không có giới hạn, do đó nó là **`apariyantā`** (không giới hạn). Hoặc, đối với sự thanh tịnh này không có giới hạn, do đó nó là `apariyantā`. Hoặc, đối với sự thanh tịnh này không có giới hạn nào khác cần phải phát triển thêm, do đó nó là `apariyantā`.

AI Translation Nissaya

pariyantapārisuddhisīla=virtue of limited purity. ; vuttapaṭipakkhena=By the opposite of what was said. ; pariyantā=a limited purity. ; vā=or a purity with an end. ; vā=or a purity with a limit. ; na=is not. ; ititasmā=therefore. ; apariyantā=it is called `apariyantā`. ; etissā pārisuddhiyā=For this purity. ; pariyanto=a limit. ; vā=or an end. ; natthi=there is not. ; ititasmāpi=for this reason also. ; apariyantā=it is called `apariyantā`. ; etissā pārisuddhiyā=For this purity. ; vuddho=a grown. ; pariyanto=limit. ; natthi=there is not. ; ititasmāpi=for this reason also. ; apariyantā=it is called `apariyantā`. ;

Myanmar Nissaya

pariyantapārisuddhisīla= ; vuttapaṭipakkhena=ဆိုအပ်ပြီးသည်မှ ပြန်သောအားဖြင့်။ ; pariyantā=အပိုင်းအခြားရှိသော ပါရိသုဒ္ဓိသည်။ ; vā=အဆုံးရှိသော ပါရိသုဒ္ဓိသည်။ ; vā=အပိုင်းအခြားနှင့်တကွဖစ်သော ပါရိသုဒ္ဓိသည်။ ; na=မဟုတ်။ ; ititasmā=ကြောင့်။ ; apariyantā=မည်၏။ ; etissā pārisuddhiyā=အား။ ; pariyanto=သည်။ ; vā=အဆုံးသည်။ ; natthi=မရှိ။ ; ititasmāpi=ကြောင့်လည်း။ ; apariyantā=မည်၏။ ; etissā pārisuddhiyā=အား။ ; vuddho=ကြီးပွားသော။ ; pariyanto=အပိုင်းအခြားသည်။ ; natthi=မရှိ။ ; ititasmāpi=ကြောင့်လည်း။ ; apariyantā=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3706 | Chunk: 62

Samādānato pabhuti akhaṇḍitattā khaṇḍitāpi katapaṭikammattā cittuppādamattakenāpi malena virahitattā ca parisuddhajātimaṇi viya sudhantasuparikammakatasuvaṇṇaṃ viya ca parisuddhattā ariyamaggassa padaṭṭhānabhūtā anūnaṭṭhena paripūṇṇā.

AI Translation based on Nissaya

Because from the time of undertaking it is unbroken, or if broken has been repaired, and because it is free from even the slightest defilement of a transgressive thought-moment, it is pure like a naturally pure gem or like well-wrought gold. Being a proximate cause for the noble path, in the sense of not being deficient, it is **`paripūṇṇā`** (complete).

Vietnamese AI Translation

Bởi vì từ lúc thọ trì, giới không bị phá vỡ, hoặc nếu bị phá vỡ đã được sửa chữa, và bởi vì nó không có dù chỉ một chút ô nhiễm nhỏ nhất của một sát-na tư tưởng vi phạm, nên nó thanh tịnh như một viên ngọc quý tự nhiên hoặc như vàng đã được luyện kỹ. Là một nhân gần cho thánh đạo, theo nghĩa không bị thiếu sót, nó là **`paripūṇṇā`** (hoàn hảo).

AI Translation Nissaya

samādānato=From the undertaking. ; pabhuti=starting from. ; akhaṇḍikattā=because of being unbroken. ; (īmha ca၍ hitapāṭhatiu့kiu anūnaṭṭhenamhā khyaññaḥcapa) khaṇḍitāpi=even if broken. ; katapaṭikammattā=because of having been repaired, and. ; cittuppādamattake nāpi=even by a mere thought-moment that is a cause for transgression. ; malena=from defilement. ; virahitattāca=because of being free from, and. ; parisuddhajātimaṇiviya=like a naturally pure gem, and. ; sudhantasuparikammakatasuvaṇṇaṃviyaca=like well-smelted and well-wrought gold. ; parisuddhattā=because of being pure. ; ariya maggassa=of the noble path. ; padaṭṭhānabhūtā=being a proximate cause. ; anūnaṭṭhena=in the sense of not being deficient. ; paripuṇṇā=it is called `paripuṇṇā` (complete). ;

Myanmar Nissaya

samādānato=ဆောက်တည်သည်မှ။ ; pabhuti=စ၍။ ; akhaṇḍikattā=ကျိုးခြင်းသို့ မရောက်ကောင်းသည်၏ အဖြစ်ကြောင့်တည်း။ ; (īmha ca၍ hitapāṭhatiu့kiu anūnaṭṭhenamhā khyaññaḥcapa) khaṇḍitāpi=ကျိုးခြင်းသို့ ရောက်သော်လည်း။ ; katapaṭikammattā=ပြုအပ်သော ကုစားခြင်းရှိသည်၏ အဖြစ်ကြောင့်လည်းကောင်း။ ; cittuppādamattake nāpi=လွန်ကျူးခြင်း၏ အကြောင်းဖြစ်သော စိတ္တုပ္ပါဒ် မျှသာဖြစ်သော။ ; malena=အညစ်အကြေးမှ။ ; virahitattāca=ကင်းသည်၏ အဖြစ်ကြောင့်လည်းကောင်း။ ; parisuddhajātimaṇiviya=စင်ကြယ်သော ပတ္တမြားစစ်ကဲ့သို့ လည်းကောင်း။ ; sudhantasuparikammakatasuvaṇṇaṃviyaca=ကောင်းစွာ ဦးသည်ဖြစ်၍ အပြေအပြစ်ပြုအပ်သော ရွှေကဲ့သို့လည်းကောင်း။ ; parisuddhattā=ကြောင့်။ ; ariya maggassa=၏။ ; padaṭṭhānabhūtā=နီးစွာသော အကြောင်းဖြစ်၍ ဖြစ်သော ပါရိသုဒ္ဓိသီလသည်။ ; anūnaṭṭhena=မဆုတ်ယုတ်သော အနက်အားဖြင့်။ ; paripuṇṇā=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3707 | Chunk: 62

Diṭṭhiyā pahīnattā diṭṭhiparāmāsena aggahitattā aparāmaṭṭhā .

AI Translation based on Nissaya

Because wrong view is abandoned, or because it is not grasped with the misapprehension that is wrong view, it is **`aparāmaṭṭhā`** (unmisapprehended).

Vietnamese AI Translation

Bởi vì tà kiến đã được đoạn trừ, hoặc bởi vì nó không bị nắm giữ với sự hiểu sai là tà kiến, nên nó là **`aparāmaṭṭhā`** (không bị chấp thủ sai lầm).

AI Translation Nissaya

diṭṭhiyā=of wrong view. ; vā=or it. ; pahīnattā=because of having been abandoned. ; diṭṭhiparāmāsena=by the misapprehension that is wrong view. ; aggahitattā=because of not being grasped. ; aparāmaṭṭhā=it is called `aparāmaṭṭhā` (unmisapprehended). ;

Myanmar Nissaya

diṭṭhiyā=၏။ ; vā=ကို။ ; pahīnattā=ကြောင့်။ ; diṭṭhiparāmāsena=ဒိဋ္ဌိတည်းဟူသော ပရာမာသ တရားဖြင့်။ ; aggahitattā=ကြောင့်။ ; aparāmaṭṭhā=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3708 | Chunk: 62

Ayaṃ te sīle dosoti kenaci codakena parāmasituṃ asakkuṇeyyattā vā aparāmaṭṭhā.

AI Translation based on Nissaya

Alternatively, because no accuser is able to misapprehend it, saying, “This is a fault in your virtue,” it is `aparāmaṭṭhā`.

Vietnamese AI Translation

Một cách khác, bởi vì không có người tố cáo nào có thể hiểu sai về nó, nói rằng, “Đây là một lỗi trong giới của ông,” nên nó là `aparāmaṭṭhā`.

AI Translation Nissaya

vā=Alternatively. ; te=your. ; sīle=in the virtue. ; doso=a fault. ; tanaññaḥkāḥ= ; ayaṃ doso=this fault. ; atthi=exists. ; iti=thus. ; kenaci=by some. ; codakena=accuser. ; parāmasituṃ=to misapprehend. ; asakkuṇeyyattā=because of being unable to. ; aparāmaṭṭhā=it is called `aparāmaṭṭhā`. ;

Myanmar Nissaya

vā=တနည်းကား။ ; te=သင်၏။ ; sīle=၌။ ; doso=အပြစ်တည်း။ ; tanaññaḥkāḥ= ; ayaṃ doso=ဤအပြစ်သည်။ ; atthi=၏။ ; iti=သို့။ ; kenaci=သော။ ; codakena=သည်။ ; parāmasituṃ=မှားသောအားဖြင့် သုံးသပ်ခြင်းငှါ။ ; asakkuṇeyyattā=မတတ်ကောင်းသည်၏ အဖြစ်ကြောင့်။ ; aparāmaṭṭhā=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3709 | Chunk: 62

Arahattaphalakkhaṇe sabbadarathapaṭippassaddhiyā paṭippassaddhi .

AI Translation based on Nissaya

At the moment of the fruit of Arahantship, through the pacification of all distress, it is **`paṭippassaddhi`** (pacified).

Vietnamese AI Translation

Vào thời điểm quả A-la-hán, thông qua sự lắng dịu của tất cả mọi phiền não, nó là **`paṭippassaddhi`** (đã được an tịnh).

AI Translation Nissaya

arahattaphalakkhaṇe=at the moment of the fruit of Arahantship. ; sabbadarathapaṭippassaddhiyā=by the pacification of all distress. ; vā=or because of pacification. ; paṭippassaddhi=it is called `paṭippassaddhi` (pacified). ;

Myanmar Nissaya

arahattaphalakkhaṇe=၌။ ; sabbadarathapaṭippassaddhiyā=ဥဿုံသော ပူပန်ခြင်းတို့မှ ငြိမ်းခြင်းအားဖြင့်။ ; vā=ငြိမ်းခြင်းကြောင့်။ ; paṭippassaddhi=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3710 | Chunk: 62

Anupasampannānan ti anavasesasamādānavasena sīlasampadāya bhusaṃ sampannāti upasampannā, na upasampannā anupasampannā.

AI Translation based on Nissaya

Regarding **`anupasampannānaṃ`** (of the non-ordained): `upasampannā` means one who is greatly accomplished in the accomplishment of virtue by way of undertaking it completely. `Anupasampannā` is not that.

Vietnamese AI Translation

Về **`anupasampannānaṃ`** (của những người chưa thọ cụ túc giới): `upasampannā` có nghĩa là người đã thành tựu viên mãn về giới hạnh bằng cách thọ trì hoàn toàn. `Anupasampannā` thì không phải như vậy.

AI Translation Nissaya

anupasampaniānanti=The word `anupasampannānaṃ`. ; anavasesasamādānavasena=by way of undertaking without remainder. ; sīlasampadāya=in the accomplishment of virtue. ; bhusaṃ=greatly. ; sampannā=is accomplished. ; iti tasmā=therefore. ; upasampannā=a person greatly accomplished in virtue. ; na=not. ;

Myanmar Nissaya

anupasampaniānanti=ကား။ ; anavasesasamādānavasena=အကြွင်းမရှိဆောက်တည်သည်၏ အစွမ်းအားဖြင့်။ ; sīlasampadāya=ခြင်း၌။ ; bhusaṃ=စွာ။ ; sampannā=ပြည့်စုံသည်တည်း။ ; iti tasmā=ကြောင့်။ ; upasampannā=လွန်မင်းစွာ သီလနှင့် ပြည့်စုံသော ပုဂ္ဂိုလ်သည်။ ; na=မဟုတ်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3711 | Chunk: 62

Tesaṃ anupasampannānaṃ.

AI Translation based on Nissaya

`Anupasampannā`. Of those `anupasampannānaṃ` (non-ordained), i.e., of laypeople and novices.

Vietnamese AI Translation

`Anupasampannā`. Của những người `anupasampannānaṃ` (chưa thọ cụ túc giới), tức là của hàng tại gia và sa-di.

AI Translation Nissaya

anupasampannā=Not `upasampannā`. ; tesaṃ anupasampannānaṃ=of those non-ordained. ; vā=or of laypeople and novices. ;

Myanmar Nissaya

anupasampannā=မဟုတ်။ ; tesaṃ anupasampannānaṃ=တို့၏။ ; vā=လူသာမဏေတို့၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3712 | Chunk: 62

Pariyantasikkhāpadānan ti [M1.188] ettha sikkhitabbaṭṭhena sikkhā, koṭṭhāsaṭṭhena padāni, sikkhitabbakoṭṭhāsānīti attho.

AI Translation based on Nissaya

Here in the phrase **`pariyantasikkhāpadānaṃ`** [M1.188] (of those with limited training rules): `sikkhā` means 'what is to be trained in,' and `padāni` means 'portions.' The meaning is 'the portions to be trained in.'

Vietnamese AI Translation

Ở đây trong cụm từ **`pariyantasikkhāpadānaṃ`** [M1.188] (của những người có học giới giới hạn): `sikkhā` có nghĩa là 'cái cần được học tập,' và `padāni` có nghĩa là 'các phần.' Ý nghĩa là 'các phần cần được học tập.'

AI Translation Nissaya

pariyantasikkhāpadānanti ettha=Here in the phrase `pariyantasikkhāpadānaṃ`. ; sikkhitabbaṭṭhena=in the sense of what should be trained in or undertaken. ; sikkhā=it is called `sikkhā`. ; koṭṭhāsaṭṭhena=in the sense of a portion or part. ; padāni=it is called `padāni`. ; sikkhitabbakoṭṭhāsāni=the portions to be undertaken. ; itiayaṃ=this is. ; attho=the meaning. ;

Myanmar Nissaya

pariyantasikkhāpadānanti ettha=ဟူသော ပါဌ်၌။ ; sikkhitabbaṭṭhena=ကျင့်အပ် ဆောက်တသည်အပ်သော အနက်ကြောင့်။ ; sikkhā=မည်ကုန်၏။ ; koṭṭhāsaṭṭhena=အဖို့အစုဟူသော အနက်ကြောင့်။ ; padāni=မည်ကုန်၏။ ; sikkhitabbakoṭṭhāsāni=ဆောက်တည်အပ်သော အဖို့အစုတို့ကို။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3713 | Chunk: 62

Apica sīle patiṭṭhitena uparipattabbattā sabbe kusalā dhammā [P1.204] sikkhā, sīlāni tāsaṃ sikkhānaṃ patiṭṭhaṭṭhena padānīti sikkhānaṃ padattā sikkhāpadāni [V1.172], pariyantāni sikkhāpadāni etesanti pariyantasikkhāpadā.

AI Translation based on Nissaya

Furthermore, because all higher wholesome states are to be attained by one established in virtue, they are called `sikkhā` (trainings). The virtues are the foundation (`padāni`) for those trainings, in the sense of being a support. Thus, because they are the foundation for the trainings, they are called `sikkhāpadāni` [V1.172] (training rules). `Pariyantasikkhāpadā` are those for whom there are these limited training rules.

Vietnamese AI Translation

Hơn nữa, bởi vì tất cả các thiện pháp cao hơn đều được đạt đến bởi người đã an trú trong giới, chúng được gọi là `sikkhā` (các điều học). Giới là nền tảng (`padāni`) cho những điều học đó, theo nghĩa là một sự hỗ trợ. Do đó, vì chúng là nền tảng cho các điều học, chúng được gọi là `sikkhāpadāni` [V1.172] (các học giới). `Pariyantasikkhāpadā` là những người có những học giới giới hạn này.

AI Translation Nissaya

apica=Furthermore. ; sīle=in virtue. ; paviṭṭhitena=by a person established. ; upari=higher. ; sabbe=all. ; kusalādhammā=wholesome states. ; vā=or them. ; pattabbattā=because they are to be attained. ; sikkhā=are called `sikkhā`. ; sīlāni=The virtues called `paripuṇṇa` and `aparāmaṭṭha`, both of the ordained and non-ordained. ; tāsaṃ sikkhānaṃ=of those wholesome states. ; patiṭṭhaṭṭhena=in the sense of being a foundation. ; padāni=are called `padāni`. ; iti=thus. ; sikkhānaṃ=of the trainings. ; padattā=because of being the foundation. ; tanaññaḥ= ; ititasmā padattā=because of being the foundation for all those wholesome states. ; sikkhāpadāni=they are called `sikkhāpadāni`. ;

Myanmar Nissaya

apica=တနည်းလည်း။ ; sīle=၌။ ; paviṭṭhitena=တည်ပြီးသော ပုဂ္ဂိုလ်သည်။ ; upari=အထက်၌။ ; sabbe=ကုန်သော။ ; kusalādhammā=တို့သည်။ ; vā=တို့ကို။ ; pattabbattā=ကြောင့်။ ; sikkhā=မည်ကုန်၏။ ; sīlāni=ပရိပုဏ္ဏအပရာမဋ္ဌဟု ဆိုအပ်သော ဥပသမ္ပန္နသီလ, အနုပသမ္ပန္နသီလတို့သည်။ ; tāsaṃ sikkhānaṃ=ထိုအလုံးစုံသော ကုသိုလ်တရားတို့၏။ ; patiṭṭhaṭṭhena=တည်ရာဟူသော အနက်ကြောင့်။ ; padāni=မည်ကုန်၏။ ; iti=သို့။ ; sikkhānaṃ=တို့၏။ ; padattā=တည်ရာ၏အဖြစ်ကြောင့်။ ; tanaññaḥ= ; ititasmā padattā=ထိုသို့ အလုံးစုံသော ကုသိုလ် တရားတို့၏ တည်ရာ၏ အဖြစ်ကြောင့်။ ; sikkhāpadāni=မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3714 | Chunk: 62

Tesaṃ pariyantasikkhāpadānaṃ.

AI Translation based on Nissaya

Of those with limited training rules.

Vietnamese AI Translation

Của những người có học giới giới hạn.

AI Translation Nissaya

etesaṃ=For those laypeople and novices. ; pariyantāni=limited. ; sikkhāpadāni=portions to be trained in and undertaken. ; santi=there are. ; tanaññaḥ= ; pariyantāni=limited. ; sikkhāpadāni=virtues which are the foundation for all states. ; santi=there are. ; iti tasmā=therefore. ; pariyantasikkhāpadā=they are called `pariyantasikkhāpadā`. ; tesaṃ pariyantasikkhāpadānaṃ=of those laypeople and novices who have virtue which is the limited foundation for all wholesome states. ;

Myanmar Nissaya

etesaṃ=ထိုလူသာမဏေတို့အား။ ; pariyantāni=အပိုင်းအခြားရှိကုန်သော။ ; sikkhāpadāni=ကျင့်အပ်ဆောက်တည်အပ်သော အဖို့အစုတို့သည်။ ; santi=ကုန်၏။ ; tanaññaḥ= ; pariyantāni=အပိုင်းအခြား ရှိကုန်သော။ ; sikkhāpadāni=အလုံးစုံသော တရားတို့၏ တည်ရာဖြစ်သော သီလတို့သည်။ ; santi=ကုန်၏။ ; iti tasmā=ကြောင့်။ ; pariyantasikkhāpadā=မည်ကုန်၏။ ; tesaṃ pariyantasikkhāpadānaṃ=ထိုအပိုင်းအခြားရှိကုန်သော အလုံးစုံသော ကုသိုလ်တရားတို့၏ တည်ရာဖြစ်သော ကုသိုလ် ရှိကုန်သော လူသာမဏေ တို့၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3715 | Chunk: 62

Ettha ca dve pariyantā sikkhāpadapariyanto ca kālapariyanto ca.

AI Translation based on Nissaya

And here there are two limits: a limit of training rules and a limit of time.

Vietnamese AI Translation

Và ở đây có hai giới hạn: giới hạn về học giới và giới hạn về thời gian.

AI Translation Nissaya

ca=And. ; ettha=here in this limited virtue. ; pariyantā=limits. ; sikkhapada pariyantoca=a limit of training rules, and. ; kālapariyantoca=a limit of time. ; iti=thus. ; dve=there are two. ;

Myanmar Nissaya

ca=ဆက်။ ; ettha=ဤပရိယန္တသီလ၌။ ; pariyantā=တို့သည်။ ; sikkhapada pariyantoca=လည်းကောငး်။ ; kālapariyantoca=လည်းကောင်း။ ; iti=သို့။ ; dve=တို့တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3716 | Chunk: 62

Katamo sikkhāpadapariyanto ?

AI Translation based on Nissaya

What is the limit of training rules?

Vietnamese AI Translation

Giới hạn về học giới là gì?

AI Translation Nissaya

sikkhāpadapariyanto=What is the limit of training rules? ; katamo=what is it? ;

Myanmar Nissaya

sikkhāpadapariyanto=သိက္ခာပုဒ်ကို ပိုင်းခြားခြင်းဟူသည်။ ; katamo=အတီနည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3717 | Chunk: 62

Upāsakopāsikānaṃ yathāsamādānavasena ekaṃ vā dve vā tīṇi vā cattāri vā pañca vā aṭṭha vā dasa vā sikkhāpadāni honti, sikkhamānasāmaṇerasāmaṇerīnaṃ dasa sikkhāpadāni.

AI Translation based on Nissaya

For laymen and laywomen, according to their undertaking, there may be one, two, three, four, five, eight, or ten training rules. For female probationers, male novices, and female novices, there are ten training rules.

Vietnamese AI Translation

Đối với nam cư sĩ và nữ cư sĩ, tùy theo sự thọ trì của họ, có thể có một, hai, ba, bốn, năm, tám, hoặc mười học giới. Đối với các vị Thức-xoa-ma-na, sa-di và sa-di-ni, có mười học giới.

AI Translation Nissaya

upāsakopāsikānaṃ=For laymen and laywomen. ; yathāsamādānavasena=according to their particular undertaking. ; ekaṃ=one. ; sikkhāpadānaṃ=training rule, or. ; dve=two. ; sikkhā padānivā=training rules, or. ; tīṇi=three. ; sikkhāpadānivā=training rules, or. ; cattāri=four. ; sikkhāpadānivā=training rules, or. ; pañca=five. ; sikkhāpadānivā=training rules, or. ; aṭṭha=eight. ; sikkhāpadānivā=training rules, or. ; dasa=ten. ; sikkhāpadānivā=training rules. ; honti=there are. ; (Just as for the five precepts 'one or two' is said for the minimum, it is not said for the eight and ten precepts because those two sets of precepts are fixed.) ; sikkhāmānasāmaṇerasāmaṇerīnaṃ=For female probationers, male novices, and female novices. ; dasasikkhāpadāni=ten training rules. ; honti=there are. ;

Myanmar Nissaya

upāsakopāsikānaṃ=ဥပါသကာ ဥပါသိကာတို့အား။ ; yathāsamādānavasena=အကြင်အကြင် ဆောက်တည်သည်၏ အစွမ်း အားဖြင့်။ ; ekaṃ=သော။ ; sikkhāpadānaṃ=သိက္ခာပုဒ္သည် လည်းကောင်း။ ; dve=ကုန်သော။ ; sikkhā padānivā=တို့သည်လည်းကောင်း။ ; tīṇi=ကုန်သော။ ; sikkhāpadānivā=တို့သည်လည်းကောင်း။ ; cattāri=ကုန်သော။ ; sikkhāpadānivā=လည်းကောင်း။ ; pañca=ကုန်သော။ ; sikkhāpadānivā=တို့သည်လည်းကောင်း။ ; aṭṭha=ကုန်သော။ ; sikkhāpadānivā=တို့သည်လည်းကောင်း။ ; dasa=ကုန်သော။ ; sikkhāpadānivā=တို့သည်လည်းကောင်း။ ; honti=ကုန်၏။ ; (ပဉ္စသီလ၌ ဧက ဝါဒွေ ဝါ ဟူ၍ အယုတ်ကို ဆိုသကဲ့သို့ အဋ္ဌင်္ဂသီလ ဒသင်္ဂသီလတို့၌ အယုတ်ကို မဆိုသည်ကား ထိုနှစ်ပါးသော သီလတို့၏ နိဗဒ္ဓဖြစ်သောကြောင့်တည်း။) ; sikkhāmānasāmaṇerasāmaṇerīnaṃ=တို့အား။ ; dasasikkhāpadāni=တို့သည်။ ; honti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3718 | Chunk: 62

Ayaṃ sikkhāpadapariyanto.

AI Translation based on Nissaya

This is the limit of training rules.

Vietnamese AI Translation

Đây là giới hạn về học giới.

AI Translation Nissaya

ayaṃ=This just described limit. ; sikkhāpadapariyanto=is the limit of training rules. ;

Myanmar Nissaya

ayaṃ=ဤဆိုအပ်ပြီးသော အပိုင်းအခြားသည်။ ; sikkhāpadapariyanto=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3719 | Chunk: 62

Katamo kālapariyanto ?

AI Translation based on Nissaya

What is the limit of time?

Vietnamese AI Translation

Giới hạn về thời gian là gì?

AI Translation Nissaya

kālapariyanto=The limit of time. ; katamo=what is it? ;

Myanmar Nissaya

kālapariyanto=ခြင်းသည်။ ; katamo=နည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3720 | Chunk: 62

Upāsakopāsikā dānaṃ dadamānā parivesanapariyantaṃ sīlaṃ samādiyanti, vihāragatā vihārapariyantaṃ sīlaṃ samādiyanti, ekaṃ vā dve vā tayo vā bhiyyo vā rattindivāni paricchedaṃ katvā sīlaṃ samādiyanti.

AI Translation based on Nissaya

Laymen and laywomen, while giving a gift, undertake virtue limited to the duration of the meal service. When they go to a monastery, they undertake virtue limited to their time at the monastery. They undertake virtue having set a limit of one day and night, two days and nights, three days and nights, or more.

Vietnamese AI Translation

Các nam cư sĩ và nữ cư sĩ, trong khi cúng dường, thọ trì giới giới hạn trong thời gian phục vụ bữa ăn. Khi họ đến một tu viện, họ thọ trì giới giới hạn trong thời gian ở tu viện. Họ thọ trì giới sau khi đã đặt ra giới hạn là một ngày một đêm, hai ngày hai đêm, ba ngày ba đêm, hoặc nhiều hơn.

AI Translation Nissaya

upāsakopāsikā=Laymen and laywomen. ; dānaṃ=a gift. ; dadamānā=while giving. ; parivesanapariyantaṃ=which has the serving of the meal as its limit. ; sīlaṃ=virtue. ; samādiyanti=undertake. ; vihāragatā=Laymen and laywomen who have gone to the monastery. ; vihārapariyantaṃ=which has the monastery as its limit. ; sīlaṃ=virtue. ; samādiyanti=undertake. ; ekaṃ=one. ; rattindivaṃvā=day and night, or. ; dve=two. ; rattindivānivā=days and nights, or. ; tayo=three. ; rattindivānivā=days and nights, or. ; bhiyyo=more than three. ; rattindivānivā=days and nights. ; paricchedaṃ=a limit. ; katvā=having made. ; sīlaṃ=virtue. ; samādiyanti=undertake. ;

Myanmar Nissaya

upāsakopāsikā=တို့သည်။ ; dānaṃ=ကို။ ; dadamānā=သော်။ ; parivesanapariyantaṃ=ရှာမှီးခြင်းလျှင် အဆုံးရှိသော။ ; sīlaṃ=ကို။ ; samādiyanti=ကုန်၏။ ; vihāragatā=ကျောင်းသို့ သွားကုန်သော ဒါယကာယောင်္ကျား ဒါယိကာမိန်းမတို့သည်။ ; vihārapariyantaṃ=ကျောင်းလျှင် အပိုင်းရှိသော။ ; sīlaṃ=ကို။ ; samādiyanti=ကုန်၏။ ; ekaṃ=သော။ ; rattindivaṃvā=ညဉ့်နေ့ကိုလည်းကောင်း။ ; dve=ကုန်သော။ ; rattindivānivā=တို့ကိုလည်းကောင်း။ ; tayo=ကုန်သော။ ; rattindivānivā=တို့ကိုလည်းကောင်း။ ; bhiyyo=သုံးပါးသော ညဉ့်နေ့တို့ထက် အလွန် ။ ; rattindivānivā=တို့ကိုလည်းကောင်း။ ; paricchedaṃ=အပိုင်းအခြားကို။ ; katvā=၍။ ; sīlaṃ=ကို။ ; samādiyanti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3721 | Chunk: 62

Ayaṃ kālapariyanto.

AI Translation based on Nissaya

This is the limit of time.

Vietnamese AI Translation

Đây là giới hạn về thời gian.

AI Translation Nissaya

ayaṃ=This just described limit. ; kālapariyanto=is the limit of time. ;

Myanmar Nissaya

ayaṃ=ဤဆိုအပ်ပြီးသော အပိုင်းအခြားသည်။ ; kālapariyanto=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3722 | Chunk: 62

Imesu dvīsu pariyantesu sikkhāpadaṃ pariyantaṃ katvā samādinnaṃ sīlaṃ vītikkamanena vā maraṇena vā paṭippassambhati, kālaṃ pariyantaṃ katvā samādinnaṃ taṃtaṃkālātikkamena paṭippassambhati.

AI Translation based on Nissaya

Among these two limits, virtue that is undertaken by making a training rule the limit is pacified either by transgression or by death. Virtue undertaken by making time the limit is pacified by the passing of that respective time.

Vietnamese AI Translation

Trong hai giới hạn này, giới được thọ trì bằng cách lấy học giới làm giới hạn sẽ bị chấm dứt bởi sự vi phạm hoặc bởi cái chết. Giới được thọ trì bằng cách lấy thời gian làm giới hạn sẽ bị chấm dứt khi thời gian tương ứng đó trôi qua.

AI Translation Nissaya

dvīsu=of the two. ; imesu pariyantesu=among these limits. ; sikkhāpadapariyantaṃ=the training rule as the limit. ; katvā=having made. ; samādinnaṃ=undertaken. ; sīlaṃ=virtue. ; vītikkamanenavā=either by transgression. ; maraṇenavā=or by death. ; paṭippassambhati=is pacified. ; kālaṃ=time. ; pariyantaṃ=as the limit. ; katvā=having made. ; samādinnaṃ=undertaken. ; sīlaṃ=virtue. ; taṃtaṃ kālātikkamena=by the passing of that respective designated time. ; paṭippassampati=is pacified. ;

Myanmar Nissaya

dvīsu=ကုန်သော။ ; imesu pariyantesu=တို့တွင်။ ; sikkhāpadapariyantaṃ=ခြင်းကို။ ; katvā=၍။ ; samādinnaṃ=အပ်သော။ ; sīlaṃ=သည်။ ; vītikkamanenavā=လွန်ကျူးသဖြင့်လည်းကောင်း။ ; maraṇenavā=သေသဖြင့်လည်းကောင်း။ ; paṭippassambhati=ငြိမ်း၏။ ; kālaṃ=ကို။ ; pariyantaṃ=ကို။ ; katvā=၍။ ; samādinnaṃ=သော။ ; sīlaṃ=သည်။ ; taṃtaṃ kālātikkamena=ထိုထိုပိုင်းခြားအပ်သော ကာလကို လွန်သဖြင့်။ ; paṭippassampati=ငြိမ်း၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3723 | Chunk: 63

Apariyantasikkhāpadānan ti –

AI Translation based on Nissaya

As for **(those with) unlimited training rules**:

Vietnamese AI Translation

Đối với **(những người có) học giới không giới hạn**:

AI Translation Nissaya

apariyanta sikkhāpadānanti=as for (those with) unlimited training rules. ;

Myanmar Nissaya

apariyanta sikkhāpadānanti=ကား။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3724 | Chunk: 63

‘‘Nava koṭisahassāni, asīti satakoṭiyo;

AI Translation based on Nissaya

“Nine thousand koṭis (90 billion), and one hundred and eighty koṭis (1.8 billion);

Vietnamese AI Translation

“Chín ngàn koṭi (90 tỷ), và một trăm tám mươi koṭi (1,8 tỷ);

AI Translation Nissaya

Meaning of the verse. ; navakoṭisahassāni=nine thousand koṭi (90 billion) of training rules, and. ; asītisatakoṭiyo=one hundred and eighty koṭi (1.8 billion) of training rules, and. ;

Myanmar Nissaya

ဂါထာအနက်။ ။ ; navakoṭisahassāni=ကုဋေကိုးထောင်သော သိက္ခာပုဒ်တို့သည် လည်းကောင်း။ ; asītisatakoṭiyo=ကုဋေတစ်ရာ့ရှစ်ဆယ်သော သိက္ခာပုဒ်တို့သည်လည်းကောင်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3725 | Chunk: 63

Paññāsa satasahassāni, chattiṃsa ca punāpare.

AI Translation based on Nissaya

five million, and again another thirty-six thousand.

Vietnamese AI Translation

năm triệu, và lại thêm ba mươi sáu ngàn nữa.

AI Translation Nissaya

saññāsasatasahassāni=five million training rules, and. ; puna=again. ; apare=other. ; chattiṃsaca chattiṃsasahassānica=and thirty-six thousand other training rules, and. ;

Myanmar Nissaya

saññāsasatasahassāni=ငါးသန်းသော သိက္ခာပုဒ်တို့သည်လည်းကောင်း။ ; puna=ဖန်။ ; apare=ကုန်သော။ ; chattiṃsaca chattiṃsasahassānica=သုံးသောင်းခြောက်ထောင်သော သိက္ခာပုဒ်တို့သည်လည်းကောင်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3726 | Chunk: 63

‘‘Ete saṃvaravinayā, sambuddhena pakāsitā;

AI Translation based on Nissaya

“These disciplines of restraint were declared by the Perfectly Enlightened One;

Vietnamese AI Translation

“Những giới luật phòng hộ này đã được bậc Chánh Đẳng Giác tuyên thuyết;

AI Translation Nissaya

iti=Thus. ; ete saṃvaravinaya=these disciplines of restraint. ; sambuddhena=by the Perfectly Enlightened One. ; pakāsitā=were declared. ;

Myanmar Nissaya

iti=သို့။ ; ete saṃvaravinaya=ဤသံဝရဝိနည်းတို့ကို။ ; sambuddhena=သည်။ ; pakāsitā=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3727 | Chunk: 63

Peyyālamukhena niddiṭṭhā, sikkhā vinayasaṃvare’’ ti.

AI Translation based on Nissaya

the trainings in the discipline of restraint were pointed out by way of abbreviation.”

Vietnamese AI Translation

các học giới trong luật phòng hộ đã được chỉ ra một cách tóm lược.”

AI Translation Nissaya

peyyālamukhena=by way of abbreviation (peyyāla). ; vā=or by way of summarizing the full text. ; vinayasaṃvare=in the discipline of restraint. ; vā=or in the Vinaya laid down for the sake of guarding. ; sikkhā=the trainings. ; niddiṭṭhā=were pointed out. ;

Myanmar Nissaya

peyyālamukhena=ပေယျာလကို အဦးပြုသဖြင့်။ ; vā=အကျယ်၏ အမြွက်အားဖြင့်။ ; vinayasaṃvare=သံဝရဝိနည်း၌။ ; vā=စောင့်ရှောက်ခြင်းငှါ ပညတ် တော်မူအပ်သော ဝိနည်း၌။ ; sikkhā=တို့ကို။ ; niddiṭṭhā=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3728 | Chunk: 63

Evaṃ gaṇanavasena pariyantānampi sikkhāpadānaṃ anavasesasamādānabhāvavasena lābhayasañātiaṅgajīvitahetu adiṭṭhapariyantabhāvavasena upari rakkhitabbasīlaparicchedābhāvavasena ca natthi etesaṃ pariyantoti apariyantāni.

AI Translation based on Nissaya

Thus, even though these training rules have a limit by way of counting, because they are undertaken without remainder, because their limit is not to be transgressed for the sake of gain, retinue, relatives, limbs, or life, and because there is no demarcation of a higher virtue to be guarded, for these (ordained ones), there is no limit to them; they are unlimited.

Vietnamese AI Translation

Do đó, mặc dù những học giới này có giới hạn về mặt số lượng, nhưng vì chúng được thọ trì không còn sót lại, vì giới hạn của chúng không được vi phạm vì lợi lộc, quyến thuộc, thân quyến, tay chân, hay mạng sống, và vì không có sự phân định một giới hạnh cao hơn để gìn giữ, đối với những vị (xuất gia) này, không có giới hạn nào đối với chúng; chúng là không giới hạn.

AI Translation Nissaya

itievaṃ=Thus. ; gaṇanavasena=by way of counting. ; pariyantānaṃ=which have a limit. ; sikkhāpadānampi=even of the training rules. ; anavasesasamādānabhāvavasena=and by virtue of the state of being undertaken without remainder. ; lābhayasañātiaṅgajīvītahetu=for the sake of gain, retinue, relatives, limbs like hands and feet, and life. ; adiṭṭhapariyantabhāvavasena=and by virtue of the state of having an unseen limit. ; upari=higher. ; rakkhitabbasīlapicchedābhāvavasenaca=and by virtue of the absence of a demarcation of virtue to be guarded. ; etesaṃ=for these training rules. ; pariyanto=a limit. ; natthi=there is not. ; etesaṃ upasampannānaṃ=for these ordained ones. ; apariyantāni=unlimited. ; sikkhāpadāni=training rules. ; honti=are. ;

Myanmar Nissaya

itievaṃ=သို့။ ; gaṇanavasena=ဖြင့်။ ; pariyantānaṃ=အပိုင်းအခြားရှိကုန်သော။ ; sikkhāpadānampi=တို့၏လည်း။ ; anavasesasamādānabhāvavasena=အကြွင်းမဲ့ဆောက်တည်အပ်သည်၏ အဖြစ်၏ အစွမ်းဖြင့်လည်းကောင်း။ ; lābhayasañātiaṅgajīvītahetu=လာဘ် အခြံအရံ ဆွေမျိုး လက်ခြေစသော အင်္ဂါအသက်တည်းဟူသော အကြောင်းကြောင့်။ ; adiṭṭhapariyantabhāvavasena=မမြင်အပ်သော အပိုင်းအခြားရှိသူ၏ အဖြစ်၏ အစွမ်းကြောင့် လည်းကောင်း။ ; upari=အထက်၌။ ; rakkhitabbasīlapicchedābhāvavasenaca=စောင့်ရှောက်အပ်သော သီလကို ပိုင်းခြားခြင်း မရှိသည်၏ အစွမ်းဖြင့်လည်းကောင်း။ ; etesaṃ=ထိုသိက္ခာပုဒ်တို့အား။ ; pariyanto=သည်။ ; natthi=မရှိ။ ; etesaṃ upasampannānaṃ=တို့အား။ ; apariyantāni=ကုန်သော။ ; sikkhāpadāni=တို့သည်။ ; honti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3729 | Chunk: 63

Apariyantāni sikkhāpadāni etesanti apariyantasikkhāpadā.

AI Translation based on Nissaya

They have unlimited training rules, therefore they are called 'those with unlimited training rules' (apariyantasikkhāpadā).

Vietnamese AI Translation

Họ có những học giới không giới hạn, do đó họ được gọi là 'những người có học giới không giới hạn' (apariyantasikkhāpadā).

AI Translation Nissaya

ititasmā=Therefore. ; apariyantasikkhāpadā=they are called 'those with unlimited training rules'. ;

Myanmar Nissaya

ititasmā=ကြောင့်။ ; apariyantasikkhāpadā=မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3730 | Chunk: 63

Tesaṃ apariyantasikkhāpadānaṃ, vuddhapariyantasikkhāpadānanti vā attho.

AI Translation based on Nissaya

Of those with unlimited training rules (apariyantasikkhāpadānaṃ), or the meaning is, of those who have developed their training rules.

Vietnamese AI Translation

Của những người có học giới không giới hạn (apariyantasikkhāpadānaṃ), hoặc ý nghĩa là, của những người đã phát triển các học giới của mình.

AI Translation Nissaya

tesaṃ apariyantisikkhāpadānaṃ=Of those monks who have unlimited training rules. ; vā=or. ; vuddhapariyantasikkhā padānaṃ=of those monks who have developed their training rules. ; itiayaṃ=this is. ; attho=the meaning. ;

Myanmar Nissaya

tesaṃ apariyantisikkhāpadānaṃ=ထိုအပိုင်းအခြားမရှိသော သိက္ခာပုဒ်ရှိကုန်သော ရဟန်တို့၏။ ; vā=ကား။ ; vuddhapariyantasikkhā padānaṃ=ပွားစည်းသော သိက္ခာပုဒ်ရှိကုန်သော ရဟန်းတို့၏။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3731 | Chunk: 63

Puthujjanakalyāṇakānan tiādīsu [P1.205] –

AI Translation based on Nissaya

In texts such as **'Of the virtuous worldlings'** [P1.205]:

Vietnamese AI Translation

Trong các bản văn như **'Của những phàm phu hiền thiện'** [P1.205]:

AI Translation Nissaya

puthujjanakalyāṇakānanti ādīsu=In (the phrase) 'of the virtuous worldlings', and so on [P1.205]. ;

Myanmar Nissaya

puthujjanakalyāṇakānanti ādīsu=တို့၌။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3732 | Chunk: 63

‘‘Puthūnaṃ jananādīhi, kāraṇehi puthujjano;

AI Translation based on Nissaya

“A 'puthujjana' (worldling) is so-called for reasons such as generating various defilements;

Vietnamese AI Translation

“Một 'puthujjana' (phàm phu) được gọi như vậy vì những lý do như tạo ra nhiều loại phiền não khác nhau;

AI Translation Nissaya

Meaning of the verse. ; puthūnaṃ.la. janoiti=as...a person... ; vuttaputhujjanalakkhaṇaṃ=the characteristic of a worldling thus stated. ; anatikkamepi=even by not transgressing. ; puthūnaṃ=of various things such as the defilements. ; jananādīhi=by reasons such as generating. ; kāraṇehi=by reasons. ; puthujjano=is called a worldling (puthujjana). ;

Myanmar Nissaya

ဂါထာအနက်။ ။ ; puthūnaṃ.la. janoiti=ဟူ၍။ ; vuttaputhujjanalakkhaṇaṃ=ကို။ ; anatikkamepi=မလွန်ခြင်း ကြောင့်သော်လည်း။ ; puthūnaṃ=အထူးထူး အပြားပြားရှိကုန်သော ကိလေသာ အစရှိသည်တို့ကို။ ; jananādīhi=ဖြစ်စေခြင်း အစရှိကုန်သော။ ; kāraṇehi=တို့ဖြင့်။ ; puthujjano=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3733 | Chunk: 63

Puthujjanantogadhattā, puthuvāyaṃ jano iti’’.

AI Translation based on Nissaya

because of being included among the many folk, he is a 'puthujjana'; or, this person is separate (from the nobles), thus he is a 'puthujjana'.

Vietnamese AI Translation

vì được bao gồm trong số đông dân chúng, người ấy là một 'puthujjana'; hoặc, người này tách biệt (với các bậc thánh), do đó người ấy là một 'puthujjana'.

AI Translation Nissaya

puthujjanantogadhattā=because of being included among the many folk. ; puthujjano=he is called a worldling. ; ayaṃ jano=this person. ; puthuva=is indeed separate from the noble individuals. ; iti tasmā=therefore. ; puthujjano=he is called a worldling. ;

Myanmar Nissaya

puthujjanantogadhattā=အရေအတွက်ကို လွန်ကုန်သော အရိယာတို့၏ အတွင်း၌ ဖြစ်သည်၏ အဖြစ်ကြောင့်။ ; puthujjano=မည်၏။ ; ayaṃ jano=ဤသူသည်။ ; puthuva=အရိယာ ပုဂ္ဂိုလ်တို့မှ အသီးအခြားသာလျှင် တည်း။ ; iti tasmā=ကြောင့်။ ; puthujjano=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3734 | Chunk: 63

Andho puthujjano eko, kalyāṇeko puthujjano’’ ti.

AI Translation based on Nissaya

One is the blind worldling, one is the virtuous worldling.”

Vietnamese AI Translation

Một là phàm phu mù quáng, một là phàm phu hiền thiện.”

AI Translation Nissaya

duve puthujjanā.la. puthujjanoti=as...two types of worldlings. ;

Myanmar Nissaya

duve puthujjanā.la. puthujjanoti=ဟူ၍။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3735 | Chunk: 63

Vuttaputhujjanadvaye kalyāṇadhammasamāgamena andhaputhujjanabhāvaṃ atikkamma kalyāṇaputhujjanabhāve ṭhitānaṃ puthujjanakalyāṇakānaṃ kalyāṇaputhujjanānanti vuttaṃ hoti.

AI Translation based on Nissaya

Among the two types of worldlings mentioned, 'of the virtuous worldlings' refers to those who, by associating with wholesome qualities, have transcended the state of a blind worldling and are established in the state of a virtuous worldling. Thus it is said, 'of the virtuous worldlings'.

Vietnamese AI Translation

Trong hai loại phàm phu được đề cập, 'của những phàm phu hiền thiện' đề cập đến những người, bằng cách kết giao với các thiện pháp, đã vượt qua trạng thái của một phàm phu mù quáng và an trú trong trạng thái của một phàm phu hiền thiện. Do đó, được nói là, 'của những phàm phu hiền thiện'.

AI Translation Nissaya

vuttaputhujjanadvaye=In the pair of worldlings mentioned. ; vā=or among the group. ; kalyāṇadhammasamāgamena=by association with good qualities (dhamma). ; andhaputhujjanabhāvaṃ=the state of being a blind worldling. ; atikkamma=having transcended. ; kalyāṇaputhujjanabhāve=in the state of a virtuous worldling. ; ṭhitānaṃ=of those who are established. ; puthujjanakalyāṇakānaṃ=of the virtuous worldlings. ; kalyāṇa puthujjanānaṃ=of the virtuous worldlings. ; iti=thus. ; vuttaṃ vutto=it is said. ; hoti=is. ;

Myanmar Nissaya

vuttaputhujjanadvaye=ဆိုအပ်ပြီးသော ပုထုဇဉ်နှစ်ယောက်တို့၏ အပေါင်း၌။ ; vā=အပေါင်းတွင်။ ; kalyāṇadhammasamāgamena=ကောင်းသော တရားနှင့် ပေါင်းမိသောအားဖြင့်။ ; andhaputhujjanabhāvaṃ=၏ အဖြစ်ကို။ ; atikkamma=လွန်၍။ ; kalyāṇaputhujjanabhāve=၏အဖြစ်၌။ ; ṭhitānaṃ=ကုန်သော။ ; puthujjanakalyāṇakānaṃ=တို့၏။ ; kalyāṇa puthujjanānaṃ=တို့၏။ ; iti=သို့။ ; vuttaṃ vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3736 | Chunk: 63

Puthujjanesu vā kalyāṇakānaṃ puthujjanakalyāṇakānaṃ.

AI Translation based on Nissaya

Or, it means 'of the virtuous ones among the worldlings' (puthujjanakalyāṇakānaṃ).

Vietnamese AI Translation

Hoặc, nó có nghĩa là 'của những người hiền thiện trong số các phàm phu' (puthujjanakalyāṇakānaṃ).

AI Translation Nissaya

Meaning of the verse. ; anto=The blind. ; puthujjano=worldling. ; eko=is one. ; kalyāṇo=the virtuous. ; puthujjano=worldling. ; eko=is one. ; iti=Thus. ; puthujjane=worldlings. ; duve=two. ; ādiccabandhunā=by the kinsman of the sun. ; buddhena=by the Buddha. ; vuttā=were spoken of. ; vā=Or. ; puthujjanesu=among worldlings. ; kalyāṇakānaṃ=of the virtuous ones. ; puthujjanakalyāṇakānaṃ=of the virtuous among worldlings. ;

Myanmar Nissaya

ဂါထာအနက်။ ။ ; anto=ကုန်သော။ ; puthujjano=ပုထုဇဉ်သည်။ ; eko=တစ်ယောက်။ ; kalyāṇo=ကောင်းသော။ ; puthujjano=သည်။ ; eko=တစ်ယောက်။ ; iti=သို့။ ; puthujjane=တို့ကို။ ; duve=တို့ဟူ၍။ ; ādiccabandhunā=နေမင်း ၏ အဆွေဖြစ်တော်မူသော။ ; buddhena=သည်။ ; vuttā=ကုန်၏။ ; vā=ကား။ ; puthujjanesu=တို့တွင်။ ; kalyāṇakānaṃ=ကောင်းကုန်သော ပုဂ္ဂိုလ်တို့၏။ ; puthujjanakalyāṇakānaṃ=ပုထုဇဉ်တို့တွင် ကောင်းကုန်သော ပုဂ္ဂိုလ်တို့၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3737 | Chunk: 63

Kusaladhamme yuttānan ti ettha kusala saddo tāva ārogyānavajjachekasukhavipākesu dissati.

AI Translation based on Nissaya

Here, in the phrase **'devoted to wholesome qualities'**, the word **'kusala'** is first seen in the meanings of health, blamelessness, skillfulness, and having a happy result.

Vietnamese AI Translation

Ở đây, trong cụm từ **'chuyên tâm vào các thiện pháp'**, từ **'kusala'** trước tiên được thấy trong các ý nghĩa là khỏe mạnh, không đáng chê trách, thiện xảo, và có kết quả hạnh phúc.

AI Translation Nissaya

kusaladhamme yuttā nantiettha=Here in this phrase 'devoted to the wholesome Dhamma'. ; samābhiniviṭṭho=intent upon. ; kusalasaddo=the word 'kusala'. ; vā=or. ; tāva=firstly. ; ārogyanavajjachekasukhavipākesu=in the meanings of health, blamelessness, skillfulness, and having a happy result. ; dissati=is seen. ; vā=is observed. ; vā=is noted. ;

Myanmar Nissaya

kusaladhamme yuttā nantiettha=ဟူသော ဤပုဒ်၌။ ; samābhiniviṭṭho=ဝင်သော။ ; kusalasaddo=သည်။ ; vā=ကို။ ; tāva=လက်မွန်။ ; ārogyanavajjachekasukhavipākesu=အနာမရှိခြင်းဟူသော အနက် အပြစ်မရှိခြင်းဟူသော အနက် လိမ္မာခြင်းဟူသော အနက် ချမ်းသာသော အကျိုးကို ပေးခြင်းဟူသော အနက်တို့၌။ ; dissati=ထင်၏။ ; vā=ရှုအပ်၏။ ; vā=မှတ်အပ်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3738 | Chunk: 63

Ayañhi ‘‘kacci nu bhoto kusalaṃ, kacci bhoto anāmayan’’ tiādīsu ( jā. 1.15.146;2.20.129) ārogye dissati.

AI Translation based on Nissaya

Indeed, this word is seen in the sense of health in passages such as: 'I hope you are well, I hope you are healthy?' (jā.1.15.146; 2.20.129).

Vietnamese AI Translation

Thật vậy, từ này được thấy theo nghĩa khỏe mạnh trong các đoạn như: 'Tôi hy vọng ngài được an ổn, tôi hy vọng ngài được khỏe mạnh?' (jā.1.15.146; 2.20.129).

AI Translation Nissaya

hisaccaṃ=Indeed. ; ayaṃ kusalasaddo=this word 'kusala'. ; kaccinu.la. anāmayantiādīsu=in such (phrases) as 'kacci nu...anāmayaṃ'. ; ārogya=in the meaning of health. ; vā=or in the meaning of the state of being. ; dissati=is seen. ; bhoto=for you, oh King of Bārāṇasī. ; kaccinu=I hope that. ; kusalā=you are well (free from illness). ; kacci=I hope that. ; bhoto=for you. ; anāmayaṃ=there is health (freedom from illness). ; (vīsatinipāta=Cūḷahaṃsa Jātaka Commentary.) ;

Myanmar Nissaya

hisaccaṃ=၏။ ; ayaṃ kusalasaddo=သည်။ ; kaccinu.la. anāmayantiādīsu=တို့၌။ ; ārogya=အနက်၌။ ; vā=သည်၏ အဖြစ်တည်းဟူသော အနက်၌။ ; dissati=ထင်၏။ ; bhoto=အရှင်ဗာရာဏသီမင်းကြီးအား။ ; kaccinu=အသို့နည်း။ ; kusalā=အနာကင်းပါး၏လော။ ; kacci=အသို့နည်း။ ; bhoto=အား။ ; anāmayaṃ=အနာကင်းပါ၏လော။ ; (vīsatinipāta=စူဠဟံသဇာတ် အဋ္ဌကထာ။) ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3739 | Chunk: 63

‘‘Katamo pana, bhante, kāyasamācāro kusalo ?

AI Translation based on Nissaya

“But which, venerable sir, is wholesome bodily conduct?

Vietnamese AI Translation

“Nhưng bạch đại vương, thế nào là thiện hạnh về thân?

AI Translation Nissaya

katamo pana.la. anavajjotica=and in 'Which, venerable sir... blameless?'. ;

Myanmar Nissaya

katamo pana.la. anavajjotica=ဟူ၍လည်းကောင်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3740 | Chunk: 63

Yo kho, mahārāja, kāyasamācāro anavajjo’’ ti ( ma. ni. 2.361) ca ‘‘puna caparaṃ, bhante, etadānuttariyaṃ yathā bhagavā dhammaṃ deseti kusalesu dhammesū’’ ti ca ( dī. ni. 3.145) evamādīsu anavajje.

AI Translation based on Nissaya

Whatever bodily conduct, great king, is blameless’ (ma. ni. 2.361) and ‘Furthermore, venerable sir, this is a supreme matter, that the Blessed One teaches the Dhamma in regard to wholesome states’ (dī. ni. 3.145), and in other such passages, it is used in the sense of ‘blameless’.

Vietnamese AI Translation

Bất cứ hành vi nào về thân, hỡi đại vương, không đáng chê trách’ (ma. ni. 2.361) và ‘Hơn nữa, bạch Ngài, đây là một vấn đề tối cao, rằng Đức Thế Tôn thuyết giảng Giáo pháp liên quan đến các thiện pháp’ (dī. ni. 3.145), và trong các đoạn khác như vậy, nó được dùng với nghĩa ‘không đáng chê trách’.

AI Translation Nissaya

puna ca paraṃ.la. dhammesūtica=and in 'Furthermore... in wholesome states', and so on. ; evamādīsu=in such passages. ; anavajje=in the meaning of 'blameless'. ; dissati=it is seen. ; bhante=Venerable sir Ānanda. ; katamo=which. ; kāyasamācāropana=bodily conduct. ; kusalo=is wholesome (blameless)? ; mahārāja=Great King Kosala. ; kho=indeed. ; yo kāyasamācāro=whatever bodily conduct. ; anāvajjo=is blameless. ; (majjhimapaṇṇāsa=Bāhitika Sutta Pāḷi.) ; bhante=Venerable Sir. ; puna=again. ; paraṃca=and furthermore. ; yathā=in which way. ; kusalesu=in wholesome. ; dhammesu=states. ; anuttariyaṃ=unsurpassed. ; etaṃ dhammaṃ=this Dhamma. ; bhagavā=the Blessed One. ; deseti=teaches. ; (Pātheyyavagga, Sampasādanīya Sutta Pāḷi.) ;

Myanmar Nissaya

puna ca paraṃ.la. dhammesūtica=ဟူ၍လည်းကောင်း။ ; evamādīsu=တို့၌။ ; anavajje=အပြစ်မရှိခြင်းဟူသော အနက်၌။ ; dissati=ထင်၏။ ; bhante=အရှင်ဘုရား အာနန္ဒာ။ ; katamo=မည်သော။ ; kāyasamācāropana=ကိုယ်အကျင့်သည်ကား။ ; kusalo=အပြစ်မရှိပါသနည်း။ ; mahārāja=ကောသလမင်းကြီ။ ; kho=စင်စစ်။ ; yo kāyasamācāro=အကြင်ကိုယ် အကျင့်သည်။ ; anāvajjo=အပြစ်မရှိ။ ; (majjhimapaṇṇāsa=ဗာဟိတိကသုတ်ပါဠိ။) ; bhante=ဘုန်းတော်ကြီးတော်မူသော မြတ်စွာဘုရား။ ; puna=ဖန်။ ; paraṃca=တစ်ပါးလည်း။ ; yathā=အကြင်အခြင်း အရာအားဖြင့်။ ; kusalesu=ကုန်သော။ ; dhammesu=တို့၌။ ; anuttariyaṃ=သော။ ; etaṃ dhammaṃ=ကို။ ; bhagavā=သည်။ ; deseti=မူ၏။ ; (ပါထေယျဝဂ်၊ သမ္မသာဒနီယသုတ်ပါဠိ။) ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3741 | Chunk: 63

‘‘Kusalo tvaṃ rathassa aṅgapaccaṅgānaṃ ( ma. ni. 2.87), kusalā naccagītassa sikkhitā cāturitthiyo’’ tiādīsu ( jā. 2.22.94) cheke.

AI Translation based on Nissaya

In passages such as, 'You are skilled in the parts and accessories of a chariot' (ma. ni. 2.87), and 'four graceful, trained women, skilled in dancing and singing' (jā. 2.22.94), it is used in the sense of 'skillful'.

Vietnamese AI Translation

Trong các đoạn như, 'Ngài thật thiện xảo về các bộ phận và phụ tùng của xe ngựa' (ma. ni. 2.87), và 'bốn người phụ nữ duyên dáng, được huấn luyện, thiện xảo trong vũ điệu và ca hát' (jā. 2.22.94), nó được dùng với nghĩa 'thiện xảo'.

AI Translation Nissaya

kusalo tvaṃ.la. cāturitthiyotiādīsu=in such (passages) as 'You are skilled... four women'. ; cheke=in the sense of 'skillful'. ; dissati=it is seen. ; tvaṃ=You, Prince Abhaya. ; rathassa=of a chariot. ; aṅgapaccaṅgānaṃ=in its parts and accessories. ; kusalo=are skilled. ; (majjhimapaṇṇāsa=Abhayarājakumāra Sutta Pāḷi.) ; naccagītassa=of dancing and singing. ; visesesu=in the special aspects. ; kusalā=skilled. ; sikkhitā=trained. ; cāturitthiyo=four women endowed with grace. ; vā=or four women. ; (Temiya Jātaka Pāḷi Commentary). ;

Myanmar Nissaya

kusalo tvaṃ.la. cāturitthiyotiādīsu=တို့၌။ ; cheke=လိမ္မာခြင်းဟူသော အနက်၌။ ; dissati=၏။ ; tvaṃ=သင်အဘယမင်းသားသည်။ ; rathassa=ရထား၏။ ; aṅgapaccaṅgānaṃ=တို့၌။ ; kusalo=လိမ္မာ၏။ ; (majjhimapaṇṇāsa=အဘယရာဇကုမာရသုတ်ပါဠိ။) ; naccagītassa=ကခြင်း သိခြင်း၏။ ; visesesu=အထူးတို့၌။ ; kusalā=ကုန်သော။ ; sikkhitā=သင်အပ်ပြီးသော အတတ်ရှိကုန်သော။ ; cāturitthiyo=လေးပါးသော တင့်တယ်စံပယ်ခြင်းနှင့် ပြည့်စုံကုန်သော မိန်းမတို့သည်။ ; vā=လေးယောက်သော မိန်းမတို့သည်။ ; (တေမိဇာတ် ပါဠိအဋ္ဌကထာ)။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3742 | Chunk: 63

‘‘Kusalānaṃ, bhikkhave, dhammānaṃ samādānahetu ( dī. ni. 3.80).

AI Translation based on Nissaya

‘Because of undertaking wholesome qualities, bhikkhus,... (dī. ni. 3.80).

Vietnamese AI Translation

‘Vì đã thực hành các thiện pháp, này các Tỳ khưu,... (dī. ni. 3.80).

AI Translation Nissaya

kusalānaṃ.la.= ;

Myanmar Nissaya

kusalānaṃ.la.= ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3743 | Chunk: 63

Kusalassa kammassa katattā upacitattā’’ tiādīsu ( dha. sa. 431) sukhavipāke.

AI Translation based on Nissaya

Because wholesome kamma has been done and accumulated...’ (dha. sa. 431), and in other such passages, it is used in the sense of 'having a happy result'.

Vietnamese AI Translation

Vì nghiệp thiện đã được làm và tích lũy...’ (dha. sa. 431), và trong các đoạn khác như vậy, nó được dùng với nghĩa 'có kết quả hạnh phúc'.

AI Translation Nissaya

upacitattātiādīsu=in such (passages) as '...having been accumulated'. ; sukhavipāke=in the sense of 'having a happy result'. ; dissati=it is seen. ; bhikkhave=O bhikkhus. ; kusalānaṃ=of wholesome qualities that give good results. ; dhammānaṃ=of states. ; samādānahetu=because of undertaking. ; (Pātheyyavagga, Cakkavatti Sutta Pāḷi.) ; kusalassa=of wholesome. ; kammassa=kamma which gives a good result. ; vā=or. ; katattā=because of having been done. ; upacitattā=because of having been accumulated. ; (dhammasaṅgaṇīpāḷi=Abyākatapadaniddesa). ;

Myanmar Nissaya

upacitattātiādīsu=တို့၌။ ; sukhavipāke=ချမ်းသာသော အကျိုးကို ပေးခြင်းဟူသော အနက်၌။ ; dissati=၏။ ; bhikkhave=တို့။ ; kusalānaṃ=ကောင်းသော အကျိုးကို ပေးတတ်ကုန်သော။ ; dhammānaṃ=တို့ကို။ ; samādānahetu=ကြောင်းကြောင့်။ ; (ပါထေယျဝဂ်၊ စက္ကဝတ္တိသုတိပါဠိ။) ; kusalassa=ကေင်းသော အကျိုးကို ပေးတတ်သော။ ; kammassa=ကံ၏။ ; vā=ကို။ ; katattā=ကြောင့်။ ; upacitattā=ကြောင့်။ ; (dhammasaṅgaṇīpāḷi=အဗျာကတပဒနိဒ္ဒေသ)။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3744 | Chunk: 63

Svāyamidha ārogyepi anavajjepi sukhavipākepi vaṭṭati.

AI Translation based on Nissaya

Here, this word is applicable in the sense of health, blamelessness, and having a happy result.

Vietnamese AI Translation

Ở đây, từ này có thể áp dụng theo nghĩa khỏe mạnh, không đáng chê trách, và có kết quả hạnh phúc.

AI Translation Nissaya

svāyaṃ so ayaṃ kusalasaddo=This word 'kusala'. ; idha=here. ; kārogyepi=in the sense of health. ; anavajjepi=in the sense of blamelessness. ; sukhavipākepi=in the sense of having a happy result. ; sukhavipākepi=in the sense of having a happy result. ; vaṭṭati=is applicable. ;

Myanmar Nissaya

svāyaṃ so ayaṃ kusalasaddo=သည်။ ; idha=ဤအရာ၌။ ; kārogyepi=၌လည်းကောင်း။ ; anavajjepi=၌လည်းကောင်း။ ; sukhavipākepi=၌လည်းကောင်း။ ; sukhavipākepi=၌လည်းကောင်း။ ; vaṭṭati=သင့်မြတ်ပါသတည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3745 | Chunk: 63

Vacanattho panettha kucchite pāpake dhamme salayanti calayanti kampenti viddhaṃsentīti kusalā.

AI Translation based on Nissaya

As for its etymology, it should be understood as follows: they shake, stir, make tremble, and destroy despicable, evil states, thus they are 'kusala'. They cause them to move by temporary abandonment, they make them tremble by suppression, and they destroy them by eradication.

Vietnamese AI Translation

Về từ nguyên của nó, cần được hiểu như sau: chúng làm lay động, khuấy đảo, làm rung chuyển, và hủy diệt các pháp ác, hèn hạ, do đó chúng là 'kusala'. Chúng làm cho các pháp ác di chuyển bằng cách tạm thời từ bỏ, làm chúng run rẩy bằng cách đè nén, và hủy diệt chúng bằng cách đoạn trừ.

AI Translation Nissaya

pana=Now as for the word's meaning. ; ettha=in this word 'kusala'. ; vacanattho=the meaning of the word. ; evaṃ=should be known in the following way. ; veditabbo=should be known. ; kucchite=despicable. ; pāpake=evil. ; dhamme=unwholesome states. ; salayanti calayanti kampenti viddhaṃsenti=they shake, stir, make tremble, and destroy. ; tanaññaḥ= ; salayanti, calayanti=they cause to move by temporary abandonment. ; salayanti- kampenti=they cause to tremble by suppression. ; salayanti viddhaṃsenti=they destroy by cutting off at the root. ; iti tasmā=therefore. ; kusalā=they are called 'kusala'. ;

Myanmar Nissaya

pana=ဝစနတ္ထကိုဆိုဦးအံ့။ ; ettha=ဤကုသလသဒ္ဒါ၌။ ; vacanattho=ကို။ ; evaṃ=ဤဆိုလတ္တံံသောနည်းဖြင့်။ ; veditabbo=၏။ ; kucchite=စက်ဆုပ်အပ်ကုန်သေုာ။ ; pāpake=ကုန်သော။ ; dhamme=အကုသိုလ်တရားတို့ကို။ ; salayanti calayanti kampenti viddhaṃsenti=ဖျက်ဆီး တတ်ကုန်၏။ ; tanaññaḥ= ; salayanti, calayanti=တဒင်္ဂပဟာန်ဖြင့် ရွေ့ရှာစေတတ်၏။ ; salayanti- kampenti=ဝိက္ခမ္ဘနပဟာန်ဖြင့် တုန်လှုပ်စေတတ်ကုန်၏။ ; salayanti viddhaṃsenti=သမုစ္ဆေဒပဟာန်ဖြင့် ဖျက်ဆီးတတ်ကုန်၏။ ; iti tasmā=ကြောင့်။ ; kusalā=မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3746 | Chunk: 63

Kucchitena vā ākārena sayanti pavattantīti kusā, te kuse lunanti chindantīti kusalā.

AI Translation based on Nissaya

Or, because they proceed in a despicable manner, they are called 'kusa' (unwholesome states); because they cut off those 'kusa', they are called 'kusala'.

Vietnamese AI Translation

Hoặc, vì chúng tiến hành một cách hèn hạ, chúng được gọi là 'kusa' (các pháp bất thiện); vì chúng cắt đứt những 'kusa' đó, chúng được gọi là 'kusala'.

AI Translation Nissaya

vā=Or. ; kucchitena=in a despicable. ; ākārena=manner. ; salayanti pavattanti=they move or proceed. ; ititasmā=therefore. ; kusā=they are called 'kusa'. ; te kuse=those 'kusa'. ; lunanti chindanti=they cut or sever. ; iti tasmā=therefore. ; kusalā=they are called 'kusala'. ;

Myanmar Nissaya

vā=ကား။ ; kucchitena=စက်ဆုပ်အပ်သော။ ; ākārena=ဖြင့်။ ; salayanti pavattanti=ဖြစ်တတ်ကုန်၏။ ; ititasmā=ကြောင့်။ ; kusā=မည်ကုန်၏။ ; te kuse=တို့ကို။ ; lunanti chindanti=ဖြစ်တတ်ကုန်၏။ ; iti tasmā=ကြောင့်။ ; kusalā=မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3747 | Chunk: 63

Kucchitānaṃ vā sānato tanukaraṇato kusaṃ ñāṇaṃ.

AI Translation based on Nissaya

Or, knowledge (ñāṇa) is called 'kusa' because it attenuates despicable things.

Vietnamese AI Translation

Hoặc, trí tuệ (ñāṇa) được gọi là 'kusa' bởi vì nó làm suy yếu những điều hèn hạ.

AI Translation Nissaya

vā=Or. ; kucchitanaṃ=of despicable, unwholesome states. ; sanato tanukaraṇato=because it thins them out or attenuates them. ; kusaṃ=is called 'kusa'. ; ñāṇaṃ=knowledge. ; labhati=is obtained. ;

Myanmar Nissaya

vā=ကား။ ; kucchitanaṃ=စက်ဆုပ်အပ်ကနု်သော အကုသိုလ်တရားတို့ကို။ ; sanato tanukaraṇato=ခေါင်းပါးခြင်းကို ပြုတတ်သောကြောင့်။ ; kusaṃ=မည်၏။ ; ñāṇaṃ=ဉာဏ်ကို။ ; labhati=ရ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3748 | Chunk: 63

Tena kusena lātabbā gahetabbā [P1.206] pavattetabbāti kusalā, yathā vā kusā ubhayabhāgagataṃ hatthappadesaṃ lunanti, evamimepi uppannānuppannabhāvena ubhayabhāgagataṃ saṃkilesapakkhaṃ lunanti, tasmā kusā viya lunantīti kusalā.

AI Translation based on Nissaya

Because they are to be obtained by that 'kusa' (knowledge), they are called 'kusala'. Or, just as kusa grass cuts the hand that holds it on both sides, so too do these wholesome states cut off the faction of defilements that exists on both sides—the arisen and the unarisen. Therefore, because they cut like kusa grass, they are called 'kusala'.

Vietnamese AI Translation

Bởi vì chúng được đạt đến bởi 'kusa' (trí tuệ) đó, chúng được gọi là 'kusala'. Hoặc, cũng như cỏ kusa cắt tay người cầm nó ở cả hai bên, thì những thiện pháp này cũng cắt đứt phe phái phiền não tồn tại ở cả hai bên—đã sinh và chưa sinh. Do đó, vì chúng cắt như cỏ kusa, chúng được gọi là 'kusala'.

AI Translation Nissaya

kusena=by that which is named 'kusa'. ; tena=by that knowledge. ; lāta tabbā gahetabbā pavattetabbā=they are to be obtained, grasped, and made to arise. ; ititasmā=therefore. ; kusalā=they are called 'kusala'. ; vā=Or. ; kusā=as kusa grass. ; ubhayabhāgagataṃ=which is held on both sides. ; hatthappadesaṃ=the hand. ; lunanti yathā=cuts. ; evaṃtathā=just so. ; imesu=these wholesome states. ; uppannānuppannabhāvena=by way of arisen and unarisen unwholesome states. ; ubhayabhāgagataṃ=which exists on both sides. ; saṃkilesapakkhaṃ=the faction of defilements. ; lunanti=they cut off. ; tasmā=therefore. ; kusalā=they are called 'kusala'. ;

Myanmar Nissaya

kusena=ကုသအမည်ရှိသော။ ; tena=ထိုဉာဏ်ဖြင့်။ ; lāta tabbā gahetabbā pavattetabbā=ဖြစ်စေတတ်ကုန်၏။ ; ititasmā=ကြောင့်။ ; kusalā=မည်ကုန်၏။ ; vā=ကား။ ; kusā=သမန်းမြက်တို့သည်။ ; ubhayabhāgagataṃ=နှစ်သက်သော အဖို့၌တည်သော။ ; hatthappadesaṃ=လက်အရပ်ကို။ ; lunanti yathā=ဖြစ်ကုန် ရှကုန်သကဲ့သို့။ ; evaṃtathā=ထို့အတူ။ ; imesu=ဤကုသိုလ်တရားတို့သည်လည်း။ ; uppannānuppannabhāvena=ဖြစ်ပြီးသော အကုသိုလ်, မဖြစ်သေးသောအကုသိုလ်တို့၏ အဖြစ်ဖြင့်။ ; ubhayabhāgagataṃ=နှစ်ဘက်သော အဖို့၌တည်သော။ ; saṃkilesapakkhaṃ=ကိလေသာအဖို့ကို။ ; lunanti=ဖျက်ဆီးတတ်ကုန်၏။ ; tasmā=ကြောင့်။ ; kusalā=မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3749 | Chunk: 63

Apica ārogyaṭṭhena anavajjaṭṭhena kosallasambhūtaṭṭhena vā kusalā.

AI Translation based on Nissaya

Furthermore, they are 'kusala' in the sense of being healthy, in the sense of being blameless, or in the sense of being born of skillfulness.

Vietnamese AI Translation

Hơn nữa, chúng là 'kusala' theo nghĩa là lành mạnh, theo nghĩa là không đáng chê trách, hoặc theo nghĩa là được sinh ra từ sự thiện xảo.

AI Translation Nissaya

apica=Furthermore. ; ārogyaṭṭhena=because of the meaning of being free from illness. ; anavajjaṭṭhena=because of the meaning of being blameless. ; losallasambhūtaṭṭhenavā=or because of the meaning of being produced by skillfulness. ; kusalā=they are called 'kusala'. ;

Myanmar Nissaya

apica=တနည်းလည်း။ ; ārogyaṭṭhena=အနာမရှိသည်၏ အဖြစ်တည်းဟူသော အနက်ကြောင့်လည်းကောငး်။ ; anavajjaṭṭhena=အပြစ်မရှိသည်၏ အဖြစ်ကြောင့်လည်းကောင်း။ ; losallasambhūtaṭṭhenavā=လိမ္မာသော သူ၏ အဖြစ်ကို ဖြစ်စေတတ်သော အနက်ကြောင့် လည်းကောင်း။ ; kusalā=မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3750 | Chunk: 63

Idha pana yasmā vipassanākusalameva adhippetaṃ, tasmā sese vihāya tasseva dassanatthaṃ ‘‘kusaladhamme’’ ti ekavacanaṃ katanti veditabbaṃ.

AI Translation based on Nissaya

However, here, since only the wholesome (kusala) of insight is intended, it should be understood that, leaving aside the others (virtue and concentration), the singular form 'kusaladhamme' is used in order to show only that wholesome state of insight.

Vietnamese AI Translation

Tuy nhiên, ở đây, vì chỉ có thiện pháp (kusala) của tuệ quán được nhắm đến, cần hiểu rằng, bỏ qua các pháp khác (giới và định), hình thức số ít 'kusaladhamme' được sử dụng để chỉ riêng trạng thái thiện pháp của tuệ quán đó.

AI Translation Nissaya

pana=Now, to state the intended meaning. ; idha=here. ; yasmā=because. ; vipassanākusalameva=only wholesome (kusalā) associated with insight. ; adhippetaṃ=is intended. ; tasmā=therefore. ; sese=the remaining (types), virtue and concentration, which are other than insight-wholesomeness. ; vihāya=leaving aside. ; tasseva=only that insight-wholesomeness. ; dassanatthaṃ=in order to show. ; kusaladhammeti=as 'kusaladhamme'. ; ekavacanaṃ=the singular locative case ending. ; kataṃ=was made. ; iti=thus. ; veditabbaṃ=should be known. ;

Myanmar Nissaya

pana=ဣစ္ဆိတတ္ထကို ဆိုအံ့။ ; idha=ဤအရာ၌။ ; yasmā=ကြောင့်။ ; vipassanākusalameva=ဝိပဿနာနှင့် ယှဉ်သော ကုသိုလ်ကိုသာလျှင်။ ; adhippetaṃ=အပ်၏။ ; tasmā=ကြောင့်။ ; sese=ဝိပဿနာကုသိုလ်မှ ကြွင်းကုန်သော သီလသမာဓိတို့ကို။ ; vihāya=စွန့်၍။ ; tasseva=ထိုဝိပဿနာကုသိုလ်ကိုသာလျှင်။ ; dassanatthaṃ=ငှာ။ ; kusaladhammeti=ဟူ၍။ ; ekavacanaṃ=သတ္တမီဧကဝုစ် ဝိဘတ်ကို။ ; kataṃ=အပ်၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3751 | Chunk: 63

Vipassanākusaladhamme sātaccakiriyatāya sakkaccakāritāya ca yuttānanti attho.

AI Translation based on Nissaya

The meaning is: 'of those persons who are engaged' in the wholesome quality of insight with continuous and respectful effort.

Vietnamese AI Translation

Ý nghĩa là: 'của những người đang thực hành' thiện pháp của tuệ quán với nỗ lực liên tục và tôn kính.

AI Translation Nissaya

vipassanākusaladhamme=in the wholesome quality associated with insight. ; sākaccakiriyatāya=because of the state of being done constantly. ; sakkaccakāritāyaca=and because of the state of being done respectfully. ; yuttānaṃ=of those persons who are engaged. ; itiayaṃ=this is. ; attho=the meaning. ; (The explanation of the word 'sekkha' is the same as the explanation of 'sekkhati'; it agrees with the Aṭṭhasālinī commentary.) ;

Myanmar Nissaya

vipassanākusaladhamme=ဝိပဿနာနှင့်ယှဉ်သော ကုသိုလ်တရား၌။ ; sākaccakiriyatāya=မပြတ်ပြုသည်၏ အဖြစ်ကြောင့် လည်းကောင်း။ ; sakkaccakāritāyaca=အရိုအသေ ပြုသည်၏ အဖြစ်ကြောင့်လည်းကောင်း။ ; yuttānaṃ=အားထုတ်အပ်ကုန်သော ပုဂ္ဂိုလ်တို့၏။ ; itiayaṃ=ကား။ ; attho=တည်း။ ; (သေက္ခာ ဟူသော ပုဒ်အဖွင့်သည် သေက္ခတိက်အဖွင့်၊ အဋ္ဌသာလိနီအဋ္ဌကထာနှင့်ညီ၏။) ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3752 | Chunk: 63

Sekkhapariyante paripūrakārīnan ti ettha tīsu sikkhāsu jātātipi sekkhā, sattannaṃ sekkhānaṃ etetipi sekkhā, sayameva sikkhantītipi sekkhā [M1.190].

AI Translation based on Nissaya

Here in the phrase **'those who are fulfilling at the limit of the learner's training'**: they are born in the three trainings, thus they are 'learners' (sekkhā); they are the properties of the seven learners, thus they are 'sekkha'; they themselves are still training, thus they are 'sekkha' [M1.190].

Vietnamese AI Translation

Ở đây trong cụm từ **'những người đang hoàn thiện ở giới hạn của sự học tập của bậc hữu học'**: họ được sinh ra trong ba học, do đó họ là 'hữu học' (sekkhā); chúng là các thuộc tính của bảy bậc hữu học, do đó chúng là 'sekkha'; bản thân họ vẫn đang học, do đó họ là 'sekkha' [M1.190].

AI Translation Nissaya

sekkhapariyante paripūrakārīnanti ettha=Here in the phrase 'those who are fulfilling at the limit of the learner's training'. ; (attho=the meaning. ; evaṃ=thus. ; veditabbo=should be known.) ; tīsu=in the three. ; sikkhāsu=trainings of higher virtue, etc. ; jātā=they are born. ; ititasmā=therefore also. ; sekkhā=they are called learners (sekkha). ; (They attain the states associated with the training.) ; sattannaṃ=of the seven. ; sekkhānaṃ=learners. ; ete=these are the properties. ; iti tasmāpi=therefore also. ; sekkhā=they are called 'sekkha'. ; sayameva=they themselves, that is, the four paths and lower fruits. ; sikkhanti=are still training. ; ivi tasmāpi=therefore also. ; sekkhā=they are called 'sekkha'. ; (They attain the three trainings starting with higher virtue.) ;

Myanmar Nissaya

sekkhapariyante paripūrakārīnanti ettha=ဟူသော ပုဒ်၌။ ; (attho=ကို။ ; evaṃ=သို့။ ; veditabbo=၏။) ; tīsu=ကုန်သော။ ; sikkhāsu=အဓိသီလသိက္ခာတို့၌။ ; jātā=ဖြစ်ကုန်သည်တို့တည်း။ ; ititasmā=ကြောင့်လည်း။ ; sekkhā=မည်ကုန်ဩ။ ; (သိက္ခာနှင့် ယှဉ်သော တရားကိုရစေ။) ; sattannaṃ=ကုန်သော။ ; sekkhānaṃ=သေက္ခာ ပုဂ္ဂိုလ်တို့၏။ ; ete=ဥစ္စာတို့တည်း။ ; iti tasmāpi=ကြောင့်လည်း။ ; sekkhā=မည်ကုန်၏။ ; sayameva=မိမိဟု ဆိုအပ်သော မဂ်လေးပါး အောက်ဖိုလ်တို့ သည်ပင်လျှင်။ ; sikkhanti=ကျင့်ဆဲဖြစ်ကုန်၏။ ; ivi tasmāpi=ကြောင့်လည်း။ ; sekkhā=မည်ကုန်၏။ ; (အဓိသီလ စသော သိက္ခာသုံးပါးကိုရစေ။) ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3753 | Chunk: 63

Sotāpattimaggaphalasakadāgāmimaggaphalaanāgāmimaggaphalaarahattamaggadhammā [V1.174].

AI Translation based on Nissaya

They obtain the states of the path and fruit of stream-entry, the path and fruit of once-returning, the path and fruit of non-returning, and the path of Arahantship [V1.174].

Vietnamese AI Translation

Họ đạt được các trạng thái đạo và quả của nhập lưu, đạo và quả của nhất lai, đạo và quả của bất lai, và đạo A-la-hán [V1.174].

AI Translation Nissaya

sotāpattimaggaphalasakadāgāmimaggaphalaanāgāmimaggaphala arahattamaggadhammā=the states of the path and fruit of stream-entry, the path and fruit of once-returning, the path and fruit of non-returning, and the path of arahantship. ; labhanti=they obtain. ;

Myanmar Nissaya

sotāpattimaggaphalasakadāgāmimaggaphalaanāgāmimaggaphala arahattamaggadhammā=သောတာပတ္တိမဂ် သောတာပတ္တိဖိုလ် သကဒါဂါမိမဂ် သကဓါဂါမိဖိုလ် အနာဂါမိမဂ် အနာဂါမိဖိုလ် အရဟတ္ထမဂ် တရားတို့ကို။ ; labhanti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3754 | Chunk: 63

Te sekkhā dhammā pariyante avasāne etassa, te vā sekkhā dhammā pariyanto paricchedo etassāti sekkhapariyanto.

AI Translation based on Nissaya

These learner's states are at the end (pariyanta) of this practice, or these learner's states are the boundary (pariyanta) for this practice; thus it is called 'sekkhapariyanta' (the limit of the learner).

Vietnamese AI Translation

Những trạng thái hữu học này ở cuối (pariyanta) của sự thực hành này, hoặc những trạng thái hữu học này là ranh giới (pariyanta) cho sự thực hành này; do đó nó được gọi là 'sekkhapariyanta' (giới hạn của bậc hữu học).

AI Translation Nissaya

etassa=of that practice fulfilled by those worldlings. ; pariyante avasāne=at the end. ; tanaññaḥ= ; etassa=that practice fulfilled by those worldlings. ; pariyante avasāne=at the end of practicing it. ; sekkhā=which are the property of the seven types of learners. ; te dhammā=those states. ; jāyanti=arise. ; iti tasmā=therefore. ; sekkhapariyanto=it is called 'sekkhapariyanta' (having the learner's states at its limit). ; vā=Or. ; etassa=for that practice fulfilled by those worldlings. ; sekkhā=because they are the property of the seven types of learners. ; sekkhapariyanto=it is called 'sekkhapariyanta' (having the learner's states as its limit). ;

Myanmar Nissaya

etassa=ထိုပုထုဇဉ်တို့ သည်ဖြည့်ကျင့်အပ်သော တရား၏။ ; pariyante avasāne=အဆုံးဂ၌။ ; tanaññaḥ= ; etassa=ထိုပုထုဇဉ်တို့၏ ဖြည့်ကျင့်သော တရားကို။ ; pariyante avasāne=မှီဝဲသည်၏ အဆုံး၌။ ; sekkhā=သေက္ခာပုဂ္ဂိုလ်ခုနစ်ယောက်တို့၏ ဥစ္စာဖြစ်ကုန်သော။ ; te dhammā=ထိုတရားတို့သည်။ ; jāyanti=ဖြစ်ကုန်၏။ ; iti tasmā=ကြောင့်။ ; sekkhapariyanto=မည်၏။ ; vā=ကား။ ; etassa=ထိုပုထုဇဉ် တို့သည် ဖြည့်ကျင့်အပ်သော တရားအား။ ; sekkhā=သေက္ခာပုဂ္ဂိုလ်ခုနစ်ယောက်တို့၏ ဥစ္စာဖြစ်ကုန်ကြောင့်။ ; sekkhapariyanto=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3755 | Chunk: 63

Tasmiṃ sekkhapariyante dhammeti sambandho.

AI Translation based on Nissaya

The connection is with the phrase 'in that Dhamma which is the limit of the learner'.

Vietnamese AI Translation

Sự liên kết là với cụm từ 'trong Pháp đó là giới hạn của bậc hữu học'.

AI Translation Nissaya

sekkhapariyante=at the end of which are the learner's states. ; vā=or having the learner's states as its limit. ; tasmiṃ dhamme=in that practice fulfilled by those worldlings. ; itiayaṃ=this is. ; sambandho=the connection. ;

Myanmar Nissaya

sekkhapariyante=အဆုံး၌ သေက္ခတို့၏ တရားရှိသော။ ; vā=သေက္ခတို့၏ တရား တည်းဟူသော အပိုင်းအခြားရှိသော။ ; tasmiṃ dhamme=ထိုပုထုဇဉ် တို့သည် ဖြည့်ကျင့်အပ်သော တရား၌။ ; itiayaṃ=ကား။ ; sambandho=အစပ်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3756 | Chunk: 63

Paripūraṃ paripuṇṇataṃ karontīti paripūrakārino, paripūrakāro paripūrakiriyā etesaṃ atthīti vā paripūrakārino.

AI Translation based on Nissaya

They bring to fulfillment (paripūraṃ), thus they are 'fulfillers' (paripūrakārino); or, they have the action of fulfilling, thus they are 'fulfillers'.

Vietnamese AI Translation

Họ làm cho viên mãn (paripūraṃ), do đó họ là 'những người làm cho viên mãn' (paripūrakārino); hoặc, họ có hành động làm cho viên mãn, do đó họ là 'những người làm cho viên mãn'.

AI Translation Nissaya

paripūraṃ paripuṇṇataṃ=the state of being complete. ; karonti=they make. ; iti tasmā=therefore. ; paripūrakārino=they are called 'fulfillers'. ; vā=Or. ; etesaṃ=for these virtuous worldlings. ; paripūrakāro paripūrakriyā=the act of fulfilling. ; atthi=exists. ; ititasmā=therefore. ; paripūrakārino=they are called 'fulfillers'. ;

Myanmar Nissaya

paripūraṃ paripuṇṇataṃ=ပြည့်စုံသည်၏ အဖြစ်ကို။ ; karonti=ကုန်၏။ ; iti tasmā=ကြောင့်။ ; paripūrakārino=မည်ကုန်၏။ ; vā=ကား။ ; etesaṃ=ထိုကလျာဏပုထုဇဉ် တို့အား။ ; paripūrakāro paripūrakriyā=ဖြည့်ခြင်းကို ပြုခြင်းသ်ည။ ; atthi=၏။ ; ititasmā=ကြောင့်။ ; paripūrakārino=မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3757 | Chunk: 63

Tesaṃ sotāpattimaggassa pubbabhāgabhūte sekkhapariyante paṭipadādhamme vipassanāpāripūriyā paripūrakārīnaṃ.

AI Translation based on Nissaya

Of those who are fulfilling the path-practice which is the prior stage of the stream-entry path and has the learner's state as its limit, fulfilling it through the perfection of insight.

Vietnamese AI Translation

Của những người đang hoàn thiện sự thực hành đạo lộ là giai đoạn trước của đạo nhập lưu và có trạng thái hữu học làm giới hạn, hoàn thiện nó thông qua sự viên mãn của tuệ quán.

AI Translation Nissaya

sotāpattimaggassa=of the path of stream-entry. ; pujjabhāgabhūte=which is the prior stage. ; sekkhapariyante=at the limit of which is the learner's state. ; vā=or having the learner's state as its boundary. ; paṭipadā dhamme=in the practice fulfilled by worldlings. ; vipassanāpāripūriyā=through the fulfillment of insight. ; vā=or by fulfilling insight. ; paripūrakārīnaṃ=of those who bring to fulfillment. ; tesaṃ=of those virtuous worldlings. ;

Myanmar Nissaya

sotāpattimaggassa=၏။ ; pujjabhāgabhūte=ရှေ့အဖို့ ဖြစ်၌ဖြစ်သော။ ; sekkhapariyante=အဆုံး၌ သေက္ခပုဂ္ဂိုလ်၏ တရားရှိသော။ ; vā=သေက္ခာ ပုဂ္ဂိုလ်၏ တရားလျှင် အပိုင်းအခြားရှိသော။ ; paṭipadā dhamme=ပုထုဇဉ် တို့သည် ဖြည့်ကျင့်အပ်သော တရား၌။ ; vipassanāpāripūriyā=ဝိပဿနာ၏ ပြည့်စုံခြင်းဖြင့်။ ; vā=ဝိပဿနာကို ပြည့်စေခြင်းဖြင့်။ ; paripūrakārīnaṃ=ပြည့်စုံသည်၏ အဖြစ်ကို ပြုတတ်ကုန်သော။ ; tesaṃ=ထိုကလျာဏပုထုဇဉ် ပုဂ္ဂိုလ်တို့၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3758 | Chunk: 63

Kāye ca jīvite ca anapekkhānan ti ettha kāyeti sarīre.

AI Translation based on Nissaya

Here in the phrase **'without concern for body and life'**: 'body' means the physical body.

Vietnamese AI Translation

Ở đây trong cụm từ **'không quan tâm đến thân và mạng'**: 'thân' có nghĩa là thân vật lý.

AI Translation Nissaya

kāyā ca jīvite ca anapekkhā nantiettha=Here in 'without concern for body and life'. ; (attho=the meaning. ; evaṃ=thus. ; veditabbo=should be known.) ; kāyeti=as for 'body'. ; sarīre=in the physical body. ;

Myanmar Nissaya

kāyā ca jīvite ca anapekkhā nantiettha=၌။ ; (attho=ကို။ ; evaṃ=သို့။ ; veditabbo=၏။) ; kāyeti=ကား။ ; sarīre=ကိုယ်၌။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3759 | Chunk: 63

Sarīrañhi asucisañcayato kucchitānañca kesādīnaṃ cakkhurogādīnañca rogasatānaṃ āyabhūtattā kāyoti vuccati.

AI Translation based on Nissaya

Indeed, the physical body is called 'kāya' because it is a collection of impurities, the source of despicable things like hair, and of hundreds of diseases such as eye disease.

Vietnamese AI Translation

Thật vậy, thân vật lý được gọi là 'kāya' vì nó là một tập hợp những thứ bất tịnh, là nguồn gốc của những thứ hèn hạ như tóc, và của hàng trăm bệnh tật như bệnh về mắt.

AI Translation Nissaya

hi saccaṃ=Indeed. ; sarīraṃ=the body. ; asucisañcayato=because it is a collection of impurities like hair. ; kucchitānaṃ=of despicable things. ; kesādīnañca=such as hair, etc.. ; cakkhurogādīnañca=and of eye diseases, etc.. ; rogasatānañca=and of hundreds of diseases. ; āyabhūtattā=because it is the source. ; vā=or because it is the cause of their arising. ; vā=or because it is their location. ; kāyoti=as 'kāya' (body). ; vuccati=it is called. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; sarīraṃ=ကို။ ; asucisañcayato=မစင်ကြယ်သော ဆံအစရှိသော တရားတို့၏ ဖြစ်ရာဖြစ်သည်၏ အဖြစ်ကြောင့်။ ; kucchitānaṃ=အပ်ကုန်သော။ ; kesādīnañca=တို့၏လည်းကောင်း။ ; cakkhurogādīnañca=မျက်စိရောဂါအစရှိကုန်သော။ ; rogasatānañca=များစွာသော အနာတို့၏ လည်းကောင်း။ ; āyabhūtattā=ဖြစ်ရာဖြစ်သည်၏ အဖြစ်ကြောင့်။ ; vā=အကြောင်းဖြစ်၍ ဖြစ်သည်၏ အဖြစ်ကြောင့်။ ; vā=နေရာဖြစ်သည်၏ အဖြစ်ကြောင့်။ ; kāyoti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3760 | Chunk: 63

Jīviteti jīvitindriye.

AI Translation based on Nissaya

**'Life'** means the life faculty.

Vietnamese AI Translation

**'Mạng'** có nghĩa là mạng căn.

AI Translation Nissaya

jīviteti=As for 'life'. ; jīvitindriye=in the twofold life faculty, physical and mental. ;

Myanmar Nissaya

jīviteti=ကား။ ; jīvitindriye=ရုပ်ဇီဝိတ နာမ်ဇီဝိတ နှစ်ပါး၌။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3761 | Chunk: 63

Tañhi jīvanti tenāti jīvitanti vuccati.

AI Translation based on Nissaya

Indeed, because one lives by means of it, it is called 'life' (jīvita).

Vietnamese AI Translation

Thật vậy, vì người ta sống nhờ nó, nên nó được gọi là 'mạng' (jīvita).

AI Translation Nissaya

hi saccaṃ=Indeed. ; taṃ=that life faculty. ; tena=by that life faculty. ; jīvanti=they live. ; iti tasmā=therefore. ; jīvitanti=as 'jīvita' (life). ; vuccati=it is called. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; taṃ=ထိုဇီဝိတိန္ဒြေကို။ ; tena=ထိုဇီဝိတိန္ဒြေဖြင့်။ ; jīvanti=အသက်ရှည််တတ်ကုန်၏။ ; iti tasmā=ကြောင့်။ ; jīvitanti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3762 | Chunk: 63

Natthi etesaṃ apekkhāti anapekkhā, nissinehāti attho.

AI Translation based on Nissaya

They have no concern (apekkhā), thus they are 'unconcerned' (anapekkhā); the meaning is that they are without attachment.

Vietnamese AI Translation

Họ không có sự quan tâm (apekkhā), do đó họ là 'những người không quan tâm' (anapekkhā); ý nghĩa là họ không có sự dính mắc.

AI Translation Nissaya

etesaṃ=For these virtuous worldling individuals. ; apekkhā=concern for body and life. ; natthi=there is not. ; iti tasmā=therefore. ; anapekkhā=they are called 'unconcerned'. ; nassinehā=they have no affection for body and life. ; itiayaṃ=this is. ; attho=the meaning. ;

Myanmar Nissaya

etesaṃ=ထိုကလျာဏ ပုထုဇဉ် ပုဂ္ဂိုလ်တို့အား။ ; apekkhā=ကိုယ်အသက်၌ ငဲ့ခြင်းသည်။ ; natthi=မရှိ။ ; iti tasmā=ကြောင့်။ ; anapekkhā=မည်ကုန်၏။ ; nassinehā=ကိုယ့်အသက်၌ ချစ်မြတ်နိုးခြင်း မရှိကုန်။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3763 | Chunk: 63

Tesaṃ tasmiṃ kāye ca jīvite ca anapekkhānaṃ.

AI Translation based on Nissaya

Of those who are unconcerned for that body and for that life.

Vietnamese AI Translation

Của những người không quan tâm đến thân đó và mạng đó.

AI Translation Nissaya

tasmiṃ kāyeca=for that body. ; anapekkhānaṃ=of those who are unconcerned. ; tasmiṃ jīviteca=and for that life. ; anapekkhānaṃ=of those who are unconcerned. ; tesaṃ=for those virtuous worldling individuals. ;

Myanmar Nissaya

tasmiṃ kāyeca=တို့ကိုလည်းကောငး်။ ; anapekkhānaṃ=ငဲ့ခြင်းမရှိကုန်သော။ ; tasmiṃ jīviteca=တို့ကိုလည်းကောင်း။ ; anapekkhānaṃ=ကုန်သော။ ; tesaṃ=ထိုကလျာဏ ပုထုဇဉ် ပုဂ္ဂိုလ်တို့အား။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3764 | Chunk: 63

Idāni tesaṃ tesu anapekkhattassa kāraṇaṃ dassento pariccattajīvitānan ti āha.

AI Translation based on Nissaya

Now, showing the reason for their lack of concern, he said, **'of those who have given up their lives'**.

Vietnamese AI Translation

Giờ đây, để chỉ ra lý do cho sự không quan tâm của họ, ngài đã nói, **'của những người đã từ bỏ mạng sống của mình'**.

AI Translation Nissaya

idāni=Now. ; tesaṃ=of those virtuous worldling individuals. ; tesu=for that body and life. ; anapekkhāttassa=of the state of being unconcerned. ; kāraṇaṃ=the reason. ; dassento=the Elder, the General of the Dhamma, wishing to show. ; pariccattajīvitānanti='of those who have given up their lives'. ; āha=said. ;

Myanmar Nissaya

idāni=၌။ ; tesaṃ=ထိုကလျာဏပုထုဇဉ် ပုဂ္ဂိုလ်တို့၏။ ; tesu=ထို ကိုယ် အသက်တို့၌။ ; anapekkhāttassa=ငဲ့ခြင်းမရှိသည်၏ အဖြစ်၏။ ; kāraṇaṃ=အကြောင်းကို။ ; dassento=ပြတော်မူလိုသော ဓမ္မသေနာပတိမထေရ်သည်။ ; pariccattajīvitānanti=ဟူ၍။ ; āha=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3765 | Chunk: 63

Bhagavato ācariyassa vā sakajīvitapariccāgeneva hi te kilamamānepi kāye vinassamānepi jīvite anapekkhā hontīti.

AI Translation based on Nissaya

Indeed, it is only because they have given up their own lives for the sake of the Blessed One or their teacher that they are unconcerned even when the body is afflicted and life is perishing.

Vietnamese AI Translation

Thật vậy, chính vì họ đã từ bỏ mạng sống của mình vì Đức Thế Tôn hoặc thầy của họ, nên họ không quan tâm ngay cả khi thân bị khổ và mạng sắp tàn.

AI Translation Nissaya

hi saccaṃ=Indeed. ; bhagavato=for the Blessed One. ; vā=or. ; ācariyassa=for the teacher. ; sakajīvita pariccāgeneva=only because of giving up one's own life. ; vā=or only because of relinquishing one's life. ; te=those virtuous worldling individuals. ; kāye=the body. ; vā=or. ; kilamamānepi=even when it is afflicted. ; vā=or oppressed. ; jīvite=life. ; vā=or. ; vinassamānepi=even when it is being destroyed. ; vā=or being destroyed. ; kilamamāne=in the afflicted. ; kāyepi=body also. ; vinassamāne=in the perishing. ; jīvitepi=life also. ; anapekkhā=are unconcerned. ; honti=they are. ; iti=thus. ; veditabbaṃ=should be known. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; bhagavato=အား။ ; vā=တနည်းကား။ ; ācariyassa=အား။ ; sakajīvita pariccāgeneva=ကြောင့်သာလျှင်။ ; vā=အသက်ကို စွန့်ခြင်းကြောင့်သာလျှင်။ ; te=ထိုကလျာဏ ပုထုဇဉ် ပုဂ္ဂိုလ်တို့သည်။ ; kāye=ကိုယ်သည်။ ; vā=ကု။ ; kilamamānepi=ပင်ပန်းသော်လည်းကောင်း။ ; vā=နှိပ်စက်အပ်သော်လည်းကောင်း။ ; jīvite=အသက်သည်။ ; vā=ကို။ ; vinassamānepi=ဖျက်ဆီးသော်လည်းကောင်း။ ; vā=ဖျက်ဆီးအပ်သည်လည်းကောင်း။ ; kilamamāne=ပင်ပန်းသော။ ; kāyepi=၌လည်းကောင်း။ ; vinassamāne=ဖျက်ဆီးလတ္တံ့သော။ ; jīvitepi=၌လည်းကောင်း။ ; anapekkhā=ငဲ့ခြင်းမရှိကုန်သည်။ ; honti=ကုန်၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3766 | Chunk: 63

Sattannaṃ sekkhānan ti sikkhantīti sekkhāti laddhanāmānaṃ sotāpattimaggaṭṭhādīnaṃ sattannaṃ ariyapuggalānaṃ.

AI Translation based on Nissaya

As for **'of the seven learners'**: this means of the seven noble individuals, from the one established on the path of stream-entry onwards, who are called 'learners' because they are still training.

Vietnamese AI Translation

Về **'của bảy bậc hữu học'**: điều này có nghĩa là của bảy bậc thánh nhân, từ người an trú trên đạo nhập lưu trở đi, những người được gọi là 'hữu học' vì họ vẫn đang học.

AI Translation Nissaya

sattannaṃ sekkhānanti=As for 'of the seven learners'. ; sikkhanti=they are training. ; ititasmā=therefore. ; sekkhā=they are called 'learners'. ; laddhanāmāraṃ=who have received this name. ; sotāpattamaggaṭṭhādīnaṃ=of those established in the path of stream-entry and so on. ; sattannaṃ=of the seven. ; ariyapuggalānaṃ=noble individuals. ;

Myanmar Nissaya

sattannaṃ sekkhānanti=ကား။ ; sikkhanti=ကျင့်ကုန်ဆဲ။ ; ititasmā=ကြောင့်။ ; sekkhā=မည်ကုန်၏ဟူ၍။ ; laddhanāmāraṃ=ရအပ်သော အမည်ရှိကုန်သော ။ ; sotāpattamaggaṭṭhādīnaṃ=သောတာပတ္တိမဂ္ဂဋ္ဌာန အစရှိကုန်သော။ ; sattannaṃ=ကုန်သော။ ; ariyapuggalānaṃ=တို့၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3767 | Chunk: 63

Tathāgatasāvakānan ti tathāgatassa sāvakānaṃ.

AI Translation based on Nissaya

**'Of the Tathāgata's disciples'** means of the disciples of the Tathāgata.

Vietnamese AI Translation

**'Của các đệ tử của Như Lai'** có nghĩa là của các đệ tử của Như Lai.

AI Translation Nissaya

tathāgatasāvakānanti=As for 'of the Tathāgata's disciples'. ; tathāgatassa=of the Tathāgata. ; sāvakānaṃ=of the disciples. ;

Myanmar Nissaya

tathāgatasāvakānanti=ကား။ ; tathāgatassa=မြတ်စွာဘုရား၏။ ; sāvakānaṃ=တပည့်တို့၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3768 | Chunk: 63

Aṭṭhapi hi ariyapuggalā savanante ariyāya jātiyā jātattā bhagavato desanaṃ anusiṭṭhiṃ aveccappasādayogena sakkaccaṃ suṇantīti sāvakā.

AI Translation based on Nissaya

Indeed, all eight noble individuals are called 'disciples' (sāvakā) because at the end of hearing they are born with a noble birth, and because they listen attentively to the teaching and instruction of the Blessed One with unwavering confidence.

Vietnamese AI Translation

Thật vậy, tất cả tám bậc thánh nhân được gọi là 'thinh văn' (sāvakā) vì vào cuối buổi nghe pháp, họ được sinh ra với một sự sinh cao quý, và vì họ lắng nghe chăm chú lời dạy và chỉ giáo của Đức Thế Tôn với niềm tin không lay chuyển.

AI Translation Nissaya

hi saccaṃ=Indeed. ; aṭṭhapi=even the eight. ; ariya puggalā=noble individuals. ; savanante=at the end of hearing. ; ariyāya=with a noble. ; jātiyā=birth. ; vā=or in. ; jātattā ca=because of being born. ; sīlavante=individuals endowed with the fourfold purification of virtue. ; ariyāya=noble. ; jātiyā=in the birth. ; jātattā=because of being made. ; bhagavato=of the Blessed One. ; desanaṃ=the teaching. ; anusiṭṭhiṃ=the instruction. ; aveccappasādayogena=through association with unwavering confidence. ; sakkaccaṃ=attentively. ; suṇanti=they listen. ; iti tasmā=therefore. ; sāvakā=they are called disciples (sāvaka). ;

Myanmar Nissaya

hi saccaṃ=၏။ ; aṭṭhapi=ရှစ်ယောက်လည်း ဖြစ်ကုန်သော။ ; ariya puggalā=တို့သည်။ ; savanante=ကြားသည်၏ အဆုံး၌။ ; ariyāya=မြတ်သော။ ; jātiyā=ဇာတ်ဖြင့်။ ; vā=၌။ ; jātattā ca=ဖြစ်သည်၏ အဖြစ်ကြောင့်။ ; sīlavante=စတုပါရိသုဒ္ဓိသီလနှင့် ပြည့်စုံသော ပုဂ္ဂိုလ်တို့ကို။ ; ariyāya=မြတ်သော။ ; jātiyā=၌။ ; jātattā=ပြုအပ်သည်၏ အဖြစ်ကြောင့်။ ; bhagavato=၏။ ; desanaṃ=ဒေသနာတော်ကို။ ; anusiṭṭhiṃ=အဆုံအမတော်ကို။ ; aveccappasādayogena=မတုန်မလှုပ် သက်ဝင်ယုံကြည်သော သဒ္ဓါတရားနှင့် ယှဉ်ခြင်းကြောင့်။ ; sakkaccaṃ=စွာ။ ; suṇanti=နာတတ်ကုန်၏။ ; iti tasmā=ကြောင့်။ ; sāvakā=မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3769 | Chunk: 63

Tesupi arahattaphalaṭṭheyeva visesetvā [P1.207] dassento khīṇāsavānan ti āha, arahattamaggañāṇena parikkhīṇasabbāsavānanti attho.

AI Translation based on Nissaya

Among these disciples, wishing to single out those established in the fruit of Arahantship [P1.207], he said **'of the destroyers of the cankers'** (khīṇāsavānaṃ). The meaning is, of the Arahant individuals whose cankers have all been completely destroyed by the knowledge of the path to Arahantship.

Vietnamese AI Translation

Trong số các vị thinh văn này, muốn chỉ riêng những vị đã an trú trong quả A-la-hán [P1.207], ngài đã nói **'của những bậc đã đoạn tận các lậu hoặc'** (khīṇāsavānaṃ). Ý nghĩa là, của các vị A-la-hán mà các lậu hoặc của họ đã được đoạn tận hoàn toàn bởi trí tuệ của đạo A-la-hán.

AI Translation Nissaya

tesupi=Among those disciples too. ; arahattaphalaṭṭheyeva=only those established in the fruit of Arahantship. ; vise setvā=distinguishing. ; dassenetā=wishing to show. ; khīṇāsavānanti='of the destroyers of the cankers'. ; āha=he said. ; arahatatamaggañāṇena=by the knowledge of the path of Arahantship. ; parikkhiṇasabbāsavānaṃ=of the Arahant individuals whose cankers are all completely destroyed. ; itiayaṃ=this is. ; attho=the meaning. ;

Myanmar Nissaya

tesupi=ထိုသာဝကတို့၌လည်း။ ; arahattaphalaṭṭheyeva=အရဟတ္တဖလဋ္ဌာ်တို့ကိုသာလျှင်။ ; vise setvā=အထူးပြု၍။ ; dassenetā=ပြုတော်မူလိုရကား။ ; khīṇāsavānanti=ဟူ၍။ ; āha=၏။ ; arahatatamaggañāṇena=ဖြင့်။ ; parikkhiṇasabbāsavānaṃ=ကုန်ပြီးသော ဥဿုံသော အာသဝေါရှိကုန်သော ရဟန္တာ ပုဂ္ဂိုလ်တို့၏။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3770 | Chunk: 63

Paccekabuddhānan ti taṃ taṃ kāraṇaṃ paṭicca ekova anācariyako catusaccaṃ bujjhitavāti paccekabuddho.

AI Translation based on Nissaya

**'Of the Paccekabuddhas'**: one who, depending on some cause, has understood the Four Noble Truths alone and without a teacher, is a Paccekabuddha.

Vietnamese AI Translation

**'Của các vị Phật Độc Giác'**: người nào, tùy thuộc vào một số nguyên nhân nào đó, đã tự mình hiểu được Tứ Thánh Đế mà không cần thầy, là một vị Phật Độc Giác.

AI Translation Nissaya

paccekabuddhānanti=As for 'of the Paccekabuddhas'. ; taṃtaṃ kāraṇaṃ=due to this or that cause, such as a falling leaf or a tree. ; paṭicca=depending on. ; ekova=alone. ; anācariyako=without a teacher. ; catusaccaṃ=the Four Truths. ; bujjhitavā=he has understood. ; vā=or has understanding. ; iti tasmā=therefore. ; paccekabuddho=he is called a Paccekabuddha. ;

Myanmar Nissaya

paccekabuddhānanti=ကား။ ; taṃtaṃ kāraṇaṃ=ထိုထိုသစ်ရွက်လျော်ခြင်း ကြွေကျခြင်း သစ်ပင်အစရှိသော အကြောင်းကို။ ; paṭicca=စွဲ၍။ ; ekova=တစ်ယာက်တည်းသာလျှင်။ ; anācariyako=ဆရားမရှိဘဲ။ ; catusaccaṃ=ကို။ ; bujjhitavā=သိပြီ။ ; vā=သိခြင်းရှိ၏။ ; iti tasmā=ကြောင့်။ ; paccekabuddho=ပစ္စေကဗုဒ္ဓမည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3771 | Chunk: 63

Tādisānaṃ paccekabuddhānaṃ.

AI Translation based on Nissaya

Of such Paccekabuddhas.

Vietnamese AI Translation

Của các vị Phật Độc Giác như vậy.

AI Translation Nissaya

tādisānaṃ=of such a kind. ; paccekabuddhānaṃ=of the Paccekabuddhas. ;

Myanmar Nissaya

tādisānaṃ=ထိုသို့ သဘောရှိကုန်သော။ ; paccekabuddhānaṃ=တို့၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3772 | Chunk: 63

Tathāgatānan ti ettha aṭṭhahi kāraṇehi bhagavā tathāgato – tathā āgatoti tathāgato, tathā gatoti tathāgato, tathalakkhaṇaṃ āgatoti tathāgato, tathadhamme yāthāvato abhisambuddhoti tathāgato, tathadassitāya tathāgato, tathavāditāya tathāgato, tathā kāritāya tathāgato, abhibhavanaṭṭhena tathāgato.

AI Translation based on Nissaya

**'Of the Tathāgatas'**: here, the Blessed One is 'Tathāgata' for eight reasons: he has come in the same way (tathā āgato); he has gone in the same way (tathā gato); he has arrived at the true characteristic (tathalakkhaṇaṃ āgato); he has fully awakened to the true nature of things as they really are (tathadhamme yāthāvato abhisambuddho); because he sees what is true (tathadassitāya); because he speaks what is true (tathavāditāya); because he does what is true (tathākāritāya); and in the sense of vanquishing all else (abhibhavanaṭṭhena).

Vietnamese AI Translation

**'Của các vị Như Lai'**: ở đây, Đức Thế Tôn là 'Tathāgata' vì tám lý do: Ngài đã đến như vậy (tathā āgato); Ngài đã đi như vậy (tathā gato); Ngài đã đến được đặc tính chân thật (tathalakkhaṇaṃ āgato); Ngài đã hoàn toàn giác ngộ bản chất chân thật của các pháp như chúng thực sự là (tathadhamme yāthāvato abhisambuddho); vì Ngài thấy những gì là thật (tathadassitāya); vì Ngài nói những gì là thật (tathavāditāya); vì Ngài làm những gì là thật (tathākāritāya); và theo nghĩa chiến thắng tất cả những thứ khác (abhibhavanaṭṭhena).

AI Translation Nissaya

tathāgatānantiettha=Here in 'of the Tathāgatas'. ; aṭṭhahi=eight. ; kāraṇehi=by reasons. ; bhagavā=the Blessed One. ; tathāgato=is called 'Tathāgata'. ; tathā=in that way. ; vā=like the Buddhas of the past. ; āgatā=he has come. ; iti tasmā=therefore. ; tathāgato=he is called 'Tathāgata'. ; tathā=in that way. ; vā=similarly. ; gato=he went, taking seven steps to the north. ; ititasmā=therefore. ; tathāgato=he is called 'Tathāgata'. ; tathalakkhaṇaṃ=the true characteristic. ; āgato=he came to be due to the arising of insight knowledge. ; iti tasmā=therefore. ; tathāgato=he is called 'Tathāgata'. ; tathadhamme=in the true nature of things. ; yāthāvato=as it really is. ; vā=truly. ; abhisambuddho=he has fully awakened. ; iti tasmā=therefore. ; tathāgato=he is called 'Tathāgata'. ; tathadassitāya=because of seeing the true nature. ; vā=because of seeing truly. ; tathāgato=he is called 'Tathāgata'. ; tathavāditāya=because he is accustomed to speaking the truth. ; tathāgato=he is called 'Tathāgata'. ; tathakāritāya=because he is accustomed to doing what is true. ; tathāgato=he is called 'Tathāgata'. ; abhibhavanaṭṭhena=in the sense of vanquishing wrong views. ; tathāgato=he is called 'Tathāgata'. ;

Myanmar Nissaya

tathāgatānantiettha=၌။ ; aṭṭhahi=ကုန်သော။ ; kāraṇehi=တို့ဖြင့်။ ; bhagavā=သည်။ ; tathāgato=မည်၏။ ; tathā=ထိုအခြင်းအရာ အားဖြင့်။ ; vā=ရှေးဘုရားတို့နှင့်အတူ။ ; āgatā=လာတော်မူ၏။ ; iti tasmā=ကြောင့်။ ; tathāgato=မည်၏။ ; tathā=ဖြင့်။ ; vā=တူ။ ; gato=မြောက်သို့ ခုနစ်ဖဝါးကြွတော်မူ၏။ ; ititasmā=ကြောင့်။ ; tathāgato=မည်၏။ ; tathalakkhaṇaṃ=မဖောက်မပြန် မှန်သော လက္ခဏာကို။ ; āgato=ဝိပဿနာဉာဏ်၏ လာခြင်းကြောင့် ဖြစ်လာတော်မူ၏။ ; iti tasmā=ကြောင့်။ ; tathāgato=မည်၏။ ; tathadhamme=ဟုတ်မှန်သော သဘော၌။ ; yāthāvato=ဟုတ်မှန်၏။ ; vā=မှန်သောအားဖြင့်။ ; abhisambuddho=မူ၏။ ; iti tasmā=ကြောင့်။ ; tathāgato=မည်၏။ ; tathadassitāya=ဟုတ်မှန်သော သဘောကို မြင်သည်၏ အဖြစ်ကြောင့်။ ; vā=ဟုတ်မှန်စွာ မြင်သည်၏ အဖြစ်ကြောင့်။ ; tathāgato=မည်၏။ ; tathavāditāya=ဟုတ်မှန်သော စကားကို ဆိုလေ့ရှိသည်၏ အဖြစ်ကြောင့်။ ; tathāgato=မည်၏။ ; tathakāritāya=ဟုတ်မှန်သော အမှုကို ပြုလေ့ရှိသည်၏ အဖြစ်ကြောင့်။ ; tathāgato=မည်၏။ ; abhibhavanaṭṭhena=မိစ္ဆာအယူကို နှိမ်နှင်းတတ်သော အနက်ကြောင့်။ ; tathāgato=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3773 | Chunk: 63

Kathaṃ [M1.191] bhagavā tathā āgatoti tathāgato ?

AI Translation based on Nissaya

How is the Blessed One a **Tathāgata** because **he has come in the same way** (tathā āgato) [M1.191]?

Vietnamese AI Translation

Làm thế nào Đức Thế Tôn là một **Tathāgata** bởi vì **Ngài đã đến như vậy** (tathā āgato) [M1.191]?

AI Translation Nissaya

bhagavā=The Blessed One. ; tathā=in that way. ; vā=like the Buddhas of the past. ; āgato=has come. ; iti iminā vacanatthena=because of this verbal meaning. ; tathāgato=is called 'Tathāgata'. ; kathaṃ hoti=How is this so? ;

Myanmar Nissaya

bhagavā=သည်။ ; tathā=ထိုအခြင်းအရာဖြင့်။ ; vā=ထိုရှေးဘုရားတို့နှင့်အတူ။ ; āgato=လာတော်မူ၏။ ; iti iminā vacanatthena=ကြောင့်။ ; tathāgato=မည်တော်မူ၏။ ; kathaṃ hoti=နည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3774 | Chunk: 63

Yathā sabbalokahitāya ussukkamāpannā purimakā sammāsambuddhā āgatā.

AI Translation based on Nissaya

Just as the former Perfectly Enlightened Ones, having undertaken the effort for the welfare of the entire world, came.

Vietnamese AI Translation

Cũng như các vị Chánh Đẳng Giác trong quá khứ, sau khi đã nỗ lực vì lợi ích của toàn thế giới, đã đến.

AI Translation Nissaya

yathā=In the same way that. ; sabbalokahitāya=for the welfare of the whole world. ; ussukkaṃ=to diligence. ; vā=or to effort. ; āpannā=having undertaken. ; purimakā=the former. ; sammasambuddhā=Perfectly Enlightened Ones. ; āgatā=came. ;

Myanmar Nissaya

yathā=အကြင်အခြင်းအရာအားဖြင့်။ ; sabbalokahitāya=အလို့ငှါ။ ; ussukkaṃ=ကြောင့်ကြခြင်းသို့။ ; vā=အားထုတ်ခြင်းသို့။ ; āpannā=မူကုန်သော။ ; purimakā=ရှေး၌ပွင့်တော်မူကုန်ပြီးသော။ ; sammasambuddhā=တို့သည်။ ; āgatā=လာကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3775 | Chunk: 63

Kiṃ vuttaṃ hoti ?

AI Translation based on Nissaya

What is meant by this?

Vietnamese AI Translation

Điều này có nghĩa là gì?

AI Translation Nissaya

kiṃ ko adhippāyo=what is the intention. ; vuttaṃ vutto=that is stated. ; hoti=is? ;

Myanmar Nissaya

kiṃ ko adhippāyo=ကို။ ; vuttaṃ vutto=သည်။ ; hoti=နည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3776 | Chunk: 63

Yenābhinīhārena purimakā bhagavanto āgatā, teneva amhākampi bhagavā āgato.

AI Translation based on Nissaya

By whichever resolution the former Blessed Ones came, by that very same resolution our Blessed One also came.

Vietnamese AI Translation

Bằng bất kỳ quyết tâm nào mà các vị Thế Tôn trong quá khứ đã đến, bằng chính quyết tâm đó, Đức Thế Tôn của chúng ta cũng đã đến.

AI Translation Nissaya

yenābhinīhārena=by which aspiration for Buddhahood. ; purimakā=the former. ; bhagavanto=Blessed Ones. ; āgato=came. ; teneva=by that very same aspiration for Buddhahood. ; amhākaṃ=our. ; bhagavāpi=Blessed One also. ; āgato=came. ;

Myanmar Nissaya

yenābhinīhārena=အကြင် ဘုရားဆုကို ဆောင်းခြင်းကြောင့်။ ; purimakā=အတီလွန်ကုန်ပြီးသော။ ; bhagavanto=သည်။ ; āgato=လာတော်မူ၏။ ; teneva=ထိုဘုရားဆုကို တောင်ခြင်းကြောင့်သာလျှင်။ ; amhākaṃ=တို့၏။ ; bhagavāpi=သည်လည်း။ ; āgato=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3777 | Chunk: 63

Atha vā yathā purimakā bhagavanto dānasīlanekkhammapaññāvīriyakhantisaccādhiṭṭhānamettupekkhāsaṅkhātā dasa pāramiyo, dasa upapāramiyo, dasa paramatthapāramiyoti samatiṃsa pāramiyo pūretvā aṅgapariccāgaṃ nayanadhanarajjaputtadārapariccāganti [V1.175] ime pañca mahāpariccāge pariccajitvā, pubbayogapubbacariyadhammakkhānañātatthacariyādayo pūretvā buddhicariyāya koṭiṃ patvā āgatā, tathā amhākampi bhagavā āgato.

AI Translation based on Nissaya

Or, just as the former Blessed Ones came after fulfilling the thirty perfections—the ten perfections, ten sub-perfections, and ten ultimate perfections, namely giving, virtue, renunciation, wisdom, energy, patience, truth, determination, loving-kindness, and equanimity; and after making the five great sacrifices [V1.175] of limbs, eyes, wealth, kingdom, and children and wife; and after fulfilling the former applications, former practices, explaining the Dhamma, conduct for the welfare of relatives, etc., and reaching the pinnacle of the practice of wisdom—in the same way, our Blessed One also came.

Vietnamese AI Translation

Hoặc, cũng như các vị Thế Tôn trong quá khứ đã đến sau khi hoàn thành ba mươi ba-la-mật—mười ba-la-mật, mười cận ba-la-mật, và mười thượng ba-la-mật, đó là bố thí, trì giới, xuất gia, trí tuệ, tinh tấn, nhẫn nại, chân thật, quyết định, tâm từ, và tâm xả; và sau khi thực hiện năm đại thí xả [V1.175] về tay chân, mắt, tài sản, vương quốc, và con cái và vợ; và sau khi hoàn thành các sự ứng dụng trong quá khứ, các sự thực hành trong quá khứ, giải thích Giáo pháp, hạnh kiểm vì lợi ích của thân quyến, v.v., và đạt đến đỉnh cao của sự thực hành trí tuệ—cũng theo cách đó, Đức Thế Tôn của chúng ta cũng đã đến.

AI Translation Nissaya

athavā=Or. ; purimakā=the former. ; bhagavanto=Blessed Ones. ; dānasīlanekkhammapaññāvīriyakhantisaccadhiṭṭhānamettupekkhāsaṅkhātā=called the perfections of giving, virtue, renunciation, wisdom, energy, patience, truth, determination, loving-kindness, and equanimity. ; dasapāramiyo=the ten perfections. ; dasa upapāramiyo=the ten sub-perfections. ; dasa paramatthapāramiyo=and the ten ultimate perfections. ; iti=thus. ; samatiṃya pāramiyo=the thirty perfections. ; pūretvā=having fulfilled. ; aṅgapariccāgaṃ=the sacrifice of limbs. ; nayanadhana rajjaputtadārapariccāgaṃ=the sacrifice of eyes, wealth, kingdom, and children and wife. ; iti=thus. ; ime pañca mahāpariggage=these five great sacrifices. ; pariccajitvā=having given up. ; pubbayogapubbacariyadhammakkhānañātatthacariyādayo=the former application, former practice, explaining the Dhamma, conduct for the welfare of relatives, and so on. ; vāpūretvā=having fulfilled. ; buddhicariyāya=of the arising of knowledge which is the cause. ; vā=or the arising of knowledge, which is practicing and reciting blameless arts through the power of kamma-ownership-knowledge, and contemplating impermanence, etc. ; vā=of the perfection of wisdom. ; koṭiṃ=to the pinnacle. ; patvā=having reached. ; āgatā yathā=as they came. ; tathāamhākammibhagavā=our Blessed One also. ; āgato=came. ;

Myanmar Nissaya

athavā=ကား။ ; purimakā=အတီလွန်ကုန်ပြီးသော။ ; bhagavanto=သည်။ ; dānasīlanekkhammapaññāvīriyakhantisaccadhiṭṭhānamettupekkhāsaṅkhātā=ဒါန ပါရမီ သီလပါရမီ နေက္ခမ္မပါရမီ ပညာပါရမီ ဝီရိယပါရမီ ခန္တီပါရမီ သစ္စာပါရမီ အဓိဋ္ဌာန်ပါရမီ မေတ္တာပါရမီ ဥပေက္ခာ ပါရမီ ဟု ဆိုအပ်ကုန်သော။ ; dasapāramiyo=လည်းကောင်း။ ; dasa upapāramiyo=တို့လည်းကောင်း။ ; dasa paramatthapāramiyo=တို့လည်းကောင်း။ ; iti=သို့။ ; samatiṃya pāramiyo=တို့ကို။ ; pūretvā=ကုန်၍။ ; aṅgapariccāgaṃ=သည်လည်းကောင်း။ ; nayanadhana rajjaputtadārapariccāgaṃ=မျက်စိကို စွန့်ခြင်း ဥစ္စာကို စွန့်ခြင်း ပြည်ရွာကို စွန့်ခြင်း သားမယားတို့ကိုစွန့်ခြင်းလည်းကောင်း။ ; iti=သို့။ ; ime pañca mahāpariggage=တို့ကို။ ; pariccajitvā=ကုန်၍။ ; pubbayogapubbacariyadhammakkhānañātatthacariyādayo=ရှေ့၌ ပြုအပ်သော အားထုတ်ခြင်း ရှေ့၌ ပြုအပ်သော အကျင့်တရားတို့ကို ပြောဟောခြင်းဆွေမျိုးတို့၏ အကျိုးငှါ ကျင့်ခြင်း အစရှိသည်တို့ကို။ ; vā=ဂတ သစ္ဏာ ဂတဝတ်နှင့်တကွ အဘိညာဉ်သမာပတ်တို့ကို ပြီးစေခြင်း တည်းဟူသော ပုဗ္ဗယောဂ ဒါနစသည်တို့၌ လွန်စွာကျင့်ခင်းကို ပြီးစေခြင်း တည်းဟူသော ပုဗ္ဗစရိယ သတ္တဝါတို့ကို လောကုတ္တရာ တရား၏ အကြောင်း၌ တည်စေခြင်း၏ အစွမ်းဖြင့်ဖြစ်သော တရားတို့ကို ဆိုခြင်းတည်းဟူသော ဓမ္မက္ခာ၊ ဆွေမျိုးတို့၏ အကျိုးငှါ ကျင့်ခြင်းတည်းဟူသော ဉာတတ္ထစရိယ အစရှိတို့ကို။ ; pūretvā=ဖြည့်ကျင့်တော်မူကုန်၍။ ; buddhicariyāya=အကြောင်းဖြစ်သော ဉာဏ်၏ ဖြစ်ခြင်း၏။ ; vā=ကမ္မဿကတတာဉာဏ်၏ အစွမ်းဖြင့် အပြစ်မရှိသော အတတ်ကို လေ့ကျက်ခြင်း သရဇ္ဈာယ်ခြင်း အနိစ္စစသည်ကို ဆင်ခြင်ခြင်းတည်းဟူသော ဉာဏ်၏ ဖြစ်ခြင်း၏။ ; vā=ပညာပါရမီ၏။ ; koṭiṃ=အထွတ်အထိပ်သို့။ ; patvā=ရောက်၍။ ; āgatā yathā=ကုန်သကဲ့သို့။ ; tathā=တူ။ ; amhākammibhagavā=သည်လည်း။ ; āgato=မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3778 | Chunk: 63

Yathā ca purimakā bhagavanto cattāro satipaṭṭhāne cattāro sammappadhāne cattāro iddhipāde pañcindriyāni pañca balāni satta bojjhaṅge ariyaṃ aṭṭhaṅgikaṃ maggaṃ bhāvetvā brūhetvā āgatā, tathā amhākampi bhagavā āgatoti tathāgato.

AI Translation based on Nissaya

And just as the former Blessed Ones came after having developed and cultivated the four foundations of mindfulness, the four right strivings, the four bases of power, the five faculties, the five powers, the seven factors of enlightenment, and the Noble Eightfold Path, in the same way, our Blessed One also came; therefore he is called 'Tathāgata'.

Vietnamese AI Translation

Và cũng như các vị Thế Tôn trong quá khứ đã đến sau khi đã phát triển và tu tập bốn niệm xứ, bốn chánh cần, bốn như ý túc, năm căn, năm lực, bảy giác chi, và Bát Thánh Đạo, cũng theo cách đó, Đức Thế Tôn của chúng ta cũng đã đến; do đó Ngài được gọi là 'Tathāgata'.

AI Translation Nissaya

ca=And. ; purimakā=the former. ; bhagavanto=Blessed Ones. ; cattāro=the four. ; satipaṭṭhāne=foundations of mindfulness. ; cattāro=the four. ; sammappadhāne=right strivings. ; cattāro=the four. ; iddhipāde=bases of power. ; pañca=the five. ; indriyāni=faculties. ; pañca=the five. ; balāni=powers. ; satta=the seven. ; bojjhaṅge=factors of enlightenment. ; ariyaṃ=the noble. ; aṭṭhaṅgikaṃ=eightfold. ; maggaṃ=path. ; bhāvetvā=having developed. ; brūhetvā=and cultivated. ; āgatāyathā=as they came. ; tathā=similarly. ; amhākampibhagavā=our Blessed One also. ; āgato=came. ; iti tasmā=therefore. ; tathāgato=he is called 'Tathāgata'. ;

Myanmar Nissaya

ca=ဆက်။ ; purimakā=ကုန်သော။ ; bhagavanto=တို့သည်။ ; cattāro=ကုန်သော။ ; satipaṭṭhāne=တို့ကို။ ; cattāro=ကုန်သော။ ; sammappadhāne=တို့ကို။ ; cattāro=ကုန်သော။ ; iddhipāde=တို့ကို။ ; pañca=ကုန်သော။ ; indriyāni=တို့ကို။ ; pañca=ကုန်သော။ ; balāni=တို့ကို။ ; satta=ကုန်သော။ ; bojjhaṅge=တို့ကို။ ; ariyaṃ=သော။ ; aṭṭhaṅgikaṃ=ရှိသော။ ; maggaṃ=ကို။ ; bhāvetvā=ဖြစ်စေ၍။ ; brūhetvā=ပွားစေ၍။ ; āgatāyathā=သကဲ့သို့။ ; tathā=တူ။ ; amhākampibhagavā=သည်လည်း။ ; āgato=မူ၏။ ; iti tasmā=ကြောင့်။ ; tathāgato=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3779 | Chunk: 63

‘‘Yatheva dīpaṅkarabuddhaādayo, sabbaññubhāvaṃ munayo idhāgatā;

AI Translation based on Nissaya

“Just as the sages, Dīpaṅkara Buddha and others, arrived here at the state of omniscience;

Vietnamese AI Translation

“Cũng như các bậc hiền triết, Phật Dīpaṅkara và các vị khác, đã đến đây đến trạng thái toàn giác;

AI Translation Nissaya

Meaning of the verse. ; dīpaṅkarabuddhaādayo=The sages, Dīpaṅkara Buddha and others. ; munayo=the sages. ; sabbaññubhāvaṃ=to the state of omniscience. ; idha=here in these three worlds. ; vā=or here at this seat of awakening. ; āgatāyatheva=just as they arrived. ;

Myanmar Nissaya

ဂါထာအနက်။ ။ ; dīpaṅkarabuddhaādayo=ကုန်သော။ ; munayo=တို့သည်။ ; sabbaññubhāvaṃ=သဗ္ဗညုအဖြစ်သို့။ ; idha=ဤလောကသုံးပါး၌။ ; vā=ဤဗောဓိမဏ္ဍိုင်၌။ ; āgatāyatheva=ရောက် တော်မူကုန် သကဲ့သို့သာလျှင်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3780 | Chunk: 63

Tathā ayaṃ sakyamunīpi āgato, tathāgato vuccati tena cakkhumā’’ ti.

AI Translation based on Nissaya

Thus, this Sage of the Sakyans has also come; because of that, the One with the Eye is called 'Tathāgata'.

Vietnamese AI Translation

Như vậy, bậc Hiền triết của dòng Sākyan này cũng đã đến; vì thế, Đấng Có Mắt được gọi là 'Tathāgata'.

AI Translation Nissaya

tathā=similarly. ; ayaṃsakyamunīpi=this Sage of the Sakyans also. ; āgato=has come. ; tena=because of that. ; cakkhumā=the One with the Eye. ; tathāgato=as Tathāgata. ; vuccati=is called. ; iti=thus. ; veditabbaṃ=it should be known. ;

Myanmar Nissaya

tathā=တူ။ ; ayaṃsakyamunīpi=ဤသာကီဝင်မင်း ဘုရားသည်လည်း။ ; āgato=ရောက်တော်မူ၏။ ; tena=ကြောင့်။ ; cakkhumā=စက္ခုငါးပါးနှင့် ပြည့်စုံတော်မူသော မြတ်စွာဘုရားကို။ ; tathāgato=ဟူ၍။ ; vuccati=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3781 | Chunk: 64

Kathaṃ tathā gatoti tathāgato ?

AI Translation based on Nissaya

How is he the 'Tathāgata' in the sense of 'thus gone'?

Vietnamese AI Translation

Làm thế nào Ngài là 'Tathāgata' theo nghĩa 'đã đi như vậy'?

AI Translation Nissaya

tathā gatotiatthena=due to the meaning 'thus gone'. ; kathaṃ=how. ; tathāgato=is he the Tathāgata?. ;

Myanmar Nissaya

tathā gatotiatthena=ဟူသော အနက်ကြောင့်။ ; kathaṃ=အတီသို့လျှင်။ ; tathāgato=မည်သနည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3782 | Chunk: 64

Yathā sampatijātā purimakā bhagavanto gatā.

AI Translation based on Nissaya

Just as the previous Blessed Ones went right after they were born.

Vietnamese AI Translation

Cũng như các vị Thế Tôn trong quá khứ đã đi ngay sau khi được sinh ra.

AI Translation Nissaya

yathā=in the way that. ; sampatijātā=who were just born. ; purimakā=the previous. ; bhagavanto=Blessed Ones. ; gatā=went, taking seven steps. ;

Myanmar Nissaya

yathā=အကြင်အခြင်းအရာအားဖြင့်။ ; sampatijātā=ဖွားကာစ ဖြစ်ကုန်သော။ ; purimakā=ကုန်သော။ ; bhagavanto=တို့သည်။ ; gatā=ခုနစ်ဖဝါး ကြွတော်မူကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3783 | Chunk: 64

Kathañca te gatā ?

AI Translation based on Nissaya

And how did they go?

Vietnamese AI Translation

Và họ đã đi như thế nào?

AI Translation Nissaya

kathañca=and how. ; te=did those previous Buddhas. ; gatā=go?. ;

Myanmar Nissaya

kathañca=အဘယ်သို့လျှင်။ ; te=ထိုရှေးဘုရားတို့သည်။ ; gatā=သွားကုန်သနည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3784 | Chunk: 64

Te hi sampatijātā samehi pādehi pathaviyaṃ patiṭṭhāya uttarenamukhā sattapadavītihārena gatā.

AI Translation based on Nissaya

Indeed, having just been born, they stood on the earth with even feet, and facing north, went forward with a stride of seven steps.

Vietnamese AI Translation

Thật vậy, vừa mới sinh ra, các ngài đã đứng trên mặt đất bằng đôi chân bằng phẳng, và quay mặt về hướng bắc, đi về phía trước một sải bảy bước.

AI Translation Nissaya

hi vitthāremi=indeed, I will elaborate. ; sampatijātā=having just been born. ; vā=as soon as they were free from the hands of the men with the white cloth. ; te=those Bodhisattas. ; samehi=with even. ; pādehi=feet. ; pathaviyaṃ=on the earth. ; patiṭṭhāya=having stood. ; uttarena=to the north. ; mukhā=facing. ; hutvā=being. ; sattapadavītihārena=with the stride of seven steps. ; gatā=they went. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; sampatijātā=ကုန်သော။ ; vā=ဘွဲ့ဖြူပုဆိုးလူတို့၏ လက်မှ လွတ်ကတည်းကပင်လျှင်။ ; te=ထိုဘုရားလောင်းတို့သည်။ ; samehi=အညီအညွတ်ဖြစ်ကုန်သော။ ; pādehi=ခြေတို့ဖြင့်။ ; pathaviyaṃ=၌။ ; patiṭṭhāya=ရပ်၍။ ; uttarena=မြောက်အဖို့ဖြင့်။ ; mukhā=ရှေ့ရှုသည်။ ; hutvā=၍။ ; sattapadavītihārena=ခုနစ်ဖဝါး ကြွသွားခြင်းဖြင့်။ ; gatā=သွားကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3785 | Chunk: 64

Yathāha ‘‘sampatijāto, ānanda, bodhisatto samehi pādehi pathaviyaṃ patiṭṭhahitvā [P1.208] uttarābhimukho sattapadavītihārena gacchati setamhi chatte anudhārayamāne, sabbā ca disā anuviloketi, āsabhiñca vācaṃ bhāsati ‘ aggohamasmi lokassa, jeṭṭhohamasmi lokassa, seṭṭhohamasmi lokassa, ayamantimā jāti, natthi dāni punabbhavo’’ ’ ti ( ma. ni. 3.207; dī. ni. 2.31).

AI Translation based on Nissaya

As it is said: 'Ānanda, as soon as he is born, the Bodhisatta stands on the earth with even feet, and facing north, he takes seven steps forward. While a white parasol is being held over him, he surveys all the directions and utters the bull-like speech: ‘I am the chief in the world, I am the eldest in the world, I am the best in the world. This is my last birth. Now there is no more future existence.’’' (ma. ni. 3.207; dī. ni. 2.31).

Vietnamese AI Translation

Như có lời dạy rằng: 'Này Ānanda, ngay khi sinh ra, vị Bồ-tát đứng trên mặt đất bằng đôi chân bằng phẳng, và quay mặt về hướng bắc, ngài đi bảy bước về phía trước. Trong khi một chiếc lọng trắng được che trên đầu, ngài nhìn khắp các phương và thốt lên lời nói như tiếng rống của con bò đực: ‘Ta là bậc tối thượng trên đời, ta là bậc tối trưởng trên đời, ta là bậc tối thắng trên đời. Đây là lần sinh cuối cùng của ta. Bây giờ không còn tái sinh nữa.’’' (ma. ni. 3.207; dī. ni. 2.31).

AI Translation Nissaya

yathāha=as it is said. ; sampatijāto.la. punabbhavoti=from 'just born' up to 'no more future existence'. ; āha=he said. ; ānanda=O Ānanda, my beloved younger brother. ; sampatijāto=just born. ; bodhisatto=the Bodhisatta. ; samehi=with even. ; pādehi=feet. ; pathaviyaṃ=on the earth. ; patiṭṭhahitvā=having stood. ; uttarābhimukho=facing north. ; hutvā=being. ; sattapadavītihārena=with a stride of seven steps. ; setamhi=a white. ; chatte=parasol. ; vā=or, with the white parasol, the five royal regalia. ; anudhārayamāne=being held up over him. ; gacchati=he goes. ; sabbā ca disā=and all ten directions. ; anuviloketi=he surveys. ; ahaṃ=I. ; lokassa=of the world of beings. ; aggo=am the chief. ; asmi=I am. ; ahaṃ=I. ; lokassa=of the world. ; jeṭṭho=am the eldest. ; asmi=I am. ; ahaṃ=I. ; lokassa=of the world. ; seṭṭhā=am the best. ; asmi=I am. ; ayaṃjāti=this birth. ; antimā=is the last. ; antimā=is the last. ; jāti=birth. ; dāni=now. ; punabbhavo=a future existence. ; natthi=there is not. ; āsabhiṃ=which is the property of a bull-like person. ; vācañca=and speech. ; bhāsati=he utters. ; assa bodhisattassa=of this Bodhisatta. ;

Myanmar Nissaya

yathāha=ဟူမူကား။ ; sampatijāto.la. punabbhavoti=မူ၍။ ; āha=၏။ ; ānanda=ညီချစ်သည်းချာအာနန္ဒာ။ ; sampatijāto=ယခုဖွားကာစဖြစ်သော။ ; bodhisatto=သည်။ ; samehi=ကုန်သော။ ; pādehi=တို့ဖြင့်။ ; pathaviyaṃ=မြေ၌။ ; patiṭṭhahitvā=ရပ်၍။ ; uttarābhimukho=မြောက်အရပ်သို့ ရှေ့ရှုသည်။ ; hutvā=၍။ ; sattapadavītihārena=ဖြင့်။ ; setamhi=ဖြူသော။ ; chatte=ထီးကို။ ; vā=သေတမှိဆတ္တေ၊ ထီးဖြူဖြင့် မှတ်အပ်သော မင်းမြောက်တန်ဆာငါးပါးကို။ ; anudhārayamāne=နောက်တော်ပါးပြု၍ ဆောင်းမိုးလျက်။ ; gacchati=သွားတော်မူ၏။ ; sabbā ca disā=ဆယ်ပါးသော အရပ်တို့ကိုလည်း။ ; anuviloketi=လှည့်လည် ၍ ရှုကြည်၏။ ; ahaṃ=ငါသည်။ ; lokassa=သတ္တလောကထက်။ ; aggo=လွန်ကဲသည်။ ; asmi=ဖြစ်၏။ ; ahaṃ=သည်။ ; lokassa=ထက်။ ; jeṭṭho=ကြီးသည်။ ; asmi=၏။ ; ahaṃ=သည်။ ; lokassa=ထက်။ ; seṭṭhā=မြတ်သည်။ ; asmi=၏။ ; ayaṃjāti=ဤပဋိသန္ဓေနေခြင်းသည်။ ; antimā=အဆုံးဖြစ်ကုန်သော။ ; antimā=အဆုံးဖြစ်ကုန်သော။ ; jāti=ခြင်းတည်း။ ; dāni=ယခု။ ; punabbhavo=တဖန် ပဋိသန္ဓေ နေခြင်းသည်။ ; natthi=ပြီ။ ; āsabhiṃ=အာသဘပုဂ္ဂိုလ်တို့၏ ဥစ္စာဖြစ်သော။ ; vācañca=ကိုလည်း။ ; bhāsati=ပြောဆို၏။ ; assa bodhisattassa=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3786 | Chunk: 64

Tañcassa gamanaṃ tathaṃ ahosi avitathaṃ anekesaṃ visesādhigamānaṃ pubbanimittabhāvena.

AI Translation based on Nissaya

And that going of his was true and unerring, being a forerunner of his many special attainments.

Vietnamese AI Translation

Và việc đi đó của ngài là thật và không sai lầm, là điềm báo trước cho nhiều thành tựu đặc biệt của ngài.

AI Translation Nissaya

tañca gamanaṃ=And that going of his, taking seven steps to the north. ; anekesaṃ=of many. ; visesādhigamānaṃ=attainments of special qualities. ; pubbanimittabhāvena=because of being a forerunner. ; vā=by being. ; tathaṃ=was true. ; avitathaṃ=was unerring. ; ahosi=it was. ;

Myanmar Nissaya

tañca gamanaṃ=ထိုသို့ မြောက်သို့ ခုနစ်ဖဝါးသွားခြင်း သည်လည်း။ ; anekesaṃ=ကုန်သော။ ; visesādhigamānaṃ=တရားအထူးကို ရခြင်းတို့၏။ ; pubbanimittabhāvena=အဖြစ်ကြောင့်။ ; vā=ဖြင့်။ ; tathaṃ=ဟုတ်မှန်သည်။ ; avitathaṃ=မချွတ်မယွင်းသည်။ ; ahosi=ပြီ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3787 | Chunk: 64

Yañhi so sampatijāto samehi pādehi patiṭṭhahi, idamassa caturiddhipādapaṭilābhassa pubbanimittaṃ, uttaramukhabhāvo panassa sabbalokuttarabhāvassa pubbanimittaṃ, sattapadavītihāro sattabojjhaṅgaratanapaṭilābhassa pubbanimittaṃ, ‘‘suvaṇṇadaṇḍā vītipatanti cāmarā’’ ti ( su. ni. 693) ettha [M1.192] vuttacāmarukkhepo pana sabbatitthiyanimmathanassa pubbanimittaṃ, setacchattadhāraṇaṃ arahattaphalavimuttivaravimalasetacchattapaṭilābhassa pubbanimittaṃ, sabbādisānuvilokanaṃ sabbaññutānāvaraṇañāṇapaṭilābhassa pubbanimittaṃ, āsabhivācābhāsanaṃ pana appaṭivattiyavaradhammacakkappavattanassa pubbanimittaṃ.

AI Translation based on Nissaya

Indeed, that he stood on even feet as soon as he was born was a forerunner of his attainment of the four bases of psychic power. His facing north, moreover, was a forerunner of his state of being supreme in all the world. The stride of seven steps was a forerunner of his attainment of the seven jewel-like factors of enlightenment. The lifting of the whisks mentioned in the verse, ‘Yak-tail whisks with golden handles wave to and fro’ (su. ni. 693), was a forerunner of his vanquishing of all heretics. The holding of the white parasol was a forerunner of his attainment of the noble, stainless white parasol of liberation, the fruit of Arahantship. The surveying of all directions was a forerunner of his attainment of the unobstructed knowledge of omniscience. And the utterance of the bull-like speech was a forerunner of the turning of the noble, irreversible wheel of Dhamma.

Vietnamese AI Translation

Thật vậy, việc ngài đứng bằng đôi chân bằng phẳng ngay khi sinh ra là điềm báo trước cho việc ngài đạt được bốn như ý túc. Hơn nữa, việc ngài quay mặt về hướng bắc là điềm báo trước cho trạng thái tối thượng trên toàn thế giới của ngài. Sải bước bảy bước là điềm báo trước cho việc ngài đạt được bảy giác chi quý báu. Việc nâng các cây phất trần được đề cập trong câu kệ, ‘Phất trần đuôi bò yak với cán vàng phe phẩy’ (su. ni. 693), là điềm báo trước cho việc ngài chiến thắng tất cả các tà thuyết. Việc che lọng trắng là điềm báo trước cho việc ngài đạt được chiếc lọng trắng giải thoát cao quý, không tỳ vết, tức là quả A-la-hán. Việc nhìn khắp các phương là điềm báo trước cho việc ngài đạt được nhất thiết chủng trí vô ngại. Và việc thốt lên lời nói như tiếng rống của bò đực là điềm báo trước cho việc chuyển Pháp luân cao thượng, không thể đảo ngược.

AI Translation Nissaya

hi vitthāremi=Indeed, I will elaborate. ; so=that Bodhisatta. ; sampati=now. ; jāto=just born. ; hoti=is. ; samehi=with even. ; pādehi=feet. ; yaṃ yena kāraṇena=that because of which. ; patiṭṭhati=he stood. ; idaṃ=this standing. ; assa bodhisattassa=for this Bodhisatta. ; caturiddhipādapaṭilābhassa=of the attainment of the four bases of psychic power. ; pubbanimittaṃ=was the forerunner. ; pana=Furthermore. ; assa=of that Bodhisatta. ; uttaramukhabhāvo=the state of facing north. ; sabbalokuttarabhāvassa=of the state of being supreme in all the world. ; pubbanimittaṃ=was the forerunner. ; sattapadavītihāro=the stride of seven steps. ; sattabojjhaṅgaratanapaṭilābhassa=of the attainment of the seven jewel-like factors of enlightenment. ; pubbanimittaṃ=was the forerunner. ; pana=Furthermore. ; suvaṇṇadaṇḍā=having handles made of gold. ; cāmarā=the yak-tail whisks. ; vītipatanti=wave to and fro. ; itiettha=in this Nālaka Sutta of the Suttanipāta. ; vuttacāmarukkhepo=the mentioned lifting of the yak-tail whisks. ; sabbatitthiyanimmathanassa=of the vanquishing of all heretics. ; pubbanimittaṃ=was the forerunner. ; setacchattadhāraṇaṃ=the holding of the white parasol. ; arahatta phalavimuttivaravimalasetacchatatapaṭilābhassa=of the attainment of the noble, stainless white parasol of liberation, the fruit of Arahantship. ; pubbanimittaṃ=was the forerunner. ; sabbādisānuvilokanaṃ=the surveying of all directions. ; sabbaññutānāvaraṇañāṇapaṭilābhassa=of the attainment of the unobstructed knowledge of omniscience. ; pubbanimittaṃ=was the forerunner. ; āsabhi vācābhāsanaṃ=the utterance of the bull-like speech beginning 'I am the chief...'. ; appaṭivattiyavaradhammacakkappavattanassa=of the turning of the noble, irreversible wheel of Dhamma. ; pubbanimittaṃ=was the forerunner. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; so=ထိုဘုရားလောင်းသည်။ ; sampati=ယခုအခါ၌။ ; jāto=ဖွားကာစ ဖြစ်သည်။ ; hoti=၏။ ; samehi=ကုန်သော။ ; pādehi=တို့ဖြင့်။ ; yaṃ yena kāraṇena=ကြောင့်။ ; patiṭṭhati=ရပ်၏။ ; idaṃ=ဤသို့ ရပ်ခြင်းသည်။ ; assa bodhisattassa=အား။ ; caturiddhipādapaṭilābhassa=၏။ ; pubbanimittaṃ=တည်း။ ; pana=ထိုမှတပါး။ ; assa=ထိုဘုရားလောင်း၏။ ; uttaramukhabhāvo=မျက်နှာမူသည်၏ အဖြစ်သည် ။ ; sabbalokuttarabhāvassa=ဥဿုံသော လောကုတ္တရာတရားကို ရခြင်းသည်။ ; pubbanimittaṃ=တည်း။ ; sattapadavītihāro=မြောက်သို့ ခုနစ်ဖဝါး ဖြန့်ကြွသွားခြင်းသည်။ ; sattabojjhaṅgaratanapaṭilābhassa=ခုနစ်ပါးသော ဗောဇ္ဈင်ရတနာကို ရခြင်း၏။ ; pubbanimittaṃ=တည်း။ ; pana=ထိုမှတစ်ပါး။ ; suvaṇṇadaṇḍā=ရွှေဖြင့် ပြီးသော အရိုးရှိကုန်သည်။ ; cāmarā=စာမရီ သားမြီးယပ်တို့သည်။ ; vītipatanti=တလွှဲလွှဲ ယပ်ခတ် ကုန်၏။ ; itiettha=ဤသုတ္တနိပါတ် နာဠကသုတ်။ ; vuttacāmarukkhepo=ဟောတော်မူအပ်သော စာမရီ သားမြီးယပ်ကို ချီမြှောက်ခြင်းသည်။ ; sabbatitthiyanimmathanassa=ခပ်သိမ်းသော တိတ္ထိတို့၏ အယူကို နှိမ်နှင်းခင်းသည်။ ; pubbanimittaṃ=တည်း။ ; setacchattadhāraṇaṃ=ထီးဖြူကို ဆောင်မိုးခြင်းသည်။ ; arahatta phalavimuttivaravimalasetacchatatapaṭilābhassa=မြတ်သော အရဟတ္တဖိုလ် ဝိမုတ္တိ တည်းဟူသော အညစ်အကြေးကင်းသော ထီးဖြူကိုရခြင်း၏။ ; pubbanimittaṃ=တည်း။ ; sabbādisānuvilokanaṃ=ခပ်သိမ်းသော အရပ်မျက်နှာကို လှည့်လည်၍ ရှုကြည့်ခြင်းသည်။ ; sabbaññutānāvaraṇañāṇapaṭilābhassa=သဗ္ဗညုတဉာဏ် တည်းဟူသော အနာဝရဏဉာဏ်ကို ရခြင်း၏။ ; pubbanimittaṃ=တည်း။ ; āsabhi vācābhāsanaṃ=ဤအဂ္ဂေါဟမသ္မိ စသည်ဖြင့် မြတ်သော စကားကို ဆိုခြင်းသည်။ ; appaṭivattiyavaradhammacakkappavattanassa=နတ်ဗြဟ္မာတို့သည် ဟောကြားခြင်းငှါ မတတ်ကောင်းသော ဓမ္မစကြာတရားကို ဟောခြင်း၏။ ; pubbanimittaṃ=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3788 | Chunk: 64

Tathāyaṃ bhagavāpi gato.

AI Translation based on Nissaya

In that same way, this Blessed One also went.

Vietnamese AI Translation

Cũng theo cách đó, Đức Thế Tôn này cũng đã đi.

AI Translation Nissaya

tathā=in that manner. ; ayaṃ bhagavāpi=this Blessed One of ours also. ; gato=went, taking seven steps to the north. ;

Myanmar Nissaya

tathā=ထိုအခြင်းအရာဖြင့်။ ; ayaṃ bhagavāpi=ဤငါတို့ ဘုရားလောင်းသည်လည်း။ ; gato=မြောက်သို့ ခုနစ်ဖဝါးကြွတော်မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3789 | Chunk: 64

Tañcassa gamanaṃ tathaṃ ahosi avitathaṃ tesaṃyeva visesādhigamānaṃ pubbanimittabhāvena.

AI Translation based on Nissaya

And that going of his was true and unerring, being a forerunner of those very same special attainments.

Vietnamese AI Translation

Và việc đi đó của ngài là thật và không sai lầm, là điềm báo trước cho chính những thành tựu đặc biệt ấy.

AI Translation Nissaya

assa bodhisattassa=of this Bodhisatta. ; tañcagamanaṃ=and his going. ; kathaṃ=truly. ; ahosi=was. ; tesaṃ yeva visesādhigamānaṃ=of those very same special attainments. ; pubbanimittabhāvena=by being a forerunner. ; avitathaṃ=was unerring. ; ahosi=it was. ;

Myanmar Nissaya

assa bodhisattassa=၏။ ; tañcagamanaṃ=သည်လည်း။ ; kathaṃ=ဟုတ်မှန်စွာ။ ; ahosi=ဖြစ်ပြီ။ ; tesaṃ yeva visesādhigamānaṃ=ထိုတရားအထူးကို ရခြင်းတို့၏ သာလျှင်။ ; pubbanimittabhāvena=ပုဗ္ဗနိမိတ်၏ အဖြစ်ဖြင့်။ ; avitathaṃ=မချွန်မယွင်းသည်။ ; ahosi=ဖြစ်ပြီ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3790 | Chunk: 64

Tenāhu porāṇā –

AI Translation based on Nissaya

Therefore the ancients said:

Vietnamese AI Translation

Do đó, các bậc cổ nhân đã nói:

AI Translation Nissaya

tena=therefore. ; porāṇā=the ancients. ;

Myanmar Nissaya

tena=ထို့ကြောင့်။ ; porāṇā=တို့သည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3791 | Chunk: 64

‘‘Muhuttajātova gavaṃpatī yathā, samehi pādehi phusī vasundharaṃ;

AI Translation based on Nissaya

‘Just as a bull, born a moment ago, touched the earth with even feet;

Vietnamese AI Translation

‘Cũng như một con bò đực, vừa mới sinh ra, đã chạm đất bằng đôi chân bằng phẳng;

AI Translation Nissaya

muhuttajātova.la.=Just as one born a moment ago... [etc.]. ;

Myanmar Nissaya

muhuttajātova.la.= ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3792 | Chunk: 64

Aṭṭhaṅgupetaṃ giramabbhudīrayi, sīho yathā pabbatamuddhaniṭṭhito’’ ti.

AI Translation based on Nissaya

He uttered the eight-factored speech, like a lion standing on a mountain peak.’

Vietnamese AI Translation

Ngài đã thốt lên lời nói tám yếu tố, như một con sư tử đứng trên đỉnh núi.’

AI Translation Nissaya

muddhaniṭṭhitoti=standing on the mountain peak. ; āhu=they said. ; **gāthāanaka**.. gavaṃpatī=Verse explanation.. a lord of cattle (bull). ; muhuttajātova=just after being born. ; samehi=with even. ; pādehi=feet. ; vasundharaṃ=the earth. ; phusīyathā=just as he touched. ; so gotamo=that Bodhisatta Gotama. ; muhuttajātova=just after being born. ; samehi=with even. ; pādehi=feet. ; vasundharaṃ=the earth. ; phusī=having touched. ; sattapadāni=the seven steps. ; vikkamī=he strode. ; marū=the gods. ; setañcachattaṃ=and the white parasol. ; anumārayuṃ=they held up. ; so gotamo=that Bodhisatta Gotama. ; sattapadāni=the seven steps. ; gantvāna=having gone. ; samā=equally. ; samantato=all around. ; disā=the directions. ; vilokesi=he surveyed. ; sīho=a lion. ; pabbatamuddhani=on a mountain peak. ; ṭhito=standing. ; aṭṭhaṅgupetaṃ=endowed with eight factors. ; giraṃ=the speech beginning 'I am the chief...'. ; abbhudīrayi=he uttered. ; (These two verses are Upajāti verses, a mix of Vaṃsaṭṭha and Indavaṃsā.) ;

Myanmar Nissaya

muddhaniṭṭhitoti=ဟူ၍။ ; āhu=ဆိုကုန်၏။ ; **gāthāanaka**.. gavaṃpatī=နွားလား ဥသဘသည်။ ; muhuttajātova=ဖွားပြီးစကပင်။ ; samehi=ဖြစ်ကုန်သော။ ; pādehi=တို့ဖြင့်။ ; vasundharaṃ=မြေကို။ ; phusīyathā=နင်းဘိသကဲ့သို့။ ; so gotamo=ထို ဂေါတမ ဘုရားအလောင်းသည်။ ; muhuttajātova=လျှင်။ ; samehi=ကုန်သော။ ; pādehi=တို့ဖြင့်။ ; vasundharaṃ=ကို။ ; phusī=၍။ ; sattapadāni=ခုနစ်ဖဝါးတို့ကို။ ; vikkamī=နင်းသွား၏။ ; marū=နတ်တို့သည်။ ; setañcachattaṃ=ထီးဖြးကိုလည်း။ ; anumārayuṃ=ဆောင်းကုန်ပြီ။ ; so gotamo=ထိုဘုရားလောင်းသည်။ ; sattapadāni=တို့ကို။ ; gantvāna=သွားဦး၍။ ; samā=အတူအမျှ။ ; samantato=လင့်ကဲတဖြာမှ။ ; disā=အရပ်မျက်နှာတို့ကို။ ; vilokesi=ရှု၏။ ; sīho=ခြင်္သေ့မင်းသည်။ ; pabbatamuddhani=ထောင်ထိပ်၌။ ; ṭhito=ရပ်လျက်။ ; aṭṭhaṅgupetaṃ=အင်္ဂါရှစ်ပါးနှင့် ပြည့်စုံသော။ ; giraṃ=အဂ္ဂေါဟမသ္မိ အစရှိသော စကားကို။ ; abbhudīrayi=ကြုံးဝါး၏။ ; (ဤနှစ်ဂါထာကား ဝံသဋ္ဌ ဣန္ဒဝံသာအရော ဥပဇာတိဂါထာတည်း။) ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3793 | Chunk: 64

Evaṃ tathā gatoti tathāgato.

AI Translation based on Nissaya

Thus, he is the Tathāgata because he has 'thus gone'.

Vietnamese AI Translation

Như vậy, ngài là Tathāgata vì ngài đã 'đi như vậy'.

AI Translation Nissaya

evaṃ=thus. ; tathāgatotivacanatthena=due to the meaning 'thus gone'. ; tathāgato=he is called Tathāgata. ;

Myanmar Nissaya

evaṃ=သို့။ ; tathāgatotivacanatthena=ကြောင့်။ ; tathāgato=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3794 | Chunk: 64

Atha vā yathā purimakā bhagavanto, ayampi bhagavā tatheva nekkhammena kāmacchandaṃ … pe … paṭhamajjhānena nīvaraṇe … pe … aniccānupassanāya niccasaññaṃ … pe … arahattamaggena sabbakilese pahāya gato.

AI Translation based on Nissaya

Alternatively, just as the previous Blessed Ones went by abandoning all defilements with the path of Arahantship, in that very same way this Blessed One also went, having abandoned sensual desire through renunciation... the hindrances through the first jhāna... the perception of permanence through the contemplation of impermanence... and all defilements through the path of Arahantship.

Vietnamese AI Translation

Hoặc cách khác, giống như các bậc Thế Tôn trong quá khứ đã đi bằng cách đoạn tận tất cả phiền não với đạo A-la-hán, thì vị Thế Tôn này cũng đã đi theo đúng cách ấy, đã đoạn tận dục tham bằng sự xuất ly... các triền cái bằng sơ thiền... tưởng về thường bằng quán vô thường... và tất cả phiền não bằng đạo A-la-hán.

AI Translation Nissaya

athavā=Alternatively. ; purimakā=the previous. ; bhagavanto=Blessed Ones. ; arahattamaggena=by means of the path of Arahantship. ; sabbakilese=all defilements. ; pahāya=having abandoned. ; gatāyathā=just as they went. ; tatheva=in that very way. ; ayampibhagavā=this Blessed One also. ; nekkhammene=through renunciation, which is the path of jhāna together with access concentration. ; vā=or, by wholesome mental states founded on non-greed. ; kāmacchandaṃ=the hindrance of sensual desire. ; pa=... . ; paṭhamajjhānena=by the first jhāna. ; nīvaraṇe=the hindrances. ; la=... . ; aniccānupassanāya=by contemplation of impermanence. ; niccasaññaṃ=the perception of permanence. ; (These objects of the verb are all connected in the Mahā-Aṭṭhakathā.) ; la=... . ; arahattamaggena=by the path of Arahantship. ; sabbakilese=all defilements. ; pahāya=having abandoned. ; vā=because of. ; vā=if it is so. ; gato=he went/practiced. ; (According to the Sīlakkhandha-ṭīkā.) ;

Myanmar Nissaya

athavā=ကား။ ; purimakā=ကုန်သော။ ; bhagavanto=တို့သည်။ ; arahattamaggena=ဖြင့်။ ; sabbakilese=တို့ကို။ ; pahāya=ပယ်၍။ ; gatāyathā=သို့။ ; tatheva=သာလျှ်င။ ; ayampibhagavā=သည်လည်း။ ; nekkhammene=ဥပစာရနှင့်တကွဖြစ်သော ဈာန်မဂ်ဖြင့်။ ; vā=အလောဘ ပြဋ္ဌာန်းသော ကုသိုလ်စိတ္တုပ္ပါဒ်ဖြင့်။ ; kāmacchandaṃ=ကာမစ္ဆန္ဒနီဝရဏကို။ ; pa= ; paṭhamajjhānena=ဖြင့်။ ; nīvaraṇe=တို့ကို။ ; la=။ ; aniccānupassanāya=ဖြင့်။ ; niccasaññaṃ=ကို။ ; (ဤကံပုဒ်တို့ကို မဟာယမှာ ချည်းစပ်။) ; la= ; arahattamaggena=ဖြင့်။ ; sabbakilese=တို့ကို။ ; pahāya=၍။ ; vā=ခြင်းကြောင့်။ ; vā=သည်ရှိသော်။ ; gato=ကျင့်၏။ ; (သီလက္ခန်ဋီကာနှင့်အညီ။) ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3795 | Chunk: 64

Evampi tathā gatoti tathāgato.

AI Translation based on Nissaya

In this way also, he is the Tathāgata because he has 'thus gone'.

Vietnamese AI Translation

Theo cách này, Ngài cũng là Như Lai vì Ngài đã 'đi như vậy'.

AI Translation Nissaya

evampi=in this way also. ; tathāgatoti vacanatthena=due to the meaning 'thus gone'. ; tathāgato=he is called Tathāgata. ; (The elided portion is to be taken from the commentaries on the Sīlakkhandhavagga, Mūlapaṇṇāsa, and Aṅguttara Nikāya.) ;

Myanmar Nissaya

evampi=ဤသို့လည်း။ ; tathāgatoti vacanatthena=ကြောင့်။ ; tathāgato=မည်၏။ ; (ပေယျာလငုပ်ကို သီလက္ခန်၊ မူလပဏ္ဏာသ၊ အင်္ဂုတ္တိုရ်အဋ္ဌကထာတို့မှာယူ။) ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3796 | Chunk: 64

Kathaṃ [P1.209] tathalakkhaṇaṃ āgatoti tathāgato ?

AI Translation based on Nissaya

How is he the Tathāgata in the sense that 'he has come to the true characteristic'?

Vietnamese AI Translation

Làm thế nào Ngài là Như Lai theo nghĩa là 'Ngài đã đến được với đặc tính chân thật'?

AI Translation Nissaya

kathaṃ=how. ; tathalakkhaṇaṃ āgatoti vacanatthena=due to the meaning 'he has come to the true characteristic'. ; tathāgato=is he the Tathāgata?. ;

Myanmar Nissaya

kathaṃ=လျှင်။ ; tathalakkhaṇaṃ āgatoti vacanatthena=ကြောင့်။ ; tathāgato=မည်သနည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3797 | Chunk: 64

Pathavīdhātuyā kakkhaḷattalakkhaṇaṃ tathaṃ avitathaṃ, āpodhātuyā paggharaṇalakkhaṇaṃ, tejodhātuyā uṇhattalakkhaṇaṃ, vāyodhātuyā vitthambhanalakkhaṇaṃ, ākāsadhātuyā asamphuṭṭhalakkhaṇaṃ, viññāṇadhātuyā vijānanalakkhaṇaṃ.

AI Translation based on Nissaya

The earth element has the true and unerring characteristic of hardness; the water element, the characteristic of flowing; the fire element, the characteristic of heat; the air element, the characteristic of supporting; the space element, the characteristic of not being touched; and the consciousness element, the characteristic of cognizing.

Vietnamese AI Translation

Địa đại có đặc tính chân thật và không sai khác là sự cứng chắc; thủy đại, có đặc tính tuôn chảy; hỏa đại, có đặc tính nóng; phong đại, có đặc tính chống đỡ; không gian đại, có đặc tính không bị chạm đến; và thức đại, có đặc tính nhận biết.

AI Translation Nissaya

pathavīdhātuyā=Of the earth element. ; tathaṃ=the true. ; avitathaṃ=unerring. ; kakkhaḷattalakkhaṇaṃ=characteristic of hardness. ; atthi=there is. ; (Thus add the word 'atthi' and connect the word 'tatha' to every sentence.) ; āpodhātuyā=of the water element. ; paggharaṇalakkhaṇaṃ=the characteristic of flowing. ; tejodhātuyā=of the fire element. ; uṇhattalakkhaṇaṃ=the characteristic of heat. ; vāyodhātuyā=of the air element. ; vitthambhanalakkhaṇaṃ=the characteristic of supporting. ; ākāsadhātuyā=of the space element. ; asaṃphuṭṭhalakkhaṇaṃ=the characteristic of not being touched by material clusters. ; viññāṇadhātuyā=of the seven consciousness elements. ; vijānanalakkhaṇaṃ=the characteristic of cognizing. ;

Myanmar Nissaya

pathavīdhātuyā=၏။ ; tathaṃ=ဟုတ်မှန်သော။ ; avitathaṃ=မချွတ်ယွင်းသော။ ; kakkhaḷattalakkhaṇaṃ=ခက်မာသည်၏ အဖြစ်တည်းဟူသော လက္ခဏာသည်။ ; atthi=၏။ ; (ဤသို့ အတ္ထိ ပုဒ်ကိုထည့်၍ တထ- သဒ္ဒါတို့ကို ဝါကျတိုင်းယှဉ်၍ ယောဇနာ။) ; āpodhātuyā=၏။ ; paggharaṇalakkhaṇaṃ=ယိုစီးခြင်းလက္ခဏာသည်။ ; tejodhātuyā=၏။ ; uṇhattalakkhaṇaṃ=ပူသည်၏ အဖြစ်တည်းဟူသော လက္ခဏာသည်။ ; vāyodhātuyā=၏။ ; vitthambhanalakkhaṇaṃ=ခိုင်ခံ့ခြင်း လက္ခဏာသည်။ ; ākāsadhātuyā=၏။ ; asaṃphuṭṭhalakkhaṇaṃ=ရုပ်ကလာပ်တို့နှင့် မတွေ့ခြင်း လက္ခဏာသည်။ ; viññāṇadhātuyā=ခုနစ်ပါးသော ဝိညာဏဓာတ်၏။ ; vijānanalakkhaṇaṃ=သိခြင်းလက္ခဏာသည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3798 | Chunk: 64

Rūpassa ruppanalakkhaṇaṃ, vedanāya vedayitalakkhaṇaṃ, saññāya sañjānanalakkhaṇaṃ, saṅkhārānaṃ abhisaṅkharaṇalakkhaṇaṃ, viññāṇassa vijānanalakkhaṇaṃ.

AI Translation based on Nissaya

Form has the characteristic of being afflicted; feeling has the characteristic of being felt; perception has the characteristic of perceiving; formations have the characteristic of constructing; consciousness has the characteristic of cognizing.

Vietnamese AI Translation

Sắc có đặc tính bị bức hại; thọ có đặc tính được cảm nhận; tưởng có đặc tính tri nhận; các hành có đặc tính tạo tác; thức có đặc tính nhận biết.

AI Translation Nissaya

rūpassa=Of the aggregate of form. ; ruppanalakkhaṇaṃ=the characteristic of being afflicted. ; vedanāya=of feeling. ; vedayitalakkhaṇaṃ=the characteristic of being felt. ; saññāya=of perception. ; sañjānanalakkhaṇaṃ=the characteristic of perceiving by making a mark. ; saṅkhārānaṃ=of the aggregate of formations. ; abhisaṅkharaṇalakkhaṇaṃ=the characteristic of constructing. ; viññāṇassa=of consciousness. ; vijānanalakkhaṇaṃ=the characteristic of cognizing. ;

Myanmar Nissaya

rūpassa=ရူပက္ခန္ဓာ၏။ ; ruppanalakkhaṇaṃ=ဖောက်ပြန်ခြင်း လက္ခဏာသည်။ ; vedanāya=၏။ ; vedayitalakkhaṇaṃ=ခံစားခြင်းလက္ခဏာသည်။ ; saññāya=၏။ ; sañjānanalakkhaṇaṃ=အမှတ်ကို ပြု၍ သိခြင်း လက္ခဏာသည်။ ; saṅkhārānaṃ=သင်္ခါရက္ခန္ဓာတို့၏။ ; abhisaṅkharaṇalakkhaṇaṃ=ပြုပြင်စီရင်ခြင်းလက္ခဏာသည်။ ; viññāṇassa=၏။ ; vijānanalakkhaṇaṃ=သိခြင်းလက္ခဏာသည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3799 | Chunk: 64

Vitakkassa abhiniropanalakkhaṇaṃ, vicārassa anumajjanalakkhaṇaṃ, pītiyā pharaṇalakkhaṇaṃ, sukhassa sātalakkhaṇaṃ, cittekaggatāya avikkhepalakkhaṇaṃ, phassassa phusanalakkhaṇaṃ.

AI Translation based on Nissaya

Applied thought has the characteristic of directing; sustained thought, of examining; rapture, of pervading; happiness, of pleasantness; one-pointedness of mind, of non-distraction; and contact, of touching.

Vietnamese AI Translation

Tầm có đặc tính hướng đến; tứ, có đặc tính thẩm sát; hỷ, có đặc tính thấm nhuần; lạc, có đặc tính dễ chịu; nhất tâm, có đặc tính không phân tán; và xúc, có đặc tính chạm vào.

AI Translation Nissaya

vitakkassa=Of applied thought. ; abhiniropanalakkhaṇaṃ=the characteristic of directing onto the object. ; vicārassa=of sustained thought. ; anumajjanulakkhaṇaṃ=the characteristic of examining the object. ; pītiyā=of rapture. ; pharaṇalakkhaṇaṃ=the characteristic of pervading. ; sukhassa=of happiness. ; sātalakkhaṇaṃ=the characteristic of being pleasant. ; cittekaggatāya=of one-pointedness of mind. ; avikkhepalakkhaṇaṃ=the characteristic of non-distraction. ; phassassa=of contact. ; phusanalakkhaṇaṃ=the characteristic of touching. ;

Myanmar Nissaya

vitakkassa=၏။ ; abhiniropanalakkhaṇaṃ=အာရုံသို့ ရှေ့ရှုလက္ခဏာသည်။ ; vicārassa=၏။ ; anumajjanulakkhaṇaṃ=အရုံသို့ သုံးသပ်ခြင်း လက္ခဏာသည်။ ; pītiyā=၏။ ; pharaṇalakkhaṇaṃ=နှံ့ခြင်း လက္ခဏာသည်။ ; sukhassa=၏။ ; sātalakkhaṇaṃ=သာယာခြင်း လက္ခဏာသည်။ ; cittekaggatāya=၏။ ; avikkhepalakkhaṇaṃ=မပျံ့လွင့်ခြင်း လက္ခဏာသည်။ ; phassassa=၏။ ; phusanalakkhaṇaṃ=တွေ့မြင်ခြင်း လက္ခဏာသည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3800 | Chunk: 64

Saddhindriyassa [M1.193] adhimokkhalakkhaṇaṃ, vīriyindriyassa paggahalakkhaṇaṃ, satindriyassa upaṭṭhānalakkhaṇaṃ, samādhindriyassa avikkhepalakkhaṇaṃ, paññindriyassa pajānanalakkhaṇaṃ.

AI Translation based on Nissaya

The faith faculty has the characteristic of conviction; the energy faculty, of exertion; the mindfulness faculty, of establishment; the concentration faculty, of non-distraction; and the wisdom faculty, of discerning.

Vietnamese AI Translation

Tín căn có đặc tính tin tưởng; tấn căn, có đặc tính nỗ lực; niệm căn, có đặc tính an lập; định căn, có đặc tính không phân tán; và tuệ căn, có đặc tính phân biệt.

AI Translation Nissaya

saddhindriyassa=Of the faith faculty. ; adhimokkhalakkhaṇaṃ=the characteristic of conviction. ; vīritindriyassa=of the energy faculty. ; paggahalakkhaṇaṃ=the characteristic of exertion. ; satindriyassa=of the mindfulness faculty. ; upaṭṭhānalakkhaṇaṃ=the characteristic of establishment. ; samādhindriyassa=of the concentration faculty. ; avikkhepalakkhaṇaṃ=the characteristic of non-distraction. ; paññindriyassa=of the wisdom faculty. ; pajānanalakkhaṇaṃ=the characteristic of discerning. ;

Myanmar Nissaya

saddhindriyassa=၏။ ; adhimokkhalakkhaṇaṃ=သက်ဝင်ယုံကြည်ခြင်းလက္ခဏာသည်။ ; vīritindriyassa=၏။ ; paggahalakkhaṇaṃ=ချီးမြှောက်ခြင်း လက္ခဏာသည်။ ; satindriyassa=၏။ ; upaṭṭhānalakkhaṇaṃ=ထင်ခြင်းလက္ခဏာသည်။ ; samādhindriyassa=၏ ; avikkhepalakkhaṇaṃ=မပျံ့လွင့်ခြင်း လက္ခဏာသည်။ ; paññindriyassa=၏။ ; pajānanalakkhaṇaṃ=အပြားအားဖြင့် သိခြင်း လက္ခဏာသည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3801 | Chunk: 64

Saddhābalassa assaddhiye akampiyalakkhaṇaṃ, vīriyabalassa kosajje, satibalassa muṭṭhassacce, samādhibalassa uddhacce, paññābalassa avijjāya akampiyalakkhaṇaṃ.

AI Translation based on Nissaya

The power of faith has the characteristic of being unshakable by faithlessness; the power of energy, by laziness; the power of mindfulness, by muddle-headedness; the power of concentration, by restlessness; and the power of wisdom, by ignorance.

Vietnamese AI Translation

Tín lực có đặc tính không bị lay chuyển bởi sự vô tín; tấn lực, bởi sự lười biếng; niệm lực, bởi sự hôn trầm; định lực, bởi sự trạo cử; và tuệ lực, bởi sự vô minh.

AI Translation Nissaya

saddhābalassa=Of the power of faith. ; assaddhiya=by faithlessness. ; akampiyalakkhaṇaṃ=the characteristic of being unshakable. ; vīriyabalassa=of the power of energy. ; kosajje=by laziness. ; akampiyalakkhaṇaṃ=the characteristic of being unshakable. ; satibalassa=of the power of mindfulness. ; muṭṭhassacce=by delusion. ; akampiyalakkhaṇaṃ=the characteristic of being unshakable. ; samādhibalassa=of the power of concentration. ; uddhacce=by restlessness. ; akampiyalakkhaṇaṃ=the characteristic of being unshakable. ; paññābalassa=of the power of wisdom. ; avijjāya=by ignorance. ; akampiyalakkhaṇaṃ=the characteristic of being unshakable. ;

Myanmar Nissaya

saddhābalassa=၏။ ; assaddhiya=မစ္ဆေရကြောင့်။ ; akampiyalakkhaṇaṃ=မတုန်လှုပ်ခြင်းလက္ခဏာသည်။ ; vīriyabalassa=၏။ ; kosajje=ပျင်းရိခြင်းကြောင့်။ ; akampiyalakkhaṇaṃ=သည်။ ; satibalassa=၏။ ; muṭṭhassacce=မောဟကြောင့်။ ; akampiyalakkhaṇaṃ=သည်။ ; samādhibalassa=၏။ ; uddhacce=ကြောင့်။ ; akampiyalakkhaṇaṃ=သည်။ ; paññābalassa=၏။ ; avijjāya=ကြောင့်။ ; akampiyalakkhaṇaṃ=သည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3802 | Chunk: 64

Satisambojjhaṅgassa upaṭṭhānalakkhaṇaṃ, dhammavicayasambojjhaṅgassa pavicayalakkhaṇaṃ, vīriyasambojjhaṅgassa paggahalakkhaṇaṃ, pītisambojjhaṅgassa pharaṇalakkhaṇaṃ, passaddhisambojjhaṅgassa upasamalakkhaṇaṃ, samādhisambojjhaṅgassa avikkhepalakkhaṇaṃ, upekkhāsambojjhaṅgassa paṭisaṅkhānalakkhaṇaṃ.

AI Translation based on Nissaya

The enlightenment factor of mindfulness has the characteristic of establishment; investigation of phenomena, of investigation; energy, of exertion; rapture, of pervading; tranquility, of calming; concentration, of non-distraction; and equanimity, of careful contemplation.

Vietnamese AI Translation

Niệm giác chi có đặc tính an lập; trạch pháp, có đặc tính thẩm sát; tấn, có đặc tính nỗ lực; hỷ, có đặc tính thấm nhuần; khinh an, có đặc tính làm lắng dịu; định, có đặc tính không phân tán; và xả, có đặc tính quán chiếu cẩn trọng.

AI Translation Nissaya

satisambojjhaṅgassa=Of the enlightenment factor of mindfulness. ; upaṭṭhānalakkhaṇaṃ=the characteristic of establishment. ; dhammavicaya sambojjhaṅgassa=of the enlightenment factor of investigation of phenomena. ; pavicayalakkhaṇaṃ=the characteristic of investigation. ; vīriya sambojjhaṅgassa=of the enlightenment factor of energy. ; paggahalakkhaṇaṃ=the characteristic of exertion. ; pītisambojjhaṅgassa=of the enlightenment factor of rapture. ; pharaṇalakkhaṇaṃ=the characteristic of pervading. ; passaddhisambojjhaṅgassa=of the enlightenment factor of tranquility. ; upasamalakkhaṇaṃ=the characteristic of calming. ; samādhi sambojjhaṅgassa=of the enlightenment factor of concentration. ; avikkhepalakkhaṇaṃ=the characteristic of non-distraction. ; upekkhāsambojjhaṅgassa=of the enlightenment factor of equanimity. ; paṭisaṅkhānalakkhaṇaṃ=the characteristic of careful contemplation. ;

Myanmar Nissaya

satisambojjhaṅgassa=၏။ ; upaṭṭhānalakkhaṇaṃ=ထင်ခြင်း လက္ခဏာသည်။ ; dhammavicaya sambojjhaṅgassa=၏။ ; pavicayalakkhaṇaṃ=ဆင်ခြင်ခြင်း လက္ခဏာသည်။ ; vīriya sambojjhaṅgassa=၏။ ; paggahalakkhaṇaṃ=ချီးမြှောက်ခြင်း လက္ခဏာသည်။ ; pītisambojjhaṅgassa=၏။ ; pharaṇalakkhaṇaṃ=နှံ့ခြင်းလက္ခဏာသည်။ ; passaddhisambojjhaṅgassa=၏။ ; upasamalakkhaṇaṃ=ငြိမ်းခြင်း လက္ခဏာသည်။ ; samādhi sambojjhaṅgassa=၏။ ; avikkhepalakkhaṇaṃ=သည်။ ; upekkhāsambojjhaṅgassa=၏။ ; paṭisaṅkhānalakkhaṇaṃ=အသင့်အားဖြင့် ရှုခြင်း လက္ခဏာသည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3803 | Chunk: 64

Sammādiṭṭhiyā [V1.177] dassanalakkhaṇaṃ, sammāsaṅkappassa abhiniropanalakkhaṇaṃ, sammāvācāya pariggahalakkhaṇaṃ, sammākammantassa samuṭṭhānalakkhaṇaṃ, sammāājīvassa vodānalakkhaṇaṃ, sammāvāyāmassa paggahalakkhaṇaṃ, sammāsatiyā upaṭṭhānalakkhaṇaṃ, sammāsamādhissa avikkhepalakkhaṇaṃ.

AI Translation based on Nissaya

Right view has the characteristic of seeing; right thought, of directing; right speech, of embracing; right action, of originating; right livelihood, of purification; right effort, of exertion; right mindfulness, of establishment; and right concentration, of non-distraction.

Vietnamese AI Translation

Chánh kiến có đặc tính thấy; chánh tư duy, có đặc tính hướng đến; chánh ngữ, có đặc tính bao hàm; chánh nghiệp, có đặc tính khởi nguồn; chánh mạng, có đặc tính thanh lọc; chánh tinh tấn, có đặc tính nỗ lực; chánh niệm, có đặc tính an lập; và chánh định, có đặc tính không phân tán.

AI Translation Nissaya

samādiṭṭhiyā=Of right view. ; dassanalakkhaṇaṃ=the characteristic of seeing. ; sammāsaṅkappassa=of right thought. ; abhiniropanalakkhaṇaṃ=the characteristic of directing. ; sammāvvacāya=of right speech. ; pariggahalakkhaṇaṃ=the characteristic of embracing. ; sammākammantassa=of right action. ; samuṭṭhānalakkhaṇaṃ=the characteristic of originating well. ; sammāājīvassa=of right livelihood. ; vodānalakkhaṇaṃ=the characteristic of purification. ; sammāvāyāmassa=of right effort. ; paggahalakkhaṇaṃ=the characteristic of exertion. ; sammāsatiyā=of right mindfulness. ; upaṭṭhānalakkhaṇaṃ=the characteristic of establishment. ; sammāsamādhissa=of right concentration. ; avikkhepalakkhaṇaṃ=the characteristic of non-distraction. ;

Myanmar Nissaya

samādiṭṭhiyā=၏။ ; dassanalakkhaṇaṃ=မြင်ခြင်း လက္ခဏာသည်။ ; sammāsaṅkappassa=၏။ ; abhiniropanalakkhaṇaṃ=သည်။ ; sammāvvacāya=၏။ ; pariggahalakkhaṇaṃ=သိမ်းဆည်းခြင်း လက္ခဏာသည်။ ; sammākammantassa=၏။ ; samuṭṭhānalakkhaṇaṃ=ကောင်းစွာဖြစ်ခြင်း လက္ခဏာသည်။ ; sammāājīvassa=၏။ ; vodānalakkhaṇaṃ=ဖြူစင်ခြင်း လက္ခဏာသည်။ ; sammāvāyāmassa=၏။ ; paggahalakkhaṇaṃ=သည်။ ; sammāsatiyā=၏။ ; upaṭṭhānalakkhaṇaṃ=သည်။ ; sammāsamādhissa=၏။ ; avikkhepalakkhaṇaṃ=သည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3804 | Chunk: 64

Avijjāya aññāṇalakkhaṇaṃ, saṅkhārānaṃ cetanālakkhaṇaṃ, viññāṇassa vijānanalakkhaṇaṃ, nāmassa namanalakkhaṇaṃ, rūpassa ruppanalakkhaṇaṃ, saḷāyatanassa āyatanalakkhaṇaṃ, phassassa phusanalakkhaṇaṃ, vedanāya vedayitalakkhaṇaṃ, taṇhāya hetulakkhaṇaṃ, upādānassa [P1.210] gahaṇalakkhaṇaṃ, bhavassa āyūhanalakkhaṇaṃ, jātiyā nibbattilakkhaṇaṃ, jarāya jīraṇalakkhaṇaṃ, maraṇassa cutilakkhaṇaṃ.

AI Translation based on Nissaya

Ignorance has the characteristic of not knowing; formations, of volition; consciousness, of cognizing; name, of bending; form, of being afflicted; the six sense bases, of being a sphere; contact, of touching; feeling, of being felt; craving, of being a cause; clinging, of grasping; existence, of striving; birth, of arising; aging, of decay; and death, of passing away.

Vietnamese AI Translation

Vô minh có đặc tính không biết; các hành, có đặc tính cố ý; thức, có đặc tính nhận biết; danh, có đặc tính hướng về; sắc, có đặc tính bị bức hại; sáu xứ, có đặc tính là một lĩnh vực; xúc, có đặc tính chạm vào; thọ, có đặc tính được cảm nhận; ái, có đặc tính là một nguyên nhân; thủ, có đặc tính nắm giữ; hữu, có đặc tính nỗ lực; sanh, có đặc tính phát sanh; lão, có đặc tính suy tàn; và tử, có đặc tính qua đời.

AI Translation Nissaya

avijjāya=Of ignorance. ; aññāṇalakkhaṇaṃ=the characteristic of not knowing. ; saṅkhārānaṃ=of the meritorious, demeritorious, and imperturbable formations. ; cetanālakkhaṇaṃ=the characteristic of volition. ; viññāṇassa=of consciousness. ; vijānanalakkhaṇaṃ=the characteristic of cognizing. ; nāmassa=of name. ; namanalakkhaṇaṃ=the characteristic of bending towards the object. ; rūpassa=of form. ; ruppanalakkhaṇaṃ=the characteristic of being afflicted. ; saḷāyatanassa=of the six sense bases. ; āyatanalakkhaṇaṃ=the characteristic of being a sphere of origin. ; phassassa=of contact. ; phusanalakkhaṇaṃ=the characteristic of touching. ; vedanāya=of feeling. ; vedayitalakkhaṇaṃ=the characteristic of being felt. ; taṇhāya=of craving. ; hetulakkhaṇaṃ=the characteristic of being a cause. ; upādānassa=of the four kinds of clinging. ; gahaṇalakkhaṇaṃ=the characteristic of grasping. ; bhavassa=of kamma-existence. ; āyūhanalakkhaṇaṃ=the characteristic of striving. ; jātiyā=of the name-aggregates at rebirth and kamma-born matter. ; nibbattilakkhaṇaṃ=the characteristic of arising. ; jarāya=of aging. ; jīraṇalakkhaṇaṃ=the characteristic of decay. ; maraṇassa=of death. ; cutilakkhaṇaṃ=the characteristic of passing away. ;

Myanmar Nissaya

avijjāya=၏။ ; aññāṇalakkhaṇaṃ=သည်။ ; saṅkhārānaṃ=မုညာဘိသင်္ခါရ အပုညာဘိသင်္ခါရအာနေဉ္စာဘိသင်္ခါရတို့၏။ ; cetanālakkhaṇaṃ=စေ့ဆော်ခြင်း လက္ခဏာသည်။ ; viññāṇassa=၏။ ; vijānanalakkhaṇaṃ=သည်။ ; nāmassa=၏။ ; namanalakkhaṇaṃ=မိမိသို့ညွတ်စေခြင်း အာရုံသို့ ညွတ်စေခြင်း လက္ခဏာသည်။ ; rūpassa=၏။ ; ruppanalakkhaṇaṃ=သည်။ ; saḷāyatanassa=၏။ ; āyatanalakkhaṇaṃ=ဖြစ်ရာတည်ရာဟူသော လက္ခဏာသည်။ ; phassassa=၏။ ; phusanalakkhaṇaṃ=သည်။ ; vedanāya=၏။ ; vedayitalakkhaṇaṃ=သည်။ ; taṇhāya=၏။ ; hetulakkhaṇaṃ=အကြောင်းဟူသော လက္ခဏာသည်။ ; upādānassa=ဥပါဒါတရား လေးပါး၏။ ; gahaṇalakkhaṇaṃ=စွဲလမ်းခြင်း လက္ခဏာ သည်။ ; bhavassa=ကမ္မဘဝ၏။ ; āyūhanalakkhaṇaṃ=အားထုတ်ခြင်း လက္ခဏာသည်။ ; jātiyā=ပဋိသန္ဓေနာမက္ခန္ဓာ ကဋတ္တာရုပ်၏။ ; nibbattilakkhaṇaṃ=ဖြစ်ခြင်း လက္ခဏာသည်။ ; jarāya=၏။ ; jīraṇalakkhaṇaṃ=ရင့်ခြင်း လက္ခဏာသည်။ ; maraṇassa=၏။ ; cutilakkhaṇaṃ=ရွေ့လျားခြင်း လက္ခဏာ သည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3805 | Chunk: 64

Dhātūnaṃ suññatālakkhaṇaṃ, āyatanānaṃ āyatanalakkhaṇaṃ, satipaṭṭhānānaṃ upaṭṭhānalakkhaṇaṃ, sammappadhānānaṃ padahanalakkhaṇaṃ, iddhipādānaṃ ijjhanalakkhaṇaṃ, indriyānaṃ adhipatilakkhaṇaṃ, balānaṃ akampiyalakkhaṇaṃ, bojjhaṅgānaṃ niyyānalakkhaṇaṃ, maggassa hetulakkhaṇaṃ.

AI Translation based on Nissaya

The elements have the characteristic of emptiness; the sense bases, of being a sphere of origin; the foundations of mindfulness, of establishment; the right exertions, of striving; the bases of psychic power, of accomplishment; the faculties, of sovereignty; the powers, of being unshakable; the enlightenment factors, of leading out; and the path, of being a cause.

Vietnamese AI Translation

Các giới có đặc tính rỗng không; các xứ, có đặc tính là một lĩnh vực của sự sanh khởi; các niệm xứ, có đặc tính an lập; các chánh cần, có đặc tính nỗ lực; các như ý túc, có đặc tính thành tựu; các căn, có đặc tính tối thượng; các lực, có đặc tính không thể lay chuyển; các giác chi, có đặc tính dẫn ra; và đạo, có đặc tính là một nguyên nhân.

AI Translation Nissaya

dhātūnaṃ=Of the elements. ; suññatālakkhaṇaṃ=the characteristic of being empty of a self or living being. ; āyatanānaṃ=of the sense bases. ; āyatanalakkhaṇaṃ=the characteristic of being a sphere of origin. ; satipaṭṭhānaṃ=of the foundations of mindfulness. ; upaṭṭhānalakkhaṇaṃ=the characteristic of establishment. ; sammappadhānānaṃ=of the right exertions. ; padahanalakkhaṇaṃ=the characteristic of striving. ; iddhipādānaṃ=of the bases of psychic power. ; ijjhanalakkhaṇaṃ=the characteristic of accomplishment. ; indriyānaṃ=of the faculties. ; adhipatilakkhaṇaṃ=the characteristic of sovereignty. ; balānaṃ=of the powers. ; akampiyalakkhaṇaṃ=the characteristic of being unshakable. ; bojjhaṅgānaṃ=of the enlightenment factors. ; niyyānalakkhaṇaṃ=the characteristic of leading out. ; maggassa=of the eightfold path factors. ; hetulakkhaṇaṃ=the characteristic of being a cause. ;

Myanmar Nissaya

dhātūnaṃ=တို့၏။ ; suññatālakkhaṇaṃ=သတ္တဇီဝမှ ဆိတ်ခြင်း လက္ခဏာသည်။ ; āyatanānaṃ=တို့၏။ ; āyatanalakkhaṇaṃ=ဖြစ်ရာ တည်ရာဟူသော လက္ခဏာသည်။ ; satipaṭṭhānaṃ=တို့၏။ ; upaṭṭhānalakkhaṇaṃ=ထင်ခြင်း လက္ခဏာသည်။ ; sammappadhānānaṃ=တို့၏။ ; padahanalakkhaṇaṃ=အားထုတ်ခြင်း လက္ခဏာသည်။ ; iddhipādānaṃ=တို့၏။ ; ijjhanalakkhaṇaṃ=ပြည့်စုံခြင်း လက္ခဏာသည်။ ; indriyānaṃ=တို့၏။ ; adhipatilakkhaṇaṃ=အစိုးရခြင်း လက္ခဏာသည်။ ; balānaṃ=တို့၏။ ; akampiyalakkhaṇaṃ=မတုန်လှုပ်ခြင်း လက္ခဏာသည်။ ; bojjhaṅgānaṃ=တို့၏။ ; niyyānalakkhaṇaṃ=ထွက်မြောက်ခြင်း လက္ခဏာ သည်။ ; maggassa=မဂ္ဂင်ရှစ်ပါး၏။ ; hetulakkhaṇaṃ=အကြောင်းဟူသော လက္ခဏာသည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3806 | Chunk: 64

Saccānaṃ tathalakkhaṇaṃ, samathassa avikkhepalakkhaṇaṃ, vipassanāya anupassanālakkhaṇaṃ, samathavipassanānaṃ ekarasalakkhaṇaṃ, yuganaddhānaṃ anativattanalakkhaṇaṃ.

AI Translation based on Nissaya

The truths have the characteristic of being true; serenity, of non-distraction; insight, of repeated contemplation; serenity and insight, of having a single function; and serenity and insight yoked together, of not transgressing each other's function.

Vietnamese AI Translation

Các chân lý có đặc tính là chân thật; chỉ, có đặc tính không phân tán; quán, có đặc tính quán chiếu lặp đi lặp lại; chỉ và quán, có đặc tính có một chức năng duy nhất; và chỉ và quán được hợp nhất, có đặc tính không xâm phạm chức năng của nhau.

AI Translation Nissaya

saccānaṃ=Of the truths. ; tathalakkhaṇa=the characteristic of being true. ; samathassa=of serenity. ; avikkhepalakkhaṇaṃ=the characteristic of non-distraction. ; vipassanāya=of insight. ; anupassanālakkhaṇaṃ=the characteristic of repeated contemplation. ; samathavipassanānaṃ=of serenity and insight. ; ekarasalakkhaṇaṃ=the characteristic of having a single function. ; yuganaddhānaṃ=of serenity and insight yoked together. ; anativattanalakkhaṇaṃ=the characteristic of not transgressing each other's function. ;

Myanmar Nissaya

saccānaṃ=တို့၏။ ; tathalakkhaṇa=ဟုတ်မှန်သော လက္ခဏာသည်။ ; samathassa=၏။ ; avikkhepalakkhaṇaṃ=မပျံ့လွင့်ခြင်း လက္ခဏာသည်။ ; vipassanāya=၏။ ; anupassanālakkhaṇaṃ=တလုံလဲလဲရှုခြင်းလက္ခဏာသည်။ ; samathavipassanānaṃ=တို့၏။ ; ekarasalakkhaṇaṃ=တူသော ကိစ္စ ရှိသည်၏ အဖြစ်တည်းဟူသော လက္ခဏာသည်။ ; yuganaddhānaṃ=အစုံဖွဲ့အပ်သော သမထဝိပဿနာတို့၏။ ; anativattanalakkhaṇaṃ=အချင်းချင်း မလွန်ခြင်း လက္ခဏာသည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3807 | Chunk: 64

Sīlavisuddhiyā saṃvaralakkhaṇaṃ, cittavisuddhiyā avikkhepalakkhaṇaṃ, diṭṭhivisuddhiyā dassanalakkhaṇaṃ.

AI Translation based on Nissaya

The purification of virtue has the characteristic of restraint; the purification of mind, of non-distraction; and the purification of view, of seeing.

Vietnamese AI Translation

Giới thanh tịnh có đặc tính chế ngự; tâm thanh tịnh, có đặc tính không phân tán; và kiến thanh tịnh, có đặc tính thấy.

AI Translation Nissaya

sīlavisuddhiyā=Of the purification of virtue. ; saṃvaralakkhaṇaṃ=the characteristic of restraint. ; cittavisuddhiyā=of the purification of mind. ; avikkhepalakkhaṇaṃ=the characteristic of non-distraction. ; diṭṭhinisuddhiyā=of the purification of view. ; dassana lakkhaṇaṃ=the characteristic of seeing the four truths. ;

Myanmar Nissaya

sīlavisuddhiyā=၏။ ; saṃvaralakkhaṇaṃ=စောင့်ရှောက် ပိတ်ပင်ခြင်း လက္ခဏာသည်။ ; cittavisuddhiyā=၏။ ; avikkhepalakkhaṇaṃ=မပျံ့လွင့်ခြင်း လက္ခဏာသည်။ ; diṭṭhinisuddhiyā=၏။ ; dassana lakkhaṇaṃ=သစ္စာလေးပါးကိုမြင်ခြင်း လက္ခဏာသည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3808 | Chunk: 64

Khaye [M1.194] ñāṇassa samucchedalakkhaṇaṃ, anuppāde ñāṇassa passaddhilakkhaṇaṃ.

AI Translation based on Nissaya

The knowledge of destruction has the characteristic of cutting off; the knowledge of non-arising has the characteristic of pacification.

Vietnamese AI Translation

Tận trí có đặc tính đoạn trừ; vô sanh trí có đặc tính tịch tịnh.

AI Translation Nissaya

khaye ñāṇassa=Of the knowledge of destruction. ; samucchedalakkhaṇaṃ=the characteristic of cutting off the root of the cycle of existence. ; anuppādeñāṇassa=of the knowledge of non-arising. ; passaddhilakkhaṇaṃ=the characteristic of the pacification of the suffering of the cycle. ;

Myanmar Nissaya

khaye ñāṇassa=၏။ ; samucchedalakkhaṇaṃ=ဝဋ်မြစ်ကို ဖြတ်ခြင်း လက္ခဏာသည်။ ; anuppādeñāṇassa=၏။ ; passaddhilakkhaṇaṃ=ဝဋ်ဆင်းရဲတို့၏ ငြိမ်းခြင်း လက္ခဏာသည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3809 | Chunk: 64

Chandassa mūlalakkhaṇaṃ, manasikārassa samuṭṭhānalakkhaṇaṃ, phassassa samodhānalakkhaṇaṃ, vedanāya samosaraṇalakkhaṇaṃ, samādhissa pamukhalakkhaṇaṃ, satiyā ādhipateyyalakkhaṇaṃ, paññāya tatuttarilakkhaṇaṃ, vimuttiyā sāralakkhaṇaṃ, amatogadhassa nibbānassa pariyosānalakkhaṇaṃ tathaṃ avitathaṃ.

AI Translation based on Nissaya

Desire has the characteristic of being the root; attention, of originating; contact, of coming together; feeling, of converging; concentration, of being foremost; mindfulness, of being dominant; wisdom, of being superior; liberation, of being the essence; and Nibbāna, which has the Deathless as its resort, has the true and unerring characteristic of being the end.

Vietnamese AI Translation

Dục có đặc tính là gốc rễ; tác ý, có đặc tính khởi nguồn; xúc, có đặc tính hội tụ; thọ, có đặc tính tụ lại; định, có đặc tính đứng đầu; niệm, có đặc tính chi phối; tuệ, có đặc tính vượt trội; giải thoát, có đặc tính là tinh yếu; và Niết-bàn, với Bất tử là nơi trú ngụ, có đặc tính chân thật và không sai khác là sự kết thúc.

AI Translation Nissaya

chandassa=Of desire. ; mūlalakkhaṇaṃ=the characteristic of being the root of the cycle of existence. ; manasikārassa=of attention. ; samuṭṭhānalakkhaṇaṃ=the characteristic of originating well. ; phassassa=of contact. ; samodhānalakkhaṇaṃ=the characteristic of coming together. ; vedanāya=of feeling. ; samosaraṇalakkhaṇaṃ=the characteristic of converging. ; samādhissa=of concentration. ; pamukhalakkhaṇaṃ=the characteristic of being foremost. ; satiyā=of mindfulness. ; ādhipateyya lakkhaṇaṃ=the characteristic of being dominant. ; paññāya=of wisdom. ; tatuttharilakkhaṇaṃ=the characteristic of being superior to that concentration. ; vimuttiyā=of liberation. ; sāralakkhaṇaṃ=the characteristic of being the essence. ; amatogadhassa=which has the Deathless as its resort. ; nibbānassa=of Nibbāna. ; tathaṃ=the true. ; avitathaṃ=unerring. ; yaṃ pariyosānalakkhaṇaṃ=which characteristic is the end of the cycle of phenomena. ; atthi=there is. ;

Myanmar Nissaya

chandassa=တဏှာ၏။ ; mūlalakkhaṇaṃ=ဝဋ်မြစ်ဟူသော လက္ခဏာသည်။ ; manasikārassa=၏။ ; samuṭṭhānalakkhaṇaṃ=ကောင်းစွာဖြစ်ခြင်း လက္ခဏာသည်။ ; phassassa=၏။ ; samodhānalakkhaṇaṃ=ပေါင်းခြင်း လက္ခဏာသည်။ ; vedanāya=၏။ ; samosaraṇalakkhaṇaṃ=စုဝေးခြင်း လက္ခဏာသည်။ ; samādhissa=၏။ ; pamukhalakkhaṇaṃ=အဦးအစဟူသော လက္ခဏာသည်။ ; satiyā=၏။ ; ādhipateyya lakkhaṇaṃ=အကြီးအမှူးဟူသော လက္ခဏာသည်။ ; paññāya=၏။ ; tatuttharilakkhaṇaṃ=ထိုသမာဓိ တို့ထက်လွန်သော လက္ခဏာသည်။ ; vimuttiyā=၏။ ; sāralakkhaṇaṃ=မြတ်သော လက္ခဏာသည်။ ; amatogadhassa=အမတဟု ဆိုသော တည်ရာဖြစ်၍ ဖြစ်သော။ ; nibbānassa=၏။ ; tathaṃ=ဟုတ်မှန်သော။ ; avitathaṃ=မချွတ်ယွင်းသော။ ; yaṃ pariyosānalakkhaṇaṃ=အကြင်ဝဋ်တရား၏ ဆုံးရာဟူသော လက္ခဏာသည်။ ; atthi=ရှိ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3810 | Chunk: 64

Etaṃ tathalakkhaṇaṃ ñāṇagatiyā āgato avirajjhitvā patto anuppattoti tathāgato.

AI Translation based on Nissaya

He has come to, reached, and fully attained this true characteristic through the course of his knowledge, without failure; therefore, he is the Tathāgata.

Vietnamese AI Translation

Ngài đã đến, đã đạt đến, và đã hoàn toàn thành tựu đặc tính chân thật này thông qua tiến trình của trí tuệ Ngài, không thất bại; do đó, Ngài là Như Lai.

AI Translation Nissaya

etaṃ tathalakkhaṇaṃ=to this true characteristic. ; ñāṇagatiyā=by way of the course of his knowledge. ; āgato=he has come. ; avirajjhitvā=without failure. ; patto=he has reached. ; anuppatto=he has fully attained. ; ititasmā=therefore. ; tathāgato=he is called Tathāgata. ;

Myanmar Nissaya

etaṃ tathalakkhaṇaṃ=ထိုဟုတ်မှန်သော လက္ခဏာကို။ ; ñāṇagatiyā=ဉာဏ်တော်၏ အလားဖြင့်။ ; āgato=လာတော်မူ၏။ ; avirajjitvā=မချွတ်ယွင်းမူ၍။ ; patto=ရောက်တော်မူ၏။ ; anuppatto=အစဉ်ရောက်တော်မူ၏။ ; ititasmā=ကြောင့်။ ; tathāgato=မည်တော်မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3811 | Chunk: 64

Evaṃ tathalakkhaṇaṃ āgatoti tathāgato.

AI Translation based on Nissaya

Thus, he is the Tathāgata because 'he has come to the true characteristic'.

Vietnamese AI Translation

Như vậy, Ngài là Như Lai vì 'Ngài đã đến được với đặc tính chân thật'.

AI Translation Nissaya

eva=thus. ; tathalakkhaṇaṃ āgatotivacanatthena=due to the meaning 'he has come to the true characteristic'. ; tathāgato=he is called Tathāgata. ;

Myanmar Nissaya

eva=ဤသို့။ ; tathalakkhaṇaṃ āgatotivacanatthena=တထလက္ခဏံ အာဂတော ဤသို့သော ဝစနတ္ထကြောင့်။ ; tathāgato=မည်တော်မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3812 | Chunk: 64

Kathaṃ [V1.178] tathadhamme yāthāvato abhisambuddhoti tathāgato ?

AI Translation based on Nissaya

How is he the Tathāgata in the sense that 'he has fully awakened to the true phenomena as they really are'?

Vietnamese AI Translation

Làm thế nào Ngài là Như Lai theo nghĩa là 'Ngài đã hoàn toàn giác ngộ các pháp chân thật như chúng thực sự là'?

AI Translation Nissaya

kathaṃ=how. ; tathadhamme=the true phenomena. ; yāthāvato=actually, as they are. ; abhisambuddho=he has fully awakened to. ; itiimināvacanatthena=due to this meaning. ; tathāgato=is he called Tathāgata?. ;

Myanmar Nissaya

kathaṃ=အတီသို့လျှင်။ ; tathadhamme=ဟုတ်မှန်သော သဘောတို့ကို။ ; yāthāvato=ဟုတ်မှန်သော အားဖြင့်။ ; abhisambuddho=ထိုးထွင်း၍ သိတော်မူ၏။ ; itiimināvacanatthena=ကြောင့်။ ; tathāgato=မည်တော်မူသနည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3813 | Chunk: 64

Tathadhammā nāma cattāri ariyasaccāni.

AI Translation based on Nissaya

'True phenomena' refers to the Four Noble Truths.

Vietnamese AI Translation

'Các pháp chân thật' ám chỉ Tứ Diệu Đế.

AI Translation Nissaya

tathadhammānāma=What are called 'true phenomena'. ; cattāri=are the four. ; ariyasaccāni=Noble Truths. ;

Myanmar Nissaya

tathadhammānāma=ဟုတ်မှန်သော တရားတို့မည်သည်ကား။ ; cattāri=ကုန်သော။ ; ariyasaccāni=တို့တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3814 | Chunk: 64

Yathāha –

AI Translation based on Nissaya

As it is said:

Vietnamese AI Translation

Như đã được nói:

AI Translation Nissaya

yathāha=as it is said. ;

Myanmar Nissaya

yathāha=ဟူမူကား။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3815 | Chunk: 64

‘‘cattārimāni, bhikkhave, tathāni avitathāni anaññathāni.

AI Translation based on Nissaya

‘Bhikkhus, these four things are true, not false, not otherwise.

Vietnamese AI Translation

‘Này các Tỳ-khưu, bốn điều này là chân thật, không sai khác, không khác đi.

AI Translation Nissaya

cattārimāni=these four. ; .la.=... . ;

Myanmar Nissaya

cattārimāni= ; .la.= ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3816 | Chunk: 64

‘ Idaṃ dukkhan ’ ti, bhikkhave, tathametaṃ avitathametaṃ anaññathametan’’ ti ( saṃ. ni. 5.1090) vitthāro.

AI Translation based on Nissaya

‘Bhikkhus, “This is suffering”: this is true, this is not false, this is not otherwise.’’ (saṃ. ni. 5.1090) The full version should be understood.

Vietnamese AI Translation

‘Này các Tỳ-khưu, “Đây là khổ”: đây là chân thật, đây không sai khác, đây không khác đi.’’ (saṃ. ni. 5.1090) Phiên bản đầy đủ cần được hiểu rõ.

AI Translation Nissaya

metanti=...it is not otherwise. ; āha=he said. ; iti=thus. ; vitthāro=the full version. ; veditabbo=should be understood. ; bhikkhave=Bhikkhus. ; cattāri=four. ; imāni=these things. ; tathāni=are true. ; avitathāni=are not false. ; anuññathāni=are not otherwise. ; cattāri=four. ; katamāni=what are they?. ; bhikkhave=Bhikkhus. ; idaṃ=this. ; dukkhaṃ=is the nature of the truth of suffering. ; iti=thus. ; atthajātaṃ=this kind of meaning. ; tathaṃ=is true. ; etaṃ atthajātaṃ=this meaning. ; avitathaṃ=is not false. ; etaṃ atthajātaṃ=this meaning. ; anaññathaṃ=is not otherwise. ;

Myanmar Nissaya

metanti=ဟူ၍။ ; āha=၏။ ; iti=သို့။ ; vitthāro=အကျယ်ကို။ ; veditabbo=၏။ ; bhikkhave=တို့။ ; cattāri=ကုန်သော။ ; imāni=ဤတရားတို့သည်။ ; tathāni=ကုန်၏။ ; avitathāni=မချွတ်ယွင်းကုန်။ ; anuññathāni=တပါးသော အခြင်းအရာအားဖြင့်မဖြစ်ကုန်။ ; cattāri=ဟူသည်။ ; katamāni=နည်း။ ; bhikkhave=တို့။ ; idaṃ=ဤသည်ကား။ ; dukkhaṃ=ဒုက္ခသစ္စာ၏ သဘောတည်း။ ; iti=သို့။ ; atthajātaṃ=ဤသို့သော အနက်သဘောသည်။ ; tathaṃ=၏။ ; etaṃ atthajātaṃ=သည်။ ; avitathaṃ=မချွတ်မယွင်း။ ; etaṃ atthajātaṃ=သည်။ ; anaññathaṃ=တပါးသော အခြင်းအရာအားဖြင့်မဖြစ်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3817 | Chunk: 64

Tāni ca bhagavā abhisambuddhoti tathānaṃ abhisambuddhattā tathāgatoti vuccati.

AI Translation based on Nissaya

And the Blessed One has fully awakened to those things; thus, because he has fully awakened to what is true, he is called 'Tathāgata'.

Vietnamese AI Translation

Và đức Thế Tôn đã hoàn toàn giác ngộ những điều đó; như vậy, vì Ngài đã hoàn toàn giác ngộ những gì là chân thật, Ngài được gọi là 'Như Lai'.

AI Translation Nissaya

tāni=Those true phenomena. ; bhagavā=the Blessed One. ; abhisambuddho=has fully awakened to. ; iti=thus. ; tathānaṃ=of the true things. ; vā=or 'to the true things'. ; abhisambuddhattā=because of having fully awakened. ; tathāgatoti=as 'Tathāgata'. ; vuccati=he is called. ;

Myanmar Nissaya

tāni=ထိုဟုတ်မှန်သော သဘောတို့ကို။ ; bhagavā=သည်။ ; abhisambuddho=မည်၏။ ; iti=သို့။ ; tathānaṃ=တို့၏။ ; vā=တို့ကို။ ; abhisambuddhattā=ကြောင့်။ ; tathāgatoti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3818 | Chunk: 64

Abhisambodhattho hi ettha gatasaddo.

AI Translation based on Nissaya

Indeed, here the word 'gata' (gone) has the meaning of full awakening.

Vietnamese AI Translation

Thật vậy, ở đây từ 'gata' (đã đi) có nghĩa là sự giác ngộ hoàn toàn.

AI Translation Nissaya

hi saccaṃ=Indeed. ; ettha=in this term 'Tathāgata'. ; gatasaddo=the word 'gata' (gone). ; abhisambodhattho=has the meaning of full awakening. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; ettha=ဤတထာဂတော ဟူသော ပုဒ်၌။ ; gatasaddo=သည်။ ; abhisambodhattho=ထိုးထွင်း၍ သိခြင်းအနက်ရှိ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3819 | Chunk: 64

Apica jarāmaraṇassa jātipaccayasambhūtasamudāgataṭṭho tatho avitatho anaññatho … pe … saṅkhārānaṃ avijjāpaccayasambhūtasamudāgataṭṭho tatho avitatho anaññatho.

AI Translation based on Nissaya

Furthermore, the fact that aging and death arise and come to be with birth as their condition is true, not false, not otherwise... the fact that formations arise and come to be with ignorance as their condition is true, not false, not otherwise.

Vietnamese AI Translation

Hơn nữa, sự thật rằng lão và tử khởi sanh và hiện hữu với sanh làm điều kiện là chân thật, không sai khác, không khác đi... sự thật rằng các hành khởi sanh và hiện hữu với vô minh làm điều kiện là chân thật, không sai khác, không khác đi.

AI Translation Nissaya

apica=Furthermore. ; jarāmaraṇassa=of aging and death. ; jātipaccayasambhūtasamudāgataṭṭho=the meaning of arising and coming into being from birth as its condition. ; tatho=is true. ; avitatho=not false. ; anaññatho=not otherwise. ; la=... . ; saṅkhārānaṃ=of formations. ; avijjāpaccayasambhūtasamudāgataṭṭho=the meaning of arising and coming into being from ignorance as its condition. ; tatho=is true. ; avitatho=not false. ; anaññatho=not otherwise. ;

Myanmar Nissaya

apica=တနည်းလည်း။ ; jarāmaraṇassa=၏။ ; jātipaccayasambhūtasamudāgataṭṭho=ဇာတိ ဟူသော အကြောင်းကြောင့်ဖြစ်သည်၏ မိမိအကြောင်းအားလျော်စွာ အထက် အထက်၌ ဖြစ်ခြင်းဟူသော အနက်သည်။ ; tatho=၏။ ; avitatho=မယွင်း။ ; anaññatho=မဖြစ်။ ; la= ; saṅkhārānaṃ=တို့၏။ ; avijjāpaccayasambhūtasamudāgataṭṭho=အဝိဇ္ဇာဟူသော အကြောင်းကြောင့် ဖြစ်သည်ဖြစ်၍ မိမိ၏အကြောင်းအားလျော်စွာ အထက်အထက်၌ ဖြစ်ခြင်းဟူသော အနက်သည်။ ; tatho=၏။ ; avitatho=ယွင်း။ ; anaññatho=ဖြစ်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3820 | Chunk: 64

Tathā avijjāya saṅkhārānaṃ paccayaṭṭho tatho avitatho anaññatho … pe … jātiyā jarāmaraṇassa [P1.211] paccayaṭṭho tatho avitatho anaññatho.

AI Translation based on Nissaya

Likewise, the fact that ignorance is a condition for formations is true, not false, not otherwise... the fact that birth is a condition for aging and death is true, not false, not otherwise.

Vietnamese AI Translation

Tương tự như vậy, sự thật rằng vô minh là điều kiện cho các hành là chân thật, không sai khác, không khác đi... sự thật rằng sanh là điều kiện cho lão và tử là chân thật, không sai khác, không khác đi.

AI Translation Nissaya

tathā=Moreover. ; avijjāya=of ignorance. ; saṅkhārānaṃ=for formations. ; paccayaṭṭho=the meaning of being a condition. ; tatho=is true. ; avitatho=not false. ; anaññatho=not otherwise. ; jātiyā=of birth. ; jarāmaraṇassa=for aging and death. ; paccayaṭṭho=the meaning of being a condition. ; tatho=is true. ; avitatho=not false. ; anaññatho=not otherwise. ;

Myanmar Nissaya

tathā=ထိုမှ တပါး။ ; avijjāya=၏။ ; saṅkhārānaṃ=တို့အား။ ; paccayaṭṭho=ကျေးဇူးပြုတတ်သော အနက်သည်။ ; tatho=၏။ ; avitatho=ယွင်း။ ; anaññatho=ဖြစ်။ ; jātiyā=ဖြင့်။ ; jarāmaraṇassa=၏။ ; paccayaṭṭho=အကြောင်းဟူသော အနက်သည်။ ; tatho=၏။ ; avitatho=ယွင်း။ ; anaññatho=ဖြစ်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3821 | Chunk: 64

Taṃ sabbaṃ bhagavā abhisambuddho.

AI Translation based on Nissaya

The Blessed One has fully awakened to all of that.

Vietnamese AI Translation

Đức Thế Tôn đã hoàn toàn giác ngộ tất cả những điều đó.

AI Translation Nissaya

taṃ sabbaṃ=All of that. ; bhagavā=the Blessed One. ; abhisambuddho=has fully awakened to. ;

Myanmar Nissaya

taṃ sabbaṃ=ကို။ ; bhagavā=သည်။ ; abhisambuddho=မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3822 | Chunk: 64

Tasmāpi tathānaṃ abhisambuddhattā tathāgato.

AI Translation based on Nissaya

Therefore, also because he has fully awakened to these true things, he is the Tathāgata.

Vietnamese AI Translation

Do đó, cũng vì Ngài đã hoàn toàn giác ngộ những điều chân thật này, Ngài là Như Lai.

AI Translation Nissaya

tathānaṃ=to the true nature of causes like birth and effects like formations. ; tasmāpi abhisambuddhattā=also because of having fully awakened in this way. ; tathāgato=he is called Tathāgata. ;

Myanmar Nissaya

tathānaṃ=ဇာတိအစရှိသော အကြောင်း သင်္ခါရ အစရှိသော အကျိုးတို့၏ ဟုတ်မှန်စွာ ဖြစ်ခြင်းတို့ကို။ ; tasmāpi abhisambuddhattā=ထိုသို့ထိုးထွင်း၍ သိတော်မူသည်၏ အဖြစ်ကြောင့်လည်း။ ; tathāgato=မည်တော်မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3823 | Chunk: 64

Evaṃ tathadhamme yāthāvato abhisambuddhoti tathāgato.

AI Translation based on Nissaya

Thus, because he has fully awakened to the true phenomena as they really are, he is the Tathāgata.

Vietnamese AI Translation

Như vậy, vì Ngài đã hoàn toàn giác ngộ các pháp chân thật như chúng thực sự là, Ngài là Như Lai.

AI Translation Nissaya

evaṃ=thus. ; tathadhamme=the true phenomena. ; yāthāvato=as they really are. ; abhisambuddho=he has fully awakened to. ; iti tasmā=therefore. ; tathāgato=he is called Tathāgata. ;

Myanmar Nissaya

evaṃ=သို့။ ; tathadhamme=ဟုတ်မှန်သော သဘောတရားတို့ကို။ ; yāthāvato=အားဖြင့်။ ; abhisambuddho=မူ၏။ ; iti tasmā=ကြောင့်။ ; tathāgato=မည်တော်မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3824 | Chunk: 64

Kathaṃ tathadassitāya tathāgato ?

AI Translation based on Nissaya

How is he the Tathāgata on account of seeing what is true?

Vietnamese AI Translation

Làm thế nào Ngài là Như Lai vì thấy được điều chân thật?

AI Translation Nissaya

kathaṃ=how. ; tathadassitāya=due to the fact of seeing what is true. ; tathāgato=is he the Tathāgata?. ;

Myanmar Nissaya

kathaṃ=လျှင်။ ; tathadassitāya=ဟုတ်မှန်သော သဘောကို သိမြင်တော်မူသည်၏ အဖြစ်ကြောင့်။ ; tathāgato=မည်သနည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3825 | Chunk: 64

Bhagavā yaṃ sadevake loke … pe … sadevamanussāya aparimāṇāsu lokadhātūsu aparimāṇānaṃ sattānaṃ cakkhudvāre āpāthaṃ āgacchantaṃ rūpārammaṇaṃ nāma atthi, taṃ sabbākārena jānāti passati.

AI Translation based on Nissaya

Whatever form-object there is that comes into the range of the eye-door of immeasurable beings in immeasurable world-systems, in the world with its gods... up to... in the world with its humans and devas, the Blessed One knows and sees it in all its aspects.

Vietnamese AI Translation

Bất cứ sắc cảnh nào đi vào phạm vi của nhãn môn của vô số chúng sanh trong vô lượng thế giới hệ, trong thế giới với các vị trời... cho đến... trong thế giới với loài người và chư thiên, đức Thế Tôn đều biết và thấy nó trong mọi khía cạnh của nó.

AI Translation Nissaya

bhagavā=the Blessed One. ; sadevake=with its gods. ; lāke=in the world-sphere. ; la=... . ; sadevamanussāya=in the world of beings with its humans and devas (conventionally called gods). ; aparimāṇāsu=in immeasurable. ; lokadhātusu=world-systems. ; aparimāṇānaṃ=of immeasurable. ; sattānaṃ=beings. ; cakkhudvāre=in the eye-door. ; āpāthaṃ=into the range. ; āgacchantaṃ=that comes. ; yaṃ rūpārammaṇaṃnāma=whatever form-object. ; atthi=there is. ; taṃrūpārammaṇaṃ=that form-object. ; sabbākārena=in all its aspects. ; jānāti=he knows. ; passati=he sees. ;

Myanmar Nissaya

bhagavā=သည်။ ; sadevake=နတ်ပြည်နှင့်တကွသော။‌ေ ; lāke=ဩကသလောက၌။ ; la= ; sadevamanussāya=သမ္မုတိ နတ်တည်းဟူသော မင်းကြွင်းသော လူနှင့် တကွသော သတ္တလောက၌။ ; aparimāṇāsu=အတိုင်းအရှည်မရှိကုန်သော။ ; lokadhātusu=လောကဓာတ်တို့၌။ ; aparimāṇānaṃ=ကုန်သော။ ; sattānaṃ=တို့၏။ ; cakkhudvāre=၌။ ; āpāthaṃ=သို့။ ; āgacchantaṃ=သော။ ; yaṃ rūpārammaṇaṃnāma=မည်သည်။ ; atthi=ရှိ၏။ ; taṃrūpārammaṇaṃ=ကို။ ; sabbākārena=ဥဿုံသော အခြင်းအရာအားဖြင့်။ ; jānāti=သိ၏။ ; passati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3826 | Chunk: 64

Evaṃ jānatā passatā ca tena taṃ iṭṭhāniṭṭhādivasena vā diṭṭhasutamutaviññātesu labbhamānakapadavasena vā ‘‘katamaṃ taṃ rūpaṃ rūpāyatanaṃ ?

AI Translation based on Nissaya

And knowing and seeing it thus, that Blessed One, whether by way of its being desirable, undesirable, and so on, or by way of the terms obtainable among the seen, heard, sensed, and cognized, [describes it thus]: 'What is that form which is the form base?

Vietnamese AI Translation

Và khi biết và thấy nó như vậy, vị Thế Tôn ấy, dù theo cách nó là khả ái, không khả ái, v.v., hoặc theo các thuật ngữ có thể có được trong số những gì được thấy, nghe, cảm nhận và nhận biết, [mô tả nó như sau]: 'Sắc nào là sắc xứ?

AI Translation Nissaya

evaṃ=thus. ; jānatā jānantenaca=and by knowing. ; passatā passantenaca=and by seeing. ; tena bhagavā=that Blessed One. ; iṭṭhāniṭṭhādivasenavā=either by way of being desirable, undesirable, and so on. ; diṭṭhasutamutaviññātesu=among the seen, heard, sensed, and cognized. ; labbhamānakapadavasenavā=or by way of the terms that can be obtained. ; katamaṃ.la.=what... [etc.]. ;

Myanmar Nissaya

evaṃ=သော။ ; jānatā jānantenaca=သော။ ; passatā passantenaca=သော။ ; tena bhagavā=သည်။ ; iṭṭhāniṭṭhādivasenavā=ဣဋ္ဌအနိဋ္ဌ အစရှိသည်တို့၏ အစွမ်းဖြင့် လည်းကောင်း။ ; diṭṭhasutamutaviññātesu=ဒိဋ္ဌပုဒ် သုတပုဒ် မုတပုဒ် ဝိညာတပုဒ်တို့တွင်။ ; labbhamānakapadavasenavā=ရအပ်သော ပုဒ်၏ အစွမ်းအားဖြင့်လည်းကောင်း။ ; katamaṃ.la.= ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3827 | Chunk: 64

Yaṃ rūpaṃ catunnaṃ mahābhūtānaṃ upādāya vaṇṇanibhā sanidassanaṃ sappaṭighaṃ nīlaṃ pītakan’’ tiādinā ( dha. sa. 616) nayena anekehi nāmehi terasahi vārehi dvipaññāsāya nayehi vibhajjamānaṃ tathameva hoti, vitathaṃ natthi [M1.195].

AI Translation based on Nissaya

That form which is a derivative of the four great elements, which has a visible appearance, is impingent, blue, yellow, etc.’ (dha. sa. 616) — analyzed by him in this way, with many names, with thirteen sections, with fifty-two methods, it is just so; there is nothing false about it.

Vietnamese AI Translation

Sắc ấy là sắc do tứ đại tạo thành, có hình tướng có thể thấy được, có sự va chạm, màu xanh, màu vàng, v.v.’ (dha. sa. 616) — được Ngài phân tích theo cách này, với nhiều tên gọi, với mười ba phần, với năm mươi hai phương pháp, nó chỉ là như vậy; không có gì sai lạc về nó.

AI Translation Nissaya

pītakanti ādinā=beginning with 'yellow', etc. ; nayena=by the method taught in the Dhammasaṅgaṇī scripture. ; anekehi=with many. ; nāmehi=names. ; terasahi=with thirteen. ; vārehi=sections which appear in the Rūpakaṇḍa. ; dvipaññāsābha=with fifty-two. ; nayehivā=or by methods. ; (In each of the sections, by way of the four methods of establishment, there are fifty-two methods - Old Sīlakkhandha Ṭīkā.) ; viyajjāmānaṃ=being analyzed by him. ; taṃ=that form-object. ; tathameva=is just so. ; hoti=it is. ; vitathaṃ=falseness. ; natthi=there is not. ;

Myanmar Nissaya

pītakanti ādinā=သော။ ; nayena=ဓမ္မသင်္ဂဏီပါဠိတော်၌ ဟောတော်မူအပ်သော နည်းဖြင့်။ ; anekehi=ကုန်သော။ ; nāmehi=တို့ဖြင့်လည်းကောင်း။ ; terasahi=ကုန်သော။ ; vārehi=ရူပကဏ္ဍ၌လာသော ဝါရတို့ဖြင့် လည်းကောင်း။ ; dvipaññāsābha=သော။ ; nayehivā=လည်းကောင်း။ ; (ဧကေကသ္မိဉ္စ ဝါရေ စတုန္နံ ဝတ္ထာပနနယာနံ ဝသေန ဒွိပညာသာယ နယေဟိ သီလက္ခန် ဋီကာဟောင်း။) ; viyajjāmānaṃ=ဝေဖန်တော်မူအပ်သော။ ; taṃ=ထိုရူပါရုံမည်သည်။ ; tathameva=လျှင်။ ; hoti=၏။ ; vitathaṃ=ခြင်းသည်။ ; natthi=မရှိ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3828 | Chunk: 64

Esa nayo sotadvārādīsupi āpāthamāgacchantesu saddādīsu.

AI Translation based on Nissaya

This same method applies to sounds and other objects that come into the range of the ear-door and so on.

Vietnamese AI Translation

Phương pháp tương tự này áp dụng cho các âm thanh và các đối tượng khác đi vào phạm vi của nhĩ môn, v.v.

AI Translation Nissaya

taṃṭhānaṃ=that thing. ; katamaṃ=what?. ; rūpāyatanaṃ=form base. ; atthi=is. ; yaṃ rūpaṃ=which form. ; catunnaṃ=of the four. ; mahābhūtānaṃ=great elements. ; upādāya=is derivative. ; vaṇṇanibhā=is color, appearance. ; (Agrees with niyama). ; pītakaṃ=is yellow. ; sotadvārādīsupi=in the ear-door, etc. also. ; āpāthaṃ=into the range. ; āgacchantesu=that come. ; saddādīsu=in sound-objects, etc. ; esa eso nayo=this is the method. ; ca saddaṃ=and the word. ; bhagavā=the Blessed One. ; yaṃ bhikkhave.la. upaṭṭhāsīti=which is 'Bhikkhus...he attended to'. ; etampivacanaṃ=this saying also. ; (aṅguttara nikāye=in the Aṅguttara Nikāya. ; catukkanipāte=in the book of Fours.) ; vuttaṃ=was said. ;

Myanmar Nissaya

taṃṭhānaṃ=ထိုရူပါရုံသည်။ ; katamaṃ=နည်း။ ; rūpāyatanaṃ=ရူပါယတနသည်။ ; atthi=၏။ ; yaṃ rūpaṃ=သည်။ ; catunnaṃ=ကုန်သော။ ; mahābhūtānaṃ=တို့ကို။ ; upādāya=၍။ ; vaṇṇanibhā=ဖြစ်သော အရောအဆင်းတည်း။ ; (နိယံနှင့် ညီ၏)။ ; pītakaṃ=ရွှေ၏။ ; sotadvārādīsupi=တို့၌လည်း။ ; āpāthaṃ=သို့။ ; āgacchantesu=ကုန်သော။ ; saddādīsu=သဒ္ဒါရုံ အစရှိသည်တို့၌။ ; esa eso nayo=တည်း။ ; ca saddaṃ=၏။ ; bhagavā=သည်။ ; yaṃ bhikkhave.la. upaṭṭhāsīti=ဟူသော။ ; etampivacanaṃ=ကိုလည်း။ ; (aṅguttara nikāye=၌။ ; catukkanipāte=၌။) ; vuttaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3829 | Chunk: 64

Vuttampi cetaṃ bhagavatā ‘‘yaṃ, bhikkhave, sadevakassa lokassa … pe … sadevamanussāya diṭṭhaṃ sutaṃ mutaṃ viññātaṃ pattaṃ pariyesitaṃ anuvicaritaṃ manasā, tamahaṃ jānāmi, tamahaṃ abbhaññāsiṃ, taṃ tathāgatassa viditaṃ, taṃ tathāgato na upaṭṭhāsī’’ ti ( a. ni. 4.24).

AI Translation based on Nissaya

And this was also said by the Blessed One: ‘Bhikkhus, whatever in the world with its devas... up to... with its humans and devas is seen, heard, sensed, cognized, attained, sought, and pondered over by the mind—that I know, that I have directly known. That is known to the Tathāgata, but the Tathāgata is not defined by that.’ (a. ni. 4.24).

Vietnamese AI Translation

Và điều này cũng đã được đức Thế Tôn nói: ‘Này các Tỳ-khưu, bất cứ điều gì trong thế giới với chư thiên... cho đến... với loài người và chư thiên được thấy, nghe, cảm nhận, nhận biết, đạt được, tìm kiếm, và suy xét bởi tâm—điều đó Ta biết, điều đó Ta đã trực tiếp biết. Điều đó được Như Lai biết, nhưng Như Lai không bị định nghĩa bởi điều đó.’ (a. ni. 4.24).

AI Translation Nissaya

bhikkhave=Bhikkhus. ; sadevakassa=of the world with its devas. ; lokassa=the world of beings. ; la=... . ; sadevamanussaūya=of the world with its humans and devas. ; diṭṭhaṃ=what is seen. ; sutaṃ=what is heard. ; mutaṃ=what is sensed. ; viññātaṃ=what is cognized. ; pattaṃ=what is attained. ; pariyesitaṃ=what is sought. ; manasā=by the mind. ; anuvicaritaṃ=what is pondered over. ; yaṃ ārammaṇaṃ=whatever object. ; atthi=there is. ; taṃ ārammaṇaṃ=that object. ; ahaṃ=I. ; jānāmi=know. ; taṃ ārammaṇaṃ=that object. ; ahaṃ=I. ; abbhaññāsiṃ=have directly known. ; taṃ ārammaṇaṃ=that object. ; tathāgatassa=by the Tathāgata. ; viditaṃ=is known. ; taṃ ārammaṇaṃ=that object. ; tathāgatassa=to the Tathāgata. ; upaṭṭhāti=is not attended to. ;

Myanmar Nissaya

bhikkhave=တို့။ ; sadevakassa=သော။ ; lokassa=သတ္တလောကသည်။ ; la= ; sadevamanussaūya=လူသည်။ ; diṭṭhaṃ=သော။ ; sutaṃ=သော။ ; mutaṃ=တွေ့အပ်သော။ ; viññātaṃ=သော။ ; pattaṃ=သော။ ; pariyesitaṃ=အပ်သော။ ; manasā=ဖြင့်။ ; anuvicaritaṃ=တလုံလဲလဲ ဆင်ခြင်အပ်သော။ ; yaṃ ārammaṇaṃ=သည်။ ; atthi=၏။ ; taṃ ārammaṇaṃ=ကို။ ; ahaṃ=သည်။ ; jānāmi=၏။ ; taṃ ārammaṇaṃ=ကို။ ; ahaṃ=သည်။ ; abbhaññāsiṃ=အထူးအားဖြင့် သိတော်မူ၏။ ; taṃ ārammaṇaṃ=ကို။ ; tathāgatassa=သည်။ ; viditaṃ=ထင်စွာ ပြုအပ်၏။ ; taṃ ārammaṇaṃ=သည်။ ; tathāgatassa=အား။ ; upaṭṭhāti=ထင်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3830 | Chunk: 64

Evaṃ tathadassitāya tathāgato.

AI Translation based on Nissaya

Thus, he is the Tathāgata on account of seeing what is true.

Vietnamese AI Translation

Như vậy, Ngài là Như Lai vì thấy được điều chân thật.

AI Translation Nissaya

evaṃ=thus. ; tathadassitāya=due to the fact of seeing what is true. ; tathāgato=he is called Tathāgata. ;

Myanmar Nissaya

evaṃ=သို့။ ; tathadassitāya=ဟုတ်မှန်သော သဘောကို မြင်တော်မူသည်၏ အဖြစ်ကြောင့်။ ; tathāgato=မည်တော်မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3831 | Chunk: 64

Tattha tathadassīatthe tathāgatoti padasambhavo veditabbo.

AI Translation based on Nissaya

There, the formation of the word 'Tathāgata' should be understood in the sense of 'one who sees what is true'.

Vietnamese AI Translation

Ở đây, sự hình thành của từ 'Tathāgata' nên được hiểu theo nghĩa 'người thấy điều chân thật'.

AI Translation Nissaya

tattha tasmiṃ=there. ; tathadassīatthe=in the meaning of 'one who sees what is true'. ; tathāgatotipadasambhavo=the formation of the word 'Tathāgata'. ; veditabbo=should be understood. ;

Myanmar Nissaya

tattha tasmiṃ= ; tathadassīatthe=ထိုဟုန်မှန်စွာ မြင်အပ်သော အနက်၌။ ; tathāgatotipadasambhavo=တထာဂတော ဟူသော ပုဒ်၏ ဖြစ်ခြင်းကို။ ; veditabbo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3832 | Chunk: 64

Kathaṃ tathavāditāya tathāgato ?

AI Translation based on Nissaya

How is he the Tathāgata on account of speaking what is true?

Vietnamese AI Translation

Làm thế nào Ngài là Như Lai vì nói điều chân thật?

AI Translation Nissaya

kathaṃ=how. ; tathavāditāya=due to the fact of habitually speaking what is true. ; tathāgato=is he the Tathāgata?. ;

Myanmar Nissaya

kathaṃ=လျှင်။ ; tathavāditāya=ဟုတ်မှန်စွာ ဆိုလေ့ရှိသည်၏ အဖြစ်ကြောင့်။ ; tathāgato=နည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3833 | Chunk: 64

Yaṃ rattiṃ bhagavā bodhimaṇḍe aparājitapallaṅke nisinno catunnaṃ mārānaṃ matthakaṃ madditvā anuttaraṃ sammāsambodhiṃ abhisambuddho, yañca rattiṃ yamakasālānamantare anupādisesāya nibbānadhātuyā parinibbāyi, etthantare pañcacattālīsavassaparimāṇe kāle paṭhamabodhiyāpi majjhimabodhiyāpi pacchimabodhiyāpi yaṃ bhagavatā bhāsitaṃ suttaṃ geyyaṃ … pe … vedallaṃ, taṃ sabbaṃ atthato ca byañjanato ca anavajjaṃ anupavajjaṃ [V1.179] anūnamanadhikaṃ sabbākāraparipuṇṇaṃ rāgamadanimmadanaṃ dosamohamadanimmadanaṃ, natthi tattha vālaggamattampi pakkhalitaṃ, sabbaṃ taṃ ekamuddikāya lañchitaṃ viya, ekanāḷikāya [P1.212] mitaṃ viya, ekatulāya tulitaṃ viya, ca tathameva hoti.

AI Translation based on Nissaya

On the night the Blessed One was seated on the unconquered throne at the Bodhi-seat, and having crushed the heads of the four Māras, fully awakened to unexcelled perfect self-enlightenment; and on the night he attained final Nibbāna with the Nibbāna-element without remainder between the twin Sāla trees—in the interim, during the period of forty-five years, in the first, middle, and last Bodhi periods, whatever was spoken by the Blessed One—Sutta, Geyya... etc... Vedalla—all of that is blameless and irreproachable both in meaning and in phrasing [V1.179], neither deficient nor redundant, complete in all aspects, crushing the intoxication of passion, hatred, and delusion. There is not even a hair's tip of error therein. All of it is just so, as if stamped with a single seal, as if measured [P1.212] with a single measure, and as if weighed with a single scale.

Vietnamese AI Translation

Vào đêm mà đức Thế Tôn ngự trên bảo좌 bất bại tại Bồ-đề đoàn, và sau khi đã nghiền nát đầu của bốn Ma vương, đã hoàn toàn giác ngộ Vô Thượng Chánh Đẳng Chánh Giác; và vào đêm Ngài nhập Vô Dư Y Niết-bàn giữa hai cây Sa-la song thọ—trong khoảng thời gian bốn mươi lăm năm ở giữa, trong thời kỳ Bồ-đề đầu tiên, ở giữa, và cuối cùng, bất cứ điều gì đã được đức Thế Tôn nói ra—Sutta, Geyya... v.v... Vedalla—tất cả những điều đó đều không thể chê trách và không thể chỉ trích cả về nghĩa lý lẫn văn cú [V1.179], không thiếu cũng không thừa, hoàn hảo về mọi mặt, nghiền nát sự say đắm của tham, sân, và si. Trong đó không có một lỗi lầm dù chỉ bằng một sợi tóc. Tất cả đều đúng như vậy, như thể được đóng bằng một con dấu duy nhất, như thể được đo lường [P1.212] bằng một thước đo duy nhất, và như thể được cân bằng một cái cân duy nhất.

AI Translation Nissaya

bhagavā=the Blessed One. ; yaṃ rattiṃ=on which night. ; bodhimaṇḍe=at the Bodhi-seat. ; aparājita mallaṅke=on the unconquered throne. ; nisinno=was seated. ; hutvā=having been. ; catunnaṃ=of the four. ; mārānaṃ=of the Māras, excepting Maccu-māra (Death-Māra). ; matthakaṃ=the head. ; madditvā=having crushed. ; anuttaraṃ=the unexcelled. ; sammosambodhiṃ=perfect self-enlightenment. ; abhisambuddho=fully awakened to. ; yañca rattiṃ=and on which night. ; yamakasālānaṃ=of the twin Sāla trees. ; antare=in between. ; anupādisesāya=with no remainder of the aggregates resulting from kamma. ; nibbānadhātuyā=with the Nibbāna-element. ; parinibbāyi=attained final Nibbāna. ; etthantare=in the interim of these two periods. ; pañcacattālīsavassaparimāṇe=of the measure of forty-five years. ; kāle=in the time. ; paṭhamabodhiyāpi=in the first Bodhi period, said to be twenty years, as well. ; (Mahāvāga-gaṇṭhi). ; vā=or in the first Bodhi period, said to be fifteen years. ; (arhaṅadhammapāla) majjhimabodhiyāpi= (Arhant Dhammapāla) in the middle Bodhi period as well. ; pacchimabodhiyāpi=and in the last Bodhi period as well. ; bhagavatā=by the Blessed One. ; bhāsitaṃ=was spoken. ; yaṃ suttaṃ=whatever Sutta. ; yaṃ geyyaṃ=whatever Geyya. ; la=etc. ; yaṃvedallaṃ=whatever Vedalla. ; atthi=there is. ; taṃ sabbaṃ=all that, the ninefold collection. ; attatoca=both in meaning. ; byañcanatoca=and in phrasing. ; anavajjaṃ=is blameless. ; anupavajjaṃ=irreproachable. ; anūnaṃ=not deficient. ; anadhikaṃ=not redundant. ; sabbākāraparipuṇṇaṃ=is complete in all aspects. ; rāgamadanimmadanaṃ=it crushes the intoxication of passion. ; dosamohamadanimmadanaṃ=it crushes the intoxication of hatred and delusion. ; tattha=in that ninefold collection. ; vālaggamattampi=even a hair's tip. ; pakkhalitaṃ=of stumbling or error. ; natthi=there is not. ; taṃ sabbaṃ=all that which was spoken, the ninefold collection. ; ekamuddikāya=with a single seal. ; lañchitaṃviya=as if stamped. ; ekanāḷikāya=with a single nāḷi measure. ; mitaṃviya=as if measured. ; ekatulāya=with a single scale. ; tulitaṃviyaca=and as if weighed. ; tathameva=is just so. ; vā=or, is just the same. ; hoti=it is. ;

Myanmar Nissaya

bhagavā=သည်။ ; yaṃ rattiṃ=အကြင်ညဉ့်၌လည်း။ ; bodhimaṇḍe=၌။ ; aparājita mallaṅke=၌။ ; nisinno=နေတော်မူသည်။ ; hutvā=၍။ ; catunnaṃ=ကုန်သော။ ; mārānaṃ=မစ္စုမာရ် သည် ကြဉ်အပ်သော မာရ်တို့၏။ ; matthakaṃ=အထွတ်ထိပ်သို့။ ; madditvā=နင်းနယ်ဖျက်ဆီး၍။ ; anuttaraṃ=အတူမရှိသော။ ; sammosambodhiṃ=သဗ္ဗညုတဉာဏ်ကို။ ; abhisambuddho=ထိုးထွင်း၍ သိတော်မူ၏။ ; yañca rattiṃ=၌လည်း။ ; yamakasālānaṃ=အစုံသော အင်ကြင်းပင်ပျိုတို့၏။ ; antare=အလယ်ကြား၌။ ; anupādisesāya=ဝိပါက်ကမ္မဇရုပ် အကြွင်းမရှိသော။ ; nibbānadhātuyā=ဖြင့်။ ; parinibbāyi=ပရိနိဗ္ဗာန်ပြုတော်မူ၏။ ; etthantare=ဤကာလနှစ်ပါး၏ အလယ်၌။ ; pañcacattālīsavassaparimāṇe=လေးဆယ့် ငါးဝါအတိုင်း အရှည်ရှိသော။ ; kāle=၌။ ; paṭhamabodhiyāpi=ဝါနှစ်ဆယ်ဟု ဆိုအပ်သော ပဌမဗောဓိ၌လည်းကောင်း။ ; (မဟာဝါဂဏ္ဌိ)။ ; vā=တဆယ့်ငါးဝါဟု ဆိုအပ်သော ပဌမဗောဓိ၌လည်းကောင်း။ ; (arhaṅadhammapāla) majjhimabodhiyāpi=၌လည်းကောင်း။ ; pacchimabodhiyāpi=၌လည်းကောင်း။ ; bhagavatā=သည်။ ; bhāsitaṃ=ဟောတော်မူအပ်သော။ ; yaṃ suttaṃ=အကြင်သုတ် သည်လည်းကောင်း။ ; yaṃ geyyaṃ=သည်လည်းကောငး်။ ; la= ; yaṃvedallaṃ=သည်လည်းကောင်း။ ; atthi=၏။ ; taṃ sabbaṃ=ထိုဥဿုံသော အင်္ဂါကိုးပါးသည်။ ; attatoca=အနက်အားဖြင့်လည်းကောင်း။ ; byañcanatoca=သဒ္ဒါအားဖြင့် လည်းကောင်း။ ; anavajjaṃ=မရှိ။ ; anupavajjaṃ=မကဲ့ရဲံ အပြစ်မတင်အပ်။ ; anūnaṃ=မယုတ်။ ; anadhikaṃ=မလွန်။ ; sabbākāraparipuṇṇaṃ=ခပ်သိမ်းသော အခြင်းအရာအားဖြင့် ပြည့်စုံ၏။ ; rāgamadanimmadanaṃ=ရာဂဖြင့် ယစ်ခြင်းကိုဖျက်ဆီးတတ်၏။ ; dosamohamadanimmadanaṃ=ဒေါသမောဟတို့ဖြင့် ယစ်ခြင်းကို ဖျက်ဆီးတတ်၏။ ; tattha=ထို အင်္ဂါကိုးပါး၌။ ; vālaggamattampi=သားမြီးဖျားမျှလည်း။ ; pakkhalitaṃ=ချော်ချွတ်ခြင်းမည်သည်။ ; natthi=မရှိ။ ; taṃ sabbaṃ=ထိုအလုံးစုံ ဟောတော်မူအပ်သော အင်္ဂါကိုးပါးသည်။ ; ekamuddikāya=တစ်ခုသော တံဆိပ်ဖြင့်။ ; lañchitaṃviya=ခက်နှိပ်အပ်သကဲ့သို့ လည်းကောင်း။ ; ekanāḷikāya=တစ်ခုသော ကွမ်းစားဖြင့်။ ; mitaṃviya=ခြင်ဘိသကဲ့သို့ လည်းကောင်း။ ; ekakulāya=တစ်ခုသော ချိန်ဖြင့်။ ; tulitaṃviyaca=ချိန်ဘိသကဲ့သို့ လည်းကောင်း။ ; tathameva=ဟုတ်မှန်သည်သာလျှင်။ ; vā=တူသည်သာလျှင်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3834 | Chunk: 65

Yathāha ‘‘yañca, cunda, rattiṃ tathāgato anuttaraṃ sammāsambodhiṃ abhisambujjhati, yañca rattiṃ anupādisesāya nibbānadhātuyā parinibbāyati, yaṃ etasmiṃ antare bhāsati lapati niddisati, sabbaṃ taṃ tathameva hoti, no aññathā.

AI Translation based on Nissaya

As it was said: 'Cunda, on the night the Tathāgata fully awakens to unexcelled perfect self-enlightenment, and on the night he attains final Nibbāna with the Nibbāna-element without remainder—whatever he speaks, utters, and points out in this interim, all of that is just so, and not otherwise.

Vietnamese AI Translation

Như đã được nói: 'Này Cunda, vào đêm Như Lai hoàn toàn giác ngộ Vô Thượng Chánh Đẳng Chánh Giác, và vào đêm Ngài nhập Vô Dư Y Niết-bàn—bất cứ điều gì Ngài nói, phát biểu, và chỉ ra trong khoảng thời gian này, tất cả đều đúng như vậy, và không khác đi.

AI Translation Nissaya

yathāha=as it was said. ; yañca cuṭṭha.la. tathāgatoti=thus, 'And on which, Cunda... Tathāgata'. ; (pātheyyavagge=in the Pātheyya Vagga. ; pāsādikasutte=in the Pāsādika Sutta). ; āha=he said. ; cunda=Cunda. ; yañcarattiṃ=and on which night. ; tathāgato=the Tathāgata. ; anuttaraṃ=the unexcelled. ; sammāsambodhiṃ=perfect self-enlightenment. ; abhisambujjhati=fully awakens to. ; yañcarattiṃ=and on which night. ; anupādisesāya=with no remainder. ; nibbānadhātuyā=with the Nibbāna-element. ; parinibbāyati=attains final Nibbāna. ; etasmiṃ antare=in the interim between these two periods. ; saṃyuttageyyādikaṃ=the Sutta, Geyya, etc. ; bhāsati=he speaks. ; lapati=he utters. ; niddisati=he points out. ; taṃ sabbaṃ=all that, the Sutta, Geyya, etc. ; tathameva=is just so. ; vā=or, is just the same. ; hoti=it is. ; aññathā=otherwise. ; nahoti=it is not. ;

Myanmar Nissaya

yathāha=ကား။ ; yañca cuṭṭha.la. tathāgatoti=ဟူ၍။ ; (pātheyyavagge=၌။ ; pāsādikasutte=၌။) ; āha=၏။ ; cunda=စုန္ဒ။ ; yañcarattiṃ=၌လည်း။ ; tathāgato=ငါဘုရားသည်။ ; anuttaraṃ=အတူမရှိသော။ ; sammāsambodhiṃ=သဗ္ဗညုတဉာဏ်ကို။ ; abhisambujjhati=တော်မူ၏။ ; yañcarattiṃ=၌လည်း။ ; anupādisesāya=သော။ ; nibbānadhātuyā=ဖြင့်။ ; parinibbāyati=၏။ ; etasmiṃ antare=ဤကာလနှစ်ပါး၏ အကြား၌။ ; saṃyuttageyyādikaṃ=ကို။ ; bhāsati=မူ၏။ ; lapati=ဆိုတော်မူ၏။ ; niddisati=ညွန်တော်မူ၏။ ; taṃ sabbaṃ=ထိုအလုံးစုံသော သုတ္တဂေယျ အစရှိသည်သည်။ ; tathameva=သည်သာလျှင်။ ; vā=တူမျှသည်သာလျှင်။ ; hoti=၏။ ; aññathā=တပါးသော အခြင်းအရာဖြင့်။ ; nahoti=မဖြစ်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3835 | Chunk: 65

Tasmā ‘ tathāgato ’ ti vuccatī’’ ti ( dī. ni. 3.188).

AI Translation based on Nissaya

Therefore, he is called 'Tathāgata'” (Dī. Ni. 3.188).

Vietnamese AI Translation

Vì vậy, Ngài được gọi là ‘Như Lai’” (Dī. Ni. 3.188).

AI Translation Nissaya

yasmā=Because. ; tathāgatoti='Tathāgata'. ; vuccati=he is called. ;

Myanmar Nissaya

yasmā=ကြောင့်။ ; tathāgatoti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3836 | Chunk: 65

Gadaattho hi ettha gatasaddo.

AI Translation based on Nissaya

Indeed, here the word 'gata' has the meaning of 'spoken' (gada).

Vietnamese AI Translation

Thật vậy, ở đây từ 'gata' có nghĩa là 'đã nói' (gada).

AI Translation Nissaya

hi saccaṃ=Indeed. ; ettha=here, in this phrase 'Tathāgato'. ; gatasaddo=the word 'gata'. ; gataattho=has the meaning of 'spoken' (gada). ;

Myanmar Nissaya

hi saccaṃ=၏။ ; ettha=ဤတထာဂတော ဟူသော ဝါကျ၌။ ; gatasaddo=သည်။ ; gataattho=ဆိုခြင်း အနက်ရှိ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3837 | Chunk: 65

Evaṃ tathavāditāya tathāgato.

AI Translation based on Nissaya

Thus, because he speaks what is true, he is the Tathāgata.

Vietnamese AI Translation

Như vậy, vì Ngài nói điều chân thật, Ngài là Như Lai.

AI Translation Nissaya

evaṃ=Thus. ; tathāvāditāya=because of the nature of speaking what is true. ; tathāgato=he is 'Tathāgata'. ;

Myanmar Nissaya

evaṃ=သို့။ ; tathāvāditāya=ဟုတ်မှန်သော သဘောကို ဆိုလေ့ရှိသည်၏ အဖြစ်ကြောင့်။ ; tathāgato=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3838 | Chunk: 65

Apica āgadanaṃ āgado, vacananti attho.

AI Translation based on Nissaya

Furthermore, 'āgadanaṃ' is 'āgado,' which means 'speaking'.

Vietnamese AI Translation

Hơn nữa, 'āgadanaṃ' là 'āgado,' có nghĩa là 'lời nói'.

AI Translation Nissaya

apica=Furthermore. ; āgadanaṃ=speaking. ; āgado=is 'āgada'. ; vacanaṃ=speaking. ; itiayaṃ=this is. ; attho=the meaning. ;

Myanmar Nissaya

apica=တနည်းလည်း။ ; āgadanaṃ=ဆိုခြင်း။ ; āgado=ဆိုခြင်း ။ ; vacanaṃ=ဆိုခြင်း။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3839 | Chunk: 65

Tatho aviparīto āgado assāti dakārassa takāraṃ katvā tathāgatoti evametasmiṃ atthe padasiddhi veditabbā.

AI Translation based on Nissaya

His speech is 'tatho aviparīto āgado' (true, undistorted speech); thus, by changing the 'd' to a 't', the derivation of the word 'Tathāgato' should be understood in this sense.

Vietnamese AI Translation

Lời nói của Ngài là 'tatho aviparīto āgado' (lời nói chân thật, không sai lệch); như vậy, bằng cách đổi chữ 'd' thành 't', nguồn gốc của từ 'Tathāgato' nên được hiểu theo nghĩa này.

AI Translation Nissaya

assa bhagavato=Of this Blessed One. ; tato aviparīto=true, not distorted. ; āgado=the speech. ; atthi=is. ; iti iminā vacanatthena=because of this meaning of speech. ; dakārassa=of the letter 'd'. ; takāraṃ=the letter 't'. ; katvā=having made. ; tathāgato=he is 'Tathāgato'. ; itievaṃ=thus. ; etasmiṃ atthe=in this meaning of the word 'gada' as 'speech'. ; padasiddhi=the derivation of the word 'Tathāgato'. ; veditabbo=should be understood. ;

Myanmar Nissaya

assa bhagavato=ကား။ ; tato aviparīto=မဖောက်ပြန်သော။ ; āgado=ဆိုခြင်းသည်။ ; atthi=၏။ ; iti iminā vacanatthena=ကြောင့်။ ; dakārassa=ဒ အက္ခရာ၏။ ; takāraṃ=ကို။ ; katvā=၍။ ; tathāgato=မည်၏။ ; itievaṃ=သို့။ ; etasmiṃ atthe=ထိုဂဒ သဒ္ဒါ၏ ဆိုခြင်းဟူသော အနက်၌။ ; padasiddhi=တထာဂတော ဟူသော ပုဒ်၏ ပြီးခြင်းကို။ ; veditabbo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3840 | Chunk: 65

Kathaṃ tathākāritāya tathāgato ?

AI Translation based on Nissaya

How is he the **Tathāgata** because of **acting in that way**?

Vietnamese AI Translation

Làm thế nào Ngài là **Như Lai** vì **hành động theo cách đó**?

AI Translation Nissaya

kathaṃ=How. ; tathākārikāya=because of acting in that way. ; tathāgato=is he 'Tathāgato'? ;

Myanmar Nissaya

kathaṃ=သို့လျှင်။ ; tathākārikāya=ထိုသို့သော အခြင်းအရာအားဖြင့် ပြုလေ့ရှိသည်၏ အဖြစ်ကြောင့်။ ; tathāgato=မည်သနည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3841 | Chunk: 65

Bhagavato hi vācāya kāyo anulometi, kāyassāpi vācā, tasmā yathāvādī tathākārī yathākārī tathāvādī ca hoti.

AI Translation based on Nissaya

Indeed, for the Blessed One, the body conforms with the speech, and the speech with the body. Therefore, as he speaks, so he acts; and as he acts, so he speaks.

Vietnamese AI Translation

Thật vậy, đối với đức Thế Tôn, thân hợp với khẩu, và khẩu hợp với thân. Do đó, Ngài nói thế nào thì làm thế ấy; và Ngài làm thế nào thì nói thế ấy.

AI Translation Nissaya

hi vitthāremi=Indeed, I shall explain. ; bhāgavato=Of the Blessed One. ; vācāya=with the speech. ; vā=and. ; kāyo=the body. ; vā=the bodily action. ; anulometi=conforms. ; kāyassāpi=with the body as well. ; vā=and. ; vācā=the speech. ; anulometi=conforms. ; tasmā=Therefore. ; yathāvādī=as he speaks. ; tathākārī=so he acts. ; tathāvādīca=and as he acts, so he speaks. ; hoti=he is. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; bhāgavato=၏။ ; vācāya=စကားတော်အား။ ; vā=နှင့်။ ; kāyo=ကိုယ်တော်သည်။ ; vā=ကိုယ်အမှုသည်။ ; anulometi=လျော်၏။ ; kāyassāpi=ကိုယ်တော်အားလည်း။ ; vā=နှင့်လည်း။ ; vācā=စကားတော်သည်။ ; anulometi=၏။ ; tasmā=ကြောင့်။ ; yathāvādī=အကြင်းအခြင်းအရာအားဖြင့် ဆို့လေ့ရှိ၏။ ; tathākārī=၏။ ; tathāvādīca=သည်လည်း။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3842 | Chunk: 65

Evaṃbhūtassa cassa yathā vācā, kāyopi tathā gato pavattoti attho.

AI Translation based on Nissaya

And for him who is thus, the meaning is that just as his speech is, so also his body has gone, has proceeded.

Vietnamese AI Translation

Và đối với Ngài là như vậy, ý nghĩa là giống như lời nói của Ngài, thân của Ngài cũng đã đi theo, đã tiến hành theo.

AI Translation Nissaya

evaṃ bhūtassaca=And for him who is thus. ; assa bhagavato=for this Blessed One. ; yathā=just as. ; vācā=the speech. ; hoti=is. ; kāyopi=the body also. ; tathā=in that way. ; gato pavatto=has gone, has proceeded. ; itiayaṃ attho=this is the meaning. ;

Myanmar Nissaya

evaṃ bhūtassaca=ဤသို့ဖြစ်သည်လည်းဖြစ်သော။ ; assa bhagavato=အား။ ; yathā=အကြင်အခြင်းအရာအားဖြင့်။ ; vācā=စကားတော်သည်။ ; hoti=၏။ ; kāyopi=ကိုယ်တော်သည်လည်း။ ; tathā=ထိုအခြင်းအရာအားဖြင့်။ ; gato pavatto=ဖြစ်တော်မူ၏။ ; itiayaṃ attho=ဤကားအနက်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3843 | Chunk: 65

Yathā ca kāyo, vācāpi tathā [M1.196] gatā pavattāti tathāgato.

AI Translation based on Nissaya

And just as the body, so too the speech [M1.196] has gone, has proceeded; thus he is the Tathāgata.

Vietnamese AI Translation

Và giống như thân, lời nói cũng vậy [M1.196] đã đi theo, đã tiến hành theo; như vậy Ngài là Như Lai.

AI Translation Nissaya

yathāca=And just as. ; kāyo=the body. ; pavatto=proceeds. ; ititasmā=therefore. ; tathāgato=he is 'Tathāgato'. ;

Myanmar Nissaya

yathāca=အကြင်အခြင်းအရာအားဖြင့်လည်း။ ; kāyo=သည်။ ; pavatto=ဖြစ်၏။ ; ititasmā=ကြောင့်။ ; tathāgato=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3844 | Chunk: 65

Tenevāha –

AI Translation based on Nissaya

For that very reason he said:

Vietnamese AI Translation

Chính vì lý do đó mà Ngài đã nói:

AI Translation Nissaya

teneva=For that very reason. ;

Myanmar Nissaya

teneva=သာလျှင်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3845 | Chunk: 65

‘‘yathāvādī, bhikkhave, tathāgato tathākārī, yathākārī tathāvādī.

AI Translation based on Nissaya

“'Monks, as the Tathāgata speaks, so he acts; as he acts, so he speaks.

Vietnamese AI Translation

“'Này các Tỳ-khưu, Như Lai nói thế nào, Ngài làm thế ấy; Ngài làm thế nào, Ngài nói thế ấy.

AI Translation Nissaya

yathāvādī.la. tathāgatoti vuccatīti=thus, 'As he speaks... he is called Tathāgata'. ; (aṅguttara nikāya=in the Aṅguttara Nikāya. ; catukkanipāteca=and in the Book of Fours. ; khuddakanikāye=in the Khuddaka Nikāya. ; itivutta keca=and in the Itivuttaka). ; āha=he said. ; bhikkhave=Monks. ; tathāgato=the Tathāgata. ; yathāvādī=as he speaks. ; tathākārī=so he acts. ; yathā kārī=as he acts. ; tathāvādī=so he speaks. ;

Myanmar Nissaya

yathāvādī.la. tathāgatoti vuccatīti=ဟူ၍။ ; (aṅguttara nikāya=၌။ ; catukkanipāteca=၌လည်းကောင်း။ ; khuddakanikāye=၌။ ; itivutta keca=၌လည်း ကောင်း။) ; āha=၏။ ; bhikkhave=တို့။ ; tathāgato=ငါဘုရားသည်။ ; yathāvādī=အကြင်အခြင်းအရာအားဖြင့် ဆိုလေ့ရှိ၏။ ; tathākārī=ထိုအခြင်းအရာအားဖြင့် ပြု့လေ့ရှိ၏။ ; yathā kārī=၏။ ; tathāvādī=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3846 | Chunk: 65

Iti yathāvādī tathākārī, yathākārī tathāvādī.

AI Translation based on Nissaya

Thus, as he speaks, so he acts; as he acts, so he speaks.

Vietnamese AI Translation

Như vậy, Ngài nói thế nào, Ngài làm thế ấy; Ngài làm thế nào, Ngài nói thế ấy.

AI Translation Nissaya

iti=Thus. ; yathāvādī=as he speaks. ; tathākārī=so he acts. ; hoti=he is. ; yathākārī=as he acts. ; tathāvādī=so he speaks. ; hoti=he is. ;

Myanmar Nissaya

iti=သို့။ ; yathāvādī=၏။ ; tathākārī=သည်။ ; hoti=၏။ ; yathākārī=၏။ ; tathāvādī=သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3847 | Chunk: 65

Tasmā ‘ tathāgato ’ ti vuccatī’’ ti.

AI Translation based on Nissaya

Therefore, he is called ‘Tathāgata’.”

Vietnamese AI Translation

Vì vậy, Ngài được gọi là ‘Như Lai’.”

AI Translation Nissaya

tasmā=Therefore. ; tathāgatoti='Tathāgata'. ; vuccati=he is called. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; tathāgatoti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3848 | Chunk: 65

Evaṃ tathākāritāya tathāgato.

AI Translation based on Nissaya

Thus, because of acting in that way, he is the Tathāgata.

Vietnamese AI Translation

Như vậy, vì hành động theo cách đó, Ngài là Như Lai.

AI Translation Nissaya

evaṃ=Thus. ; tathākāritāya=because of acting in that way. ; tathāgato=he is 'Tathāgato'. ;

Myanmar Nissaya

evaṃ=သို့။ ; tathākāritāya=ထိုသို့သော အခြင်းအရာအားဖြင့် ပြုလေ့ရှိသည်၏ အဖြစ်ကြောင့်။ ; tathāgato=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3849 | Chunk: 65

Kathaṃ abhibhavanaṭṭhena tathāgato ?

AI Translation based on Nissaya

How is he the **Tathāgata** in the sense of **overcoming**?

Vietnamese AI Translation

Làm thế nào Ngài là **Như Lai** theo nghĩa **chế ngự**?

AI Translation Nissaya

kathaṃ=How. ; abhibhavanaṭṭhena=due to the meaning of 'overcoming'. ; tathāgato=is he 'Tathāgato'? ;

Myanmar Nissaya

kathaṃ=လျှင်။ ; abhibhavanaṭṭhena=နှိမ်နင်းတတ်သော အနက်ကြောင့်။ ; tathāgato=နည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3850 | Chunk: 65

Upari bhavaggaṃ heṭṭhā avīciṃ pariyantaṃ katvā tiriyaṃ aparimāṇāsu lokadhātūsu sabbasatte abhibhavati sīlena samādhinā paññāya vimuttiyā vimuttiñāṇadassanena, na tassa tulā vā pamāṇaṃ vā atthi, atulo appameyyo anuttaro rājādhirājā devānaṃ atidevo sakkānaṃ atisakko brahmānaṃ atibrahmā.

AI Translation based on Nissaya

Having made the peak of existence his upper limit and the Avīci hell his lower limit, he overcomes all beings across immeasurable world-systems by his virtue, concentration, wisdom, liberation, and knowledge and vision of liberation. There is no equal or measure for him; he is unequalled, immeasurable, unexcelled, a king of kings, a supreme deva among devas, a supreme Sakka among Sakkas, a supreme Brahmā among Brahmās.

Vietnamese AI Translation

Lấy đỉnh của cõi hữu làm giới hạn trên và địa ngục Vô Gián làm giới hạn dưới, Ngài chế ngự tất cả chúng sanh trong vô lượng thế giới hệ bằng giới, định, tuệ, giải thoát, và giải thoát tri kiến của mình. Không có ai bằng hoặc có thể đo lường được Ngài; Ngài là vô song, vô lượng, vô thượng, một vị vua của các vị vua, một vị trời tối cao trong các vị trời, một vị Đế Thích tối cao trong các vị Đế Thích, một vị Phạm Thiên tối cao trong các vị Phạm Thiên.

AI Translation Nissaya

upari=above. ; bhavaggaṃ=the peak of existence. ; heṭṭhā=below. ; avīciṃ=the Avīci hell. ; pariyantaṃ=the limit. ; katvā=having made. ; tiriyaṃ=across. ; aparimāṇāsu=in immeasurable. ; lokadhātusu=world-systems. ; sabbasatte=all beings. ; sīlena=by virtue. ; samādhinā=by concentration. ; paññāya=by wisdom. ; vimuttiyā=by liberation. ; vimuttiñāṇadassanena=by the knowledge and vision of liberation. ; abhibhavati=he overcomes. ; tassabhāgavato=To that Blessed One. ; tulāvā=an equal. ; pamāṇaṃvā=or a measure. ; naatthi=there is not. ; atulo=He is unequalled. ; appameyyo=immeasurable. ; anuttaro=unexcelled. ; rājādhirājā=king of kings. ; devānaṃ=of devas. ; atidevo=a supreme deva. ; sakkānaṃ=of Sakkas. ; atisakko=a supreme Sakka. ; brahmānaṃ=than Brahmās. ; atibrahmā=a supreme Brahmā. ;

Myanmar Nissaya

upari=၌။ ; bhavaggaṃ=ကို။ ; heṭṭhā=၌။ ; avīciṃ=ကို။ ; pariyantaṃ=အပိုင်းအခြားကို။ ; katvā=၍။ ; tiriyaṃ=ဖီလာ။ ; aparimāṇāsu=ကုန်သော။ ; lokadhātusu=တို့၌။ ; sabbasatte=တို့ကို။ ; sīlena=ဖြင့်။ ; samādhinā=ဖြင့်။ ; paññāya=ဖြင့်။ ; vimuttiyā=ဖြင့်။ ; vimuttiñāṇadassanena=ဖြင့်။ ; abhibhavati=လွှမ်းမိုးတော်မူ၏။ ; tassabhāgavato=အား။ ; tulāvā=အတူသည်လည်းကောင်း။ ; pamāṇaṃvā=နှိုင်းယှဉ်ကြောင်းသည်လည်းကောင်း။ ; naatthi=မရှိ။ ; atulo=အတူမရှိ။ ; appameyyo=မနှိုင်းယှဉ်အပ်‌။ ; anuttaro=လွန်ကဲသော သူမရှိ။ ; rājādhirājā=မင်းထက်မင်းဖြစ်တော်မူ၏။ ; devānaṃ=နုတ်တို့၏။ ; atidevo=လွန်သော နတ်တည်း။ ; sakkānaṃ=သိကြားမင်းတို့၏။ ; atisakko=လွန်ကဲသော သိကြားဖြစ်တော်မူ၏။ ; brahmānaṃ=တို့ထက်။ ; atibrahmā=လွန်သော ဗြဟ္မာဖြစ်တော်မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3851 | Chunk: 65

Tenāha –

AI Translation based on Nissaya

For that reason he said:

Vietnamese AI Translation

Vì lý do đó Ngài đã nói:

AI Translation Nissaya

tena=For that reason. ;

Myanmar Nissaya

tena=ကြောင့်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3852 | Chunk: 65

‘‘sadevake, bhikkhave, loke … pe … sadevamanussāya tathāgato abhibhū anabhibhūto aññadatthu daso vasavattī.

AI Translation based on Nissaya

“'Monks, in the world with its devas... etc... in the world with its devas and humans, the Tathāgata is the overcomer, un-overcome, the one who sees all, the one who wields power.

Vietnamese AI Translation

“'Này các Tỳ-khưu, trong thế giới với các vị trời... v.v... trong thế giới với các vị trời và loài người, Như Lai là người chế ngự, không bị chế ngự, người thấy tất cả, người nắm giữ quyền năng.

AI Translation Nissaya

sadevake.la.=In the world with its devas... etc. ;

Myanmar Nissaya

sadevake.la.= ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3853 | Chunk: 65

Tasmā ‘ tathāgato ’ ti vuccatī’’ ti ( a. ni. 4.23).

AI Translation based on Nissaya

Therefore, he is called ‘Tathāgata’” (A. Ni. 4.23).

Vietnamese AI Translation

Do đó, Ngài được gọi là ‘Như Lai’” (A. Ni. 4.23).

AI Translation Nissaya

vuccatīti=is called', thus. ; āha=he said. ; bhikkhave=Monks. ; sadevake=with its five deva realms. ; loke=in the physical world. ; sadevamanussāya=in the world of beings, together with the conventional devas, that is, kings, and the remaining humans. ; tathāgato=the Tathāgata. ; abhibhū=overcomes. ; anabhibhūto=there is none who can overcome him. ; aññadatthu=certainly. ; daso=he is able to see. ; vasavattī=he makes them follow his will. ; tasmā=Therefore. ; tathāgatoti='Tathāgata'. ; vuccati=he is called. ; (aññadatthu is an indeclinable particle meaning 'certainly'. daso is from 'dakkhati', to see. vasavattī is from 'vasaṃ vattati', to wield power. Aṅg-ṭṭha-2. 269). ;

Myanmar Nissaya

vuccatīti=ဟူ၍။ ; āha=၏။ ; bhikkhave=တို့။ ; sadevake=နတ်ပြည်ငါးထပ်နှင့်တကွသော။ ; loke=ဩကာသလောက၌။ ; sadevamanussāya=သမ္မုတ္တိနတ်တည်းဟူသော မင်းကြွင်းသော လူနှင့်တကွသော သတ္တလောဥ၌. ; tathāgato=သည်။ ; abhibhū=လွှမ်းမိုးတော်မူ၏။ ; anabhibhūto=လွှမ်းမိုးနိုင်သော သူမရှိ။ ; aññadatthu=စင်စစ်။ ; daso=မြင်စွမ်းနိုင်၏။ ; vasavattī=ငါ၏ အလိိုသို့ လိုက်စေကုန်၏။ ; tasmā=ကြောင့်။ ; tathāgatoti=ဟူ၍။ ; vuccati=၏။ ; (အညဒတ္ထူတိ ဧကံ သတ္တေ နိပါတော။ ဒက္ခတီတိ ဒသော။ ဝသံ ဝတ္တေတီတိ ဝသတ္တိ။ အံ-ဋ္ဌ-၂။ ၂၆၉)။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3854 | Chunk: 65

Tatthevaṃ padasiddhi veditabbā – agado viya agado.

AI Translation based on Nissaya

In this case, the derivation of the word should be understood thus: he is a remedy, like a remedy (agado).

Vietnamese AI Translation

Trong trường hợp này, nguồn gốc của từ nên được hiểu như sau: Ngài là một phương thuốc, giống như một phương thuốc (agado).

AI Translation Nissaya

tattha=In that word 'Tathāgato'. ; evaṃ iminā vuccamānanayena=by this method now being explained. ; padasiddhi=the derivation of the word. ; veditabbā=should be understood. ; agadoviya=like a remedy. ; agado=is a remedy. ;

Myanmar Nissaya

tattha=ထိုတထာဂတော ဟူသော ပုဒ်၌။ ; evaṃ iminā vuccamānanayena=ဖြင့်။ ; padasiddhi=ပုဒ်၏ ပြီးခြင်းကို။ ; veditabbā=၏။ ; agadoviya=နတ်ဆေးနှင့်တူသည်လည်း။ ; agado=နတ်ဆေးနှင့်တူသည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3855 | Chunk: 65

Ko panesa ?

AI Translation based on Nissaya

But what is this remedy?

Vietnamese AI Translation

Nhưng phương thuốc này là gì?

AI Translation Nissaya

pana=Now, to raise a question. ; esa eso agado=this 'remedy'. ; ko=what is it? ;

Myanmar Nissaya

pana=စောဒနာသောဓနာပုဒ်ကို ဆိုဦးအံ့။ ; esa eso agado=သည်။ ; ko=နည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3856 | Chunk: 65

Desanāvilāso ceva puññussayo ca.

AI Translation based on Nissaya

It is the graceful exposition of the teaching and the abundance of merit.

Vietnamese AI Translation

Đó là sự trình bày duyên dáng của giáo pháp và sự phong phú của công đức.

AI Translation Nissaya

desanā vilāsoceva=The graceful exposition of the teaching. ; puññussayoca=and the abundance of merit. ; hoti=it is. ;

Myanmar Nissaya

desanā vilāsoceva=ဒေသနာတော်၏ ကွန့်မြူးစံပယ်ခြင်းသည်လည်းကောင်း။ ; puññussayoca=ပါရမီကံ၏ စည်ပင်ခြင်းသည် လည်းကောင်း။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3857 | Chunk: 65

Tena hesa mahānubhāvo bhisakko dibbāgadena sappe viya sabbaparappavādino sadevakañca lokaṃ abhibhavati.

AI Translation based on Nissaya

Indeed, for this reason, this Blessed One, like a physician of great power who overcomes snakes with a divine remedy, overcomes all who hold other doctrines and the entire world with its devas.

Vietnamese AI Translation

Thật vậy, vì lý do này, vị Thế Tôn này, giống như một thầy thuốc có năng lực vĩ đại chế ngự rắn bằng một phương thuốc thần diệu, đã chế ngự tất cả những người theo các học thuyết khác và toàn bộ thế giới với các vị trời.

AI Translation Nissaya

hi saccaṃ=Indeed. ; tena=For that reason. ; esa eso bhagavā=this Blessed One. ; mahānubhāvo=of great power. ; bhisakko=a physician. ; dibbāpadena=with a divine remedy. ; vā=or with a medicine like a divine remedy. ; sappe=snakes. ; abhibhavativiya=just as he overcomes. ; sabbaparappavādino=all who hold other doctrines. ; puggaleca=and persons. ; sadevakaṃ=with its devas. ; lokañca=and the world. ; abhibhavati=he overcomes. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; tena=ကြောင့်။ ; esa eso bhagavā=သည်။ ; mahānubhāvo=ရှိသော။ ; bhisakko=ဆေးသမားသည်။ ; dibbāpadena=နတ်ဆေးဖြင့်။ ; vā=နတ်ဆေးနှင့်တူသော ဆေးဖြင့်။ ; sappe=မြွေတို့ကို။ ; abhibhavativiya=နှိမ်နင်းသကဲ့သို့။ ; sabbaparappavādino=အလုံးစုံသော အယူရှိသော။ ; bhisakko=ဆေးသမားသည်။ ; puggaleca=တို့ကိုလည်းကောင်း။ ; sadevakaṃ=သော။ ; lokañca=ကိုလည်းကောင်း။ ; abhibhavati=လွှမ်းမိုးတော်မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3858 | Chunk: 65

Iti sabbalokābhibhavane tatho aviparīto desanāvilāsamayo ceva puññamayo ca agado assāti dakārassa takāraṃ katvā tathāgatoti veditabbo.

AI Translation based on Nissaya

Therefore, it should be understood that in overcoming the entire world, his remedy is true and undistorted, consisting of the graceful exposition of the teaching and of merit; changing the 'd' (of agado) to a 't', he is 'Tathāgato'.

Vietnamese AI Translation

Do đó, cần phải hiểu rằng trong việc chế ngự toàn bộ thế giới, phương thuốc của Ngài là chân thật và không sai lệch, bao gồm sự trình bày duyên dáng của giáo pháp và của công đức; đổi chữ 'd' (của agado) thành 't', Ngài là 'Tathāgato'.

AI Translation Nissaya

itita smā=Therefore. ; assabhagavato=of this Blessed One. ; sabbalokābhibhavane=in overcoming the entire world. ; tato aviparīto=true, not distorted. ; vā=or, without distortion. ; desanāvīlāsamayāceva=consisting of the graceful exposition of the teaching. ; puññamayoca=and consisting of merit. ; agado=is the remedy. ; takāraṃ=the letter 't'. ; ကတွာ ၍။ ; tathāgato=is 'Tathāgato'. ; iti=thus. ; veditabbo=it should be understood. ;

Myanmar Nissaya

itita smā=ကြောင့်။ ; assabhagavato=အား။ ; sabbalokābhibhavane=ဥဿုံသော လောကကို နှိမ်နင်းခြင်း၌။ ; tato aviparīto=မဖောက်ပြန်သော။ ; vā=ဖောက်ပြန်ခြင်း မရှိသော။ ; desanāvīlāsamayāceva=ဒေသနာဝိလာသဖြင့် ပြီးသည်လည်းဖြစ်သော။ ; puññamayoca=ပုညဖြင့် ပြီးသည်လည်းကောင်း။ ; agado=၏။ ; takāraṃ=ကို။ ; ကတွာ ၍။ ; tathāgato=မည်၏။ ; iti=သို့။ ; veditabbo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3859 | Chunk: 65

Evaṃ abhibhavanaṭṭhena tathāgato.

AI Translation based on Nissaya

Thus, in the sense of overcoming, he is the Tathāgata.

Vietnamese AI Translation

Như vậy, theo nghĩa chế ngự, Ngài là Như Lai.

AI Translation Nissaya

evaṃ=Thus. ; abhibhavanaṭṭhena=due to the meaning of 'overcoming'. ; tathāgato=he is 'Tathāgato'. ;

Myanmar Nissaya

evaṃ=သို့။ ; abhibhavanaṭṭhena=လွှမ်းမိုးတတ်သော အနက်ကြောင့်။ ; tathāgato=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3860 | Chunk: 65

Apica [V1.180] tathāya gatotipi tathāgato, tathaṃ gatotipi tathāgatoti.

AI Translation based on Nissaya

Furthermore [V1.180], he is the Tathāgata because he has understood (gato) the truth (tathāya), and he is the Tathāgata because he has practiced (gato) the truth (tathaṃ).

Vietnamese AI Translation

Hơn nữa [V1.180], Ngài là Như Lai vì Ngài đã hiểu (gato) chân lý (tathāya), và Ngài là Như Lai vì Ngài đã thực hành (gato) chân lý (tathaṃ).

AI Translation Nissaya

apica=Furthermore. ; tathāya=by the truth. ; gato=he has understood. ; iti tasmāpi=for this reason also. ; tathāgato=he is called 'Tathāgato'. ; tathaṃ=the true. ; gato=he has practiced. ; iti tasmāpi=for this reason also. ; tathāgato=he is 'Tathāgato'. ;

Myanmar Nissaya

apica=တနည်းလည်း။ ; tathāya=ဟုတ်မှန်သော ပရိညာဉ်ဖြင့်။ ; gato=သိတော်မူ၏။ ; iti tasmāpi=ကြောင့်လည်း။ ; tathāgato=မည်တော်မူ၏။ ; tathaṃ=ဟုတ်မှန်သော အကျင့်ကို။ ; gato=ကျင့်တော်မူ၏။ ; iti tasmāpi=ကြောင့်လည်း။ ; tathāgato=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3861 | Chunk: 65

Gatoti avagato atīto patto paṭipannoti attho [P1.213].

AI Translation based on Nissaya

**Gato** here means understood, gone beyond, attained, or practiced [P1.213].

Vietnamese AI Translation

**Gato** ở đây có nghĩa là đã hiểu, đã vượt qua, đã đạt được, hoặc đã thực hành [P1.213].

AI Translation Nissaya

gatoti='Gato' means. ; avagato=understood. ; atīto=gone beyond. ; patto=attained. ; paṭipanno=practiced. ; itiayaṃ=this is. ; attho=the meaning. ;

Myanmar Nissaya

gatoti=ကား။ ; avagato=သိသည်လည်း။ ; atīto=လွန်သည်လည်း။ ; patto=ရောက်သည်လည်း။ ; paṭipanno=ကျင့်သည်လည်း။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3862 | Chunk: 65

Tattha sakalaṃ lokaṃ tīraṇapariññāya tathāya gato avagatoti tathāgato, lokasamudayaṃ pahānapariññāya tathāya gato atītoti tathāgato, lokanirodhaṃ sacchikiriyāya tathāya gato pattoti tathāgato, lokanirodhagāminipaṭipadaṃ tathaṃ gato paṭipannoti tathāgato.

AI Translation based on Nissaya

Among these, he is the Tathāgata because he has understood (gato avagato) the entire world by means of the truth of full understanding through scrutinizing. He is the Tathāgata because he has gone beyond (gato atīto) the origin of the world by means of the truth of full understanding through abandoning. He is the Tathāgata because he has attained (gato patto) the cessation of the world by means of the truth of realization. He is the Tathāgata because he has practiced (gato paṭipanno) the true practice leading to the cessation of the world.

Vietnamese AI Translation

Trong số này, Ngài là Như Lai vì Ngài đã hiểu (gato avagato) toàn bộ thế giới bằng phương tiện của chân lý về sự liễu tri thông qua việc thẩm sát. Ngài là Như Lai vì Ngài đã vượt qua (gato atīto) nguồn gốc của thế giới bằng phương tiện của chân lý về sự liễu tri thông qua việc đoạn tận. Ngài là Như Lai vì Ngài đã đạt được (gato patto) sự chấm dứt của thế giới bằng phương tiện của chân lý về sự chứng ngộ. Ngài là Như Lai vì Ngài đã thực hành (gato paṭipanno) con đường chân chính dẫn đến sự chấm dứt của thế giới.

AI Translation Nissaya

tattha=Among these four meanings. ; sakalaṃ=the entire. ; lokaṃ=world of formations. ; tathāya=by the truth of. ; tīraṇapariññāya=full understanding by scrutinizing. ; gato avagato=he has comprehended. ; ititasmā=therefore. ; tathāgato=he is 'Tathāgato'. ; lokasamudayaṃ=craving, the cause of the world of formations. ; tathāya=by the truth of. ; pahānapariññāya=full understanding by abandoning. ; gato atīto=he has gone beyond. ; vā=or, he has abandoned. ; iti tasmā=therefore. ; tathāgato=he is called 'Tathāgato'. ; lokanirodhaṃ=Nibbāna, the cessation of the world of formations. ; tathāya=by the truth of. ; sacchikiriyāya=realization. ; gato patto=he has attained. ; vā=or, he has obtained. ; iti tasmā=therefore. ; tathāgato=he is 'Tathāgato'. ; tathaṃ=the true. ; lokanirodhagāminipaṭipadaṃ=practice leading to the cessation of the world of formations. ; gatopaṭipanno=he has practiced. ; vā=or, he has developed. ; iti tasmā=therefore. ; tathāgato=he is 'Tathāgato'. ;

Myanmar Nissaya

tattha=ထိုလေးပါးသော အနက်တို့၌။ ; sakalaṃ=အလုံးစုံသော။ ; lokaṃ=သင်္ခါရလောကကို။ ; tathāya=ဟုတ်မှန်သော။ ; tīraṇapariññāya=ဖြင့်။ ; gato avagato=ပိုင်းခြား၍ သိတော်မူ၏။ ; ititasmā=ကြောင့်။ ; tathāgato=မည်၏။ ; lokasamudayaṃ=သင်္ခါရလောက၏ အကြောင်းဖြစ်သော တဏှာကို။ ; tathāya=သော။ ; pahānapariññāya=ဖြင့်။ ; gato atīto=လွန်တော်မူ၏။ ; vā=ပယ်တော်မူ၏။ ; iti tasmā=ကြောင့်။ ; tathāgato=မည်တော်မူ၏။ ; lokanirodhaṃ=သင်္ခါရလောက၏ ချုပ်ရာနိဗ္ဗာန်ကို။ ; tathāya=သော။ ; sacchikiriyāya=မျက်မှောက်ပြုသော အားဖြင့်။ ; gato patto=ရောက်တော်မူ၏။ ; vā=ရတော်မူ၏။ ; iti tasmā=ကြောင့်။ ; tathāgato=မည်၏။ ; tathaṃ=ဟုတ်မှန်သော။ ; lokanirodhagāminipaṭipadaṃ=သင်္ခါရလောက၏ ချုပ်ရာနိဗ္ဗာန်သို့ ရောက်ကြောင်းဖြစ်သော အကျင့်ကို။ ; gatopaṭipanno=ကျင့်တော်မူ၏။ ; vā=ပွားတော်မူ၏။ ; iti tasmā=ကြောင့်။ ; tathāgato=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3863 | Chunk: 65

Tena yaṃ vuttaṃ bhagavatā –

AI Translation based on Nissaya

For that reason, what was said by the Blessed One:

Vietnamese AI Translation

Vì lý do đó, những gì đã được đức Thế Tôn nói:

AI Translation Nissaya

tena=For that reason. ; bhagavato=the Blessed One. ;

Myanmar Nissaya

tena=ကြောင့်။ ; bhagavato=သည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3864 | Chunk: 65

‘‘loko, bhikkhave, tathāgatena abhisambuddho, lokasmā tathāgato visaṃyutto.

AI Translation based on Nissaya

“'Monks, the world has been fully understood by the Tathāgata; the Tathāgata is disjoined from the world.

Vietnamese AI Translation

“'Này các Tỳ-khưu, thế giới đã được Như Lai hoàn toàn liễu tri; Như Lai đã tách rời khỏi thế giới.

AI Translation Nissaya

loke.la.=The world... etc. ;

Myanmar Nissaya

loke.la.= ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3865 | Chunk: 65

Tasmā ‘ tathāgato ’ ti vuccatī’’ ti ( a. ni. 4.23).

AI Translation based on Nissaya

Therefore, he is called ‘Tathāgata’” (A. Ni. 4.23).

Vietnamese AI Translation

Do đó, Ngài được gọi là ‘Như Lai’” (A. Ni. 4.23).

AI Translation Nissaya

vuccatīti=is called', thus. ; (yaṃ vacanaṃ=which statement. ; vuttaṃ=was said). ;

Myanmar Nissaya

vuccatīti=ဟူ၍။ ; (yaṃ vacanaṃ=ကို။ ; vuttaṃ=၏။) ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3866 | Chunk: 65

Tassa evampi attho veditabbo.

AI Translation based on Nissaya

And the meaning of that statement should be understood in this way as well. ‘Monks, the truth of suffering has been directly realized by the Tathāgata; the Tathāgata is detached from the truth of suffering. Monks, the truth of the origin has been realized by the Tathāgata; the truth of the origin has been abandoned by the Tathāgata. Monks, the truth of cessation has been realized by the Tathāgata; the truth of cessation has been realized by the Tathāgata. Monks, the practice leading to the truth of cessation has been realized by the Tathāgata; the practice leading to the truth of cessation has been developed by the Tathāgata. Monks, whatever in the world with its devas… etc… is seen, heard, sensed, cognized, attained, sought after, and pondered upon by the mind, all that has been fully understood by the Tathāgata. Therefore, he is called ‘Tathāgata’.

Vietnamese AI Translation

Và ý nghĩa của câu nói đó cũng nên được hiểu theo cách này. ‘Này các Tỳ-khưu, chân lý về khổ đã được Như Lai trực tiếp chứng ngộ; Như Lai đã tách rời khỏi chân lý về khổ. Này các Tỳ-khưu, chân lý về nguồn gốc đã được Như Lai chứng ngộ; chân lý về nguồn gốc đã được Như Lai đoạn tận. Này các Tỳ-khưu, chân lý về sự chấm dứt đã được Như Lai chứng ngộ; chân lý về sự chấm dứt đã được Như Lai chứng ngộ. Này các Tỳ-khưu, con đường dẫn đến chân lý về sự chấm dứt đã được Như Lai chứng ngộ; con đường dẫn đến chân lý về sự chấm dứt đã được Như Lai phát triển. Này các Tỳ-khưu, bất cứ điều gì trong thế giới với các vị trời… v.v… được thấy, nghe, cảm nhận, nhận biết, đạt được, tìm kiếm, và suy xét bởi tâm, tất cả những điều đó đã được Như Lai hoàn toàn liễu tri. Do đó, Ngài được gọi là ‘Như Lai’.

AI Translation Nissaya

tassa vacanassa=Of that statement. ; evampi attho=this meaning also. ; veditabbo=should be understood. ; bhikkhave=Monks. ; tathāgatena=by the Tathāgata. ; loke=the truth of suffering. ; abhisambuddhā=has been directly realized by wisdom. ; lokasmā=from the truth of suffering. ; tathāgato=the Tathāgata. ; visaṃyutto=is detached. ; bhikkhave=Monks. ; tathāgatena=by the Tathāgata. ; lokasamudayo=the truth of the origin of the world of formations. ; abhisambuddho=has been realized. ; lokasamudayo=the truth of the origin. ; tathāgatassa=by me, the Buddha. ; pahīno=has been abandoned by the wisdom of the path of Arahantship. ; bhikkhave=Monks. ; lokanirodho=the truth of cessation, the ending of the world of formations. ; tathāgatena=by the Tathāgata. ; abhisambuddho=has been realized. ; lokanirodho=the cessation. ; tathāgatassa=by the Tathāgata. ; sacchikato=has been realized. ; bhikkhave=Monks. ; lokanirodhagāmīnipaṭipadā=the practice leading to the cessation of the world of formations. ; tathāgatena=by the Tathāgata. ; abhisambuddhā=has been realized. ; lokanirodhagāmīnipaṭipadā=the path. ; tathāgatassa=by the Tathāgata. ; bhāvitā=has been developed. ; bhikkhave=Monks. ; sadevakassa=of the world with its devas. ; lokassa=of the world. ; la=etc. ; manasā=by mind. ; anuvicaritaṃ=has been contemplated. ; yaṃ ārammaṇaṃ=whatever object. ; atthi=there is. ; taṃ=that visible object seen, audible object heard, odorous, gustatory, and tangible object experienced, the mental object known such as pleasure and pain, the object obtained and sought, the object contemplated by the mind. ; tathāgatena=by the Tathāgata. ; abhisambuddhaṃ=has been realized. ; tasmā=therefore. ; tathāgatoti='Tathāgata'. ; vuccati=he is called. ;

Myanmar Nissaya

tassa vacanassa=၏။ ; evampi attho=ကိုလည်း။ ; veditabbo=၏။ ; bhikkhave=တို့။ ; tathāgatena=သည်။ ; loke=ဒုက္ခသစ္စာို။ ; abhisambuddhā=ဉာဏ်ဖြင့် မျက်မှောက်ပြုတော်မူအပ်၏။ ; lokasmā=ဒုက္ခသစ္စာမှ။ ; tathāgato=သည်။ ; visaṃyutto=ကင်းတော်မူ၏။ ; bhikkhave=တို့။ ; tathāgatena=သည်။ ; lokasamudayo=သင်္ခါရလောက၏ အမုဒယသစ္စာကို။ ; abhisambuddho=၏။ ; lokasamudayo=သမုဒယသစ္စာကို။ ; tathāgatassa=ငါဘုရားသည်။ ; pahīno=အရဟတ္တမဂ်ဉာဏ်ဖြင့် ပယ်တော်မူအပ်၏။ ; bhikkhave=တို့။ ; lokanirodho=သင်္ခါရလောက၏ ချုပ်ရာနိရောဓသစ္စာကို။ ; tathāgatena=သည်။ ; abhisambuddho=၏။ ; lokanirodho=ကို။ ; tathāgatassa=သည်။ ; sacchikato=အပ်၏။ ; bhikkhave=တို့။ ; lokanirodhagāmīnipaṭipadā=သင်္ခါရလောက၏ ချုပ်ရာနိရောဓသစ္စာသို့ ရောက်ကြောင်းဖြစ်သော အကျင့်ကို။ ; tathāgatena=သည်။ ; abhisambuddhā=၏။ ; lokanirodhagāmīnipaṭipadā=ကို။ ; tathāgatassa=သည်။ ; bhāvitā=ပွားစေအပ်၏။ ; bhikkhave=တို့။ ; sadevakassa=သော။ ; lokassa=သည်။ ; la= ; manasā=ဖြင့်။ ; anuvicaritaṃ=ဆင်ခြင်အပ်သော။ ; yaṃ ārammaṇaṃ=သည်။ ; atthi=၏။ ; taṃ=ထိုမြင်အပ်သော ရူပါရုံ ကြားအပ်သော သဒ္ဒါရုံ တွေ့အပ်သော ဂန္ဓရသ ဖောဋ္ဌဗ္ဗာရုံ သိအပ်သော သုခဒုက္ခအစရှိသော ဓမ္မာရုံ ရအပ် ရှာမှီးအပ်သော အာရုံစိတ်ဖြင့် ဆင်ခြင်အပ်သော အာရုံကို။ ; tathāgatena=သည်။ ; abhisambuddhaṃ=၏။ ; tasmā=ကြောင့်။ ; tathāgatoti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3867 | Chunk: 65

Idampi ca tathāgatassa tathāgatabhāvadīpane mukhamattameva.

AI Translation based on Nissaya

And this that has been said is merely a brief indication in explaining the state of being a Tathāgata.

Vietnamese AI Translation

Và những gì đã được nói ở đây chỉ là một chỉ dẫn ngắn gọn trong việc giải thích về trạng thái của một vị Như Lai.

AI Translation Nissaya

ca=Also. ; idampi=this which has been said. ; tathāgatassa=of the Tathāgata. ; tathāgatabhāvadīpane=in explaining the state of being a Tathāgata. ; mukhamattameva=is merely a brief indication. ;

Myanmar Nissaya

ca=ဆက်။ ; idampi=ဤဆိုအပ်ပြီးသော စကားသည်လည်း။ ; tathāgatassa=၏။ ; tathāgatabhāvadīpane=တထာဂတမည်သည်၏ အဖြစ်ကို ပြရာ၌။ ; mukhamattameva=အမြွက်မျှသာလျှင်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3868 | Chunk: 65

Sabbākārena pana tathāgatova tathāgatassa tathāgatabhāvaṃ vaṇṇeyya.

AI Translation based on Nissaya

But in fact, only a Tathāgata could describe in all its aspects the state of being a Tathāgata.

Vietnamese AI Translation

Nhưng trên thực tế, chỉ có một vị Như Lai mới có thể mô tả được đầy đủ mọi khía cạnh về trạng thái của một vị Như Lai.

AI Translation Nissaya

pana=But in fact. ; sabbākārena=in all aspects. ; tathāgatova=only a Tathāgata. ; tathāgatassa=of a Tathāgata. ; tathāgatabhāvaṃ=the state of being a Tathāgata. ; vaṇṇeyya=can describe. ;

Myanmar Nissaya

pana=စင်စစ်သော်ကား။ ; sabbākārena=ဖြင့်။ ; tathāgatova=ငါဘုရားသည်သာလျှင်။ ; tathāgatassa=ဘုရားရှင်၏။ ; tathāgatabhāvaṃ=တထာဂဝမည်သည်၏ အဖြစ်ကို။ ; vaṇṇeyya=ဖွင့်ဆိုနိုင်ရာ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3869 | Chunk: 65

Yasmā pana sabbabuddhā tathāgataguṇenāpi samasamā, tasmā sabbesaṃ vasena tathāgatānan ti āha.

AI Translation based on Nissaya

But since all Buddhas are exactly equal also in regard to the quality of a Tathāgata, he therefore said **of the Tathāgatas**, speaking in the plural by way of all of them.

Vietnamese AI Translation

Nhưng vì tất cả các vị Phật đều hoàn toàn bình đẳng về phẩm chất của một vị Như Lai, do đó, ngài đã nói **của các bậc Như Lai**, nói ở số nhiều để chỉ tất cả các vị ấy.

AI Translation Nissaya

pana=Now, to state the reason for speaking in the plural. ; yasmā=Because. ; sabbabuddhā=all Buddhas. ; tathāgataguṇenāpi=also by the quality of a Tathāgata. ; samasamā=are exactly equal. ; tasmā=Therefore. ; sabbesaṃ=of all of them. ; vasena=by way of. ; tathāgatānanti=as 'Tathāgatānaṃ'. ; bahuvacanavasena=by way of the plural. ; dhammasenāpatitero=the Elder, the General of the Dhamma. ; āha=said. ;

Myanmar Nissaya

pana=ဗဟုဝုစ် အားဖြင့် ဟောခြင်း၏ အကြောင်းကို ဆိုအံ့။ ; yasmā=ကြောင့်။ ; sabbabuddhā=အလုံစုံကုန်သော ဘုရားရှင်တို့သည်။ ; tathāgataguṇenāpi=တထာဂတ ဂုဏ်တော်အားဖြင့်လည်း။ ; samasamā=ထပ်တူထပ်မျှ ဖြစ်တော်မူကြကုန်၏။ ; tasmā=ကြောင့်။ ; sabbesaṃ=တို့၏။ ; vasena=အစွမ်းဖြင့်။ ; tathāgatānanti=တထာဂတာနံ ဟူ၍။ ; bahuvacanavasena=အစွမ်းဖြင့်။ ; dhammasenāpatitero=အရှင်သာရိပုတြာမထေရ်သည်။ ; āha=မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3870 | Chunk: 65

Arahantānan ti kilesehi ārakattā, arīnaṃ arānañca hatattā, paccayādīnaṃ arahattā, pāpakaraṇe rahābhāvā tathāgato arahaṃ.

AI Translation based on Nissaya

As to **of the Arahants**: the Tathāgata is an Arahant because he is far (āraka) from the defilements; because he has destroyed (hata) the enemies (ari) and the spokes (ara); because he is worthy (arahati) of requisites and so on; and because he has no secret place (raha) for doing evil.

Vietnamese AI Translation

Đối với **của các bậc A-la-hán**: Như Lai là một vị A-la-hán vì Ngài ở xa (āraka) các phiền não; vì Ngài đã hủy diệt (hata) kẻ thù (ari) và các căm bánh xe (ara); vì Ngài xứng đáng (arahati) với các vật dụng, v.v.; và vì Ngài không có nơi bí mật (raha) để làm điều ác.

AI Translation Nissaya

arahantānanti=As to 'of the Arahants'. ; kilesehi=from the defilements. ; ārakattā=because of being far from. ; tathāgato=the Tathāgata. ; arahaṃ=is an Arahant. ; arīnaṃ=the enemies, i.e., the defilements. ; arānañca=and the spokes of the wheel of saṃsāra. ; hatattā=because of having destroyed. ; tathāgato=the Tathāgata. ; arahaṃ=is an Arahant. ; paccayādīnaṃ=requisites such as robes, and special offerings. ; arahattā=because of being worthy to receive. ; tathāgato=the Tathāgata. ; arahaṃ=is an Arahant. ; pāpakaraṇe=in the doing of evil. ; rahābhāvā=because of having no secret place. ; tathāgato=the Tathāgata. ; arahaṃ=is an Arahant. ;

Myanmar Nissaya

arahantānanti=ကား။ ; kilesehi=တို့မှ။ ; ārakattā=အလွန်ဝေးသည်၏ အဖြစ်ကြောင့်။ ; tathāgato=သည်။ ; arahaṃ=မည်တော်မူ၏။ ; arīnaṃ=ကိလေသာတည်းဟူသော ရန်သူတို့ကိုလည်းကောင်း။ ; arānañca=သံသရာစက်၏ အကန့်တို့ကိုလည်းကောင်း။ ; hatattā=ဖျက်ဆီးတတ်သည်၏ အဖြစ်ကြောင့်။ ; tathāgato=သည်။ ; arahaṃ=မည်တော်မူ၏။ ; paccayādīnaṃ=သင်္ကန်းအစရှိသော ပစ္စည်း ပူဇော်အထူးအစရှိသည်တို့ကို။ ; arahattā=ခံတော်မူထိုက်သည်၏ အဖြစ်ကြောင့်။ ; tathāgato=သည်။ ; arahaṃ=မည်၏။ ; pāpakaraṇe=မကောင်းမှုကို ပြုခြင်း၌။ ; rahābhāvā=ဆိတ်ကွယ်ရာ မရှိသည်၏ အဖြစ်ကြောင့်။ ; tathāgato=သည်။ ; arahaṃ=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3871 | Chunk: 65

Ārakā hi so sabbakilesehi suvidūravidūre ṭhito maggena savāsanānaṃ kilesānaṃ pahīnattāti arahaṃ.

AI Translation based on Nissaya

Because the defilements together with their latent tendencies have been abandoned by the path, he stands far, at a very great distance from all defilements; thus he is an Arahant.

Vietnamese AI Translation

Bởi vì các phiền não cùng với các tùy miên của chúng đã được đoạn tận bởi đạo, Ngài đứng xa, ở một khoảng cách rất lớn so với tất cả các phiền não; do đó Ngài là một vị A-la-hán.

AI Translation Nissaya

hi vittāremi=Indeed, I shall explain. ; sobhagavā=that Blessed One. ; maggena=by the path of Arahantship. ; savāsanānaṃ=together with their latent tendencies. ; kilesānaṃ=the defilements. ; pahīnattā=because of having been abandoned. ; ārakā=is far from the defilements. ; sabbakilesehi=from all defilements. ; suvidūravidūre=at a very great distance. ; ṭhito=he stands. ; iti tasmā=therefore. ; arahaṃ=he is called an Arahant. ;

Myanmar Nissaya

hi vittāremi=အံ့။ ; sobhagavā=သည်။ ; maggena=အရဟတ္တမဂ်ဖြင့်။ ; savāsanānaṃ=ဝါသနာနှင့် တကွကုန်သော။ ; kilesānaṃ=တို့ကို။ ; pahīnattā=ပယ်အပ်သည်၏ အဖြစ်ကြောင့်။ ; ārakā=ကိလေသာတို့မှ အလွန်ဝေးတော်မူ၏။ ; sabbakilesehi=တို့မှ။ ; suvidūravidūre=အလွန်ဝေးသည်၌။ ; ṭhito=တည်တော်မူ၏။ ; iti tasmā=ကြောင့်။ ; arahaṃ=မည်တော်မူ၏။။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3872 | Chunk: 65

Asamaṅgī ca dosehi, nātho tenārahaṃ mato.

AI Translation based on Nissaya

He is not endowed with faults; for that reason, the Lord is known as an Arahant.

Vietnamese AI Translation

Ngài không bị phú bởi các lỗi lầm; vì lý do đó, Đức Thế Tôn được biết đến là một vị A-la-hán.

AI Translation Nissaya

Verse meaning: ; yassa bhagavato=to which Blessed One. ; yena kāraṇena=for which reason. ; asamaṅgitā=the state of not being endowed with defilements. ; hoti=is. ; doseti=the faults, i.e., the defilements. ; asamaṅgīca=the state of not being endowed. ; hoti=is. ; tato tasmākāraṇā=for that reason. ; sobhagavā=that Blessed One. ; ārakānāma=is called 'Āraka' (far). ; tena=because of being called Āraka in that way. ; nātho=the Protector. ; arahaṃ=as 'Arahaṃ'. ; mato=is known. ;

Myanmar Nissaya

ဂါထာအနက်။ ။ ; yassa bhagavato=အား။ ; yena kāraṇena=အကြင်အကြောင်းဖြင့်။ ; asamaṅgitā=ကိလေသာတို့နှင့် မပြည့်စုံသည်၏ အဖြစ်သည်။ ; hoti=၏။ ; doseti=ကိလေသာတည်းဟူသော အပြစ်တို့။ ; asamaṅgīca=မပြည့်စုံသည်၏ အဖြစ်သည်လည်း။ ; hoti=၏။ ; tato tasmākāraṇā=ကြောင့်။ ; sobhagavā=သည်။ ; ārakānāma=အာရကာမည်တော်မူ၏။ ; tena=ထိုသို့ အာရကာမည်ခြင်းကြောင့်။ ; nātho=ကို။ ; arahaṃ=အရဟ ဟူ၍။ ; mato=သိအပ်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3873 | Chunk: 65

Te cānena kilesārayo maggena hatāti arīnaṃ hatattāpi arahaṃ.

AI Translation based on Nissaya

And by him those enemies, the defilements, were destroyed with the path; thus, also because of having destroyed the enemies (ari), he is an Arahant.

Vietnamese AI Translation

Và bởi Ngài, những kẻ thù đó, tức là các phiền não, đã bị hủy diệt bằng đạo; do đó, cũng vì đã hủy diệt kẻ thù (ari), Ngài là một vị A-la-hán.

AI Translation Nissaya

ca=Now I shall explain the phrase 'because he has destroyed the enemies,' which is distinct from the meaning of 'being far.' ; anena bhagavatā=by this Blessed One. ; te kilesārayo=those enemies, the defilements. ; maggena=by the path of Arahantship. ; hatā=were destroyed. ; iti=Thus. ; arīnaṃ hatattāpi=also because of having destroyed the enemies, the defilements. ; arahaṃ=he is called an Arahant. ;

Myanmar Nissaya

ca=အာရကတ္တာ ဟူသော ပုဒ်၏ အကျယ်မှ တပါး အရီနံ ဟတတ္တာ ဟူသော ပုဒ်၏ အကျယ်ကို ဆိုအံ့။ ; anena bhagavatā=သည်။ ; te kilesārayo=ထိုကိလေသာတည်းဟူသော ရန်သူတို့ကို။ ; maggena=အရဟတ္တမဂ်ဖြင့်။ ; hatā=သိအပ်ကုန်၏။ ; iti=သို့။ ; arīnaṃ hatattāpi=ကိလေသာတည်းဟူသော ရန်သူတို့ကို သတ်တော်မူသည်၏ အဖြစ်ကြောင့်လည်း။ ; arahaṃ=မည်တော်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3874 | Chunk: 65

Yasmā rāgādisaṅkhātā, sabbepi arayo hatā;

AI Translation based on Nissaya

Because all the enemies called passion and so on were destroyed,

Vietnamese AI Translation

Bởi vì tất cả kẻ thù được gọi là tham ái và vân vân đã bị hủy diệt,

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3875 | Chunk: 65

Paññāsatthena nāthena, tasmāpi arahaṃ mato.

AI Translation based on Nissaya

by the Protector with the sword of wisdom, therefore he is also known as an Arahant.

Vietnamese AI Translation

bởi Đấng Hộ Trì với thanh gươm trí tuệ, do đó Ngài cũng được biết đến là một vị A-la-hán.

AI Translation Nissaya

Verse meaning: ; nāthena=by the Protector. ; yasmā=because. ; rāgādisaṅkhātā=called passion and so on. ; sabbepi=all. ; araho=the enemies. ; paññāsatthena=with the weapon of the wisdom of the Arahant path. ; hatā=were destroyed. ; tasmāpi=for that reason also. ; arahaṃ=as 'Arahant'. ; tato=he is known. ;

Myanmar Nissaya

ဂါထာအနက်။ ။ ; nāthena=သည်။ ; yasmā=ကြောင့်။ ; rāgādisaṅkhātā=ရာဂအစရှိသည်ဟု ဆိုအပ်ကုန်သော။ ; sabbepi=ကုန်သော။ ; araho=ရန်သူတို့ကို။ ; paññāsatthena=အရဟတ္တမဂ်ပညာ တည်းဟူသော လက်နက်ဖြင့်။ ; hatā=သိအပ်ကုန်၏။ ; tasmāpi=ကြောင့်လည်း။ ; arahaṃ=ဟူ၍။ ; tato=သိအပ်၏ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3876 | Chunk: 65

Yañcetaṃ [V1.181] avijjābhavataṇhāmayanābhipuññādiabhisaṅkhārānaṃ jarāmaraṇanemi āsavasamudayamayena akkhena vijjhitvā [P1.214] tibhavarathe samāyojitaṃ anādikālappavattaṃ saṃsāracakkaṃ, tassānena bodhimaṇḍe vīriyapādehi sīlapathaviyaṃ patiṭṭhāya saddhāhatthena kammakkhayakaraṃ ñāṇapharasuṃ gahetvā sabbe arā hatāti arānaṃ hatattāpi arahaṃ.

AI Translation based on Nissaya

And that wheel of saṃsāra [V1.181], which turns from beginningless time, with its hub made of ignorance, becoming, and craving, its spokes of meritorious and other formations, and its rim of aging and death, pierced by an axle made of the arising of the cankers and yoked to the chariot of the three states of existence—at the seat of enlightenment, standing on the ground of virtue with the feet of energy, having taken up the axe of knowledge which brings about the destruction of kamma with the hand of faith, he destroyed all the spokes (ara) of that wheel. Thus, also because of having destroyed the spokes, he is an Arahant [P1.214].

Vietnamese AI Translation

Và bánh xe luân hồi ấy [V1.181], quay từ vô thủy, với trục làm bằng vô minh, hữu và ái, các căm bánh xe làm bằng các hành có công đức và các hành khác, và vành bánh xe làm bằng lão và tử, được xuyên qua bởi một trục làm bằng sự khởi sanh của các lậu hoặc và được cột vào cỗ xe của ba cõi hữu—tại Bồ-đề đoàn, đứng trên nền tảng của giới với đôi chân của tinh tấn, đã cầm lấy chiếc rìu tri kiến mang lại sự hủy diệt của nghiệp bằng bàn tay của tín, Ngài đã hủy diệt tất cả các căm bánh xe (ara) của bánh xe đó. Do đó, cũng vì đã hủy diệt các căm bánh xe, Ngài là một vị A-la-hán [P1.214].

AI Translation Nissaya

ca=Now I shall explain the phrase 'because he has destroyed the spokes.' ; avijjābhavataṇhāmayanābhi=which has a hub made of ignorance, becoming, and craving. ; puññādiabhisaṅkhārānaṃ=and spokes of meritorious and other formations. ; jarāmaraṇanepi=and a rim of aging and death. ; āsavasamudayamayena=made of the cause that is the cankers. ; akkhena=with the axle. ; vijjhitvā=having pierced. ; tibhavarathe=in the chariot of the three kinds of existence, such as the sensual sphere existence. ; samayojitaṃ=yoked together from the beginning. ; vā=or, yoked together from the beginning in all its variations. ; anādikālapavattaṃ=which has been turning from beginningless time. ; yaṃ evaṃ saṃsāracakkaṃ=whatever such wheel of saṃsāra, which is the ceaseless arising of aggregates, āyatanas, and elements. ; atthi=there is. ; tassa saṃsāracakkassa=of that wheel of saṃsāra. ; anena bhagavatā=by this Blessed One. ; bodhimaṇḍe=at the Great Bodhi-tree where omniscience became clear. ; vā=or, at the time when omniscience became clear. ; vīriyapodehi=with the feet of energy. ; sīlapathaviyaṃ=on the ground of virtue. ; saddhāhatthena=with the hand of faith. ; kammakkhayataraṃ=which brings about the destruction of kamma, such as bodily kamma. ; ñāṇapharasuṃthe axe of path-knowledge. ; gahetvā=having taken up. ; sabbe=all. ; arā=the spokes. ; hatā=were destroyed. ; iti=Thus. ; arānaṃhatattāpi=also because of being one who has destroyed the spokes of the wheel of saṃsāra. ; arahaṃ=he is called an Arahant. ;

Myanmar Nissaya

ca=အရာနံ ဟတတ္တာဟူသော ပုဒ်၏ အကျယ်ကိုဆိုအံံ။ ; avijjābhavataṇhāmayanābhi=အဝိဇ္ဇာဘဝတဏှာဖြင့် ပြီးသော ပုံတောင်းလည်းရှိသော။ ; puññādiabhisaṅkhārānaṃ=ပုညာ ဘိသင်္ခါရအစရှိသော အကန့်လည်းရှိထသော။ ; jarāmaraṇanepi=ဇရာမရဏမတည်း ဟူသော အကွပ်လည်းရှိထသော။ ; āsavasamudayamayena=အာသဝေါတရားတည်း ဟူသော အကြောင်းဖြင့်ပြီးသော။ ; akkhena=ဝင်ရိုးဖြင့်။ ; vijjhitvā=လျှို၍။ ; tibhavarathe=ကာမဘဝ အစရှိသော ဘဝသုံးပါး တည်းဟူသော ရထား၌။ ; samayojitaṃ=အညီအညွတ် အစမှ စ၍ ယှဉ်အပ်သော။ ; vā=ခပ်သိမ်းသော အပြားအားဖြင့် အစမှ စ၍ ယှဉ်အပ်သော။ ; anādikālapavattaṃ=အစကင်းသော ကာလ၌ ဖြစ်သော။ ; yaṃ evaṃ saṃsāracakkaṃ=အကြင်ခန္ဓာအာယတနဓာတ်၏ မပြတ်ဖြစ်ခြင်းတည်းဟူသော သံသရာစက်သည်။ ; atthi=၏။ ; tassa saṃsāracakkassa=ကို။ ; anena bhagavatā=သည်။ ; bodhimaṇḍe=သဗ္ဗညုတဉာဏ်၏ ကြည်လင်ရာ မဟာဗောဓိ၌။ ; vā=သဗ္ဗညုတဉာဏ်၏ ကြည်လင်ရာ ကာလ၌။ ; vīriyapodehi=ဝီရိယတည်းဟူသော ခြေတို့ဖြင့်။ ; sīlapathaviyaṃ=သီလတည်းဟူသော မြေ၌။ ; saddhāhatthena=သဒ္ဓါတရားတည်းဟူသော လက်ဖြင့်။ ; kammakkhayataraṃ=ကာယကံ အစရှိသည် တို့၏ ကုန်ခြင်းကို ပြုတတ်သော။ ; ñāṇapharasuṃ=မဂ်ဉာဏ်တည်းဟူသော ပေါက်ဆိန်ကို။ ; gahetvā=စွဲကိုင်တော်မူ၍။ ; sabbe=ကုန်သော။ ; arā=အကန့်တို့ကို။ ; hatā=ဖျက်ဆီးတော်မူအပ်ကုန်၏။ ; iti=သို့။ ; arānaṃhatattāpi=သံသရာစက်၏ အကန့်တို့ကို ဖျက်ဆီးတော်မူတတ်သည်၏ အဖြစ်ကြောင့်လည်း။ ; arahaṃ=မည်တော်မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3877 | Chunk: 65

Lokanāthena tenesa, arahanti pavuccati.

AI Translation based on Nissaya

For that reason, the Lord of the World is called an Arahant.

Vietnamese AI Translation

Vì lý do đó, Đức Thế Tôn được gọi là A-la-hán.

AI Translation Nissaya

Verse meaning: ; lokanāthena=by the Protector of the world. ; yato yasmā=because. ; saṃsāracakkassa=of the wheel of saṃsāra. ; arā=the spokes. ; ñāṇāsinā=with the sword of the wisdom of the Arahant path. ; hatā=were destroyed. ; esa eso bhagavā=this Blessed One. ; arahanti=as 'Arahant'. ; pavuccati=is called. ;

Myanmar Nissaya

ဂါထာအနက်။ ။ ; lokanāthena=သည်။ ; yato yasmā=ကြောင့်။ ; saṃsāracakkassa=၏။ ; arā=အကန့်တို့ကို။ ; ñāṇāsinā=အရဟတ္တမဂ်ဉာဏ်တည်းဟူသော သန်လျှက်ဖြင့်။ ; hatā=ဖျက်ဆီးအပ်ကုန်၏။ ; esa eso bhagavā=ကို။ ; arahanti=ဟူ၍။ ; pavuccati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3878 | Chunk: 65

Aggadakkhiṇeyyattā ca cīvarādipaccaye arahati pūjāvisesañca.

AI Translation based on Nissaya

And because he is the most worthy of offerings, he is worthy (arahati) of requisites such as robes and of special offerings.

Vietnamese AI Translation

Và vì Ngài là người xứng đáng nhất với các vật cúng dường, Ngài xứng đáng (arahati) với các vật dụng như y phục và các vật cúng dường đặc biệt.

AI Translation Nissaya

ca=Now I shall explain the phrase 'because he is worthy of requisites and so on.' ; aggadakkhiṇeyyattā=because of being worthy of the highest offerings. ; cīvarādipaccaye=requisites such as robes. ; pūjāvisesañca=and special offerings. ; arahati=he is worthy of. ;

Myanmar Nissaya

ca=ပစ္စယာဒီနံ အရဟတ္တာ ဟူသော ပုဒ်၏ အကျယ်ကို ဆိုအံ့။ ; aggadakkhiṇeyyattā=မြတ်သော အလှူကို ခံတော်မူထိုက်သည်၏ အဖြစ်ကြောင့်။ ; cīvarādipaccaye=တို့ကိုလည်းကောင်း။ ; pūjāvisesañca=ကိုလည်းကောင်း။ ; arahati=ထိုက်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3879 | Chunk: 65

Teneva ca uppanne tathāgate ye keci mahesakkhā devamanussā, na te [M1.198] aññattha pūjaṃ karonti.

AI Translation based on Nissaya

For that very reason, when the Tathāgata had arisen, whatever devas and humans of great power there were did not make offerings elsewhere [M1.198].

Vietnamese AI Translation

Chính vì lý do đó, khi Như Lai đã xuất hiện, bất cứ vị trời và người nào có quyền năng lớn cũng không cúng dường ở nơi nào khác [M1.198].

AI Translation Nissaya

teneva=For that very reason. ; tathāgate=the Tathāgata. ; uppanne=when he had arisen. ; yekeci=whoever. ; mahesakkhā=of great power. ; devamanussā=devas and humans. ; sinerumattena=of the size of Mount Sineru. ; ratanadāmena=with a garland of jewels. ; uñcenti=they worship. ; te=those powerful devas. ; aññattha=in a place other than the Buddha. ; pūjaṃ=worship. ; nakaronti=do not perform. ;

Myanmar Nissaya

teneva=သာလျှင်။ ; tathāgate=သည်။ ; uppanne=သော်။ ; yekeci=ကုန်သော။ ; mahesakkhā=ကြီးသော တန်ခိုးရှိကုန်သော။ ; devamanussā=တို့သည်။ ; sinerumattena=ရှိသော။ ; ratanadāmena=ရတနာပန်းဆိုင်းဖြင့်။ ; uñcenti=ကုန်၏။ ; te=ထိုဘုန်းကြီးသော နတ်တို့သည်။ ; aññattha=ဘုရားမှ တပါးသော အရာ၌။ ; pūjaṃ=ပူဇော်ခြင်းကို။ ; nakaronti=မပြုကုန်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3880 | Chunk: 65

Tathā hi brahmā sahampati sinerumattena ratanadāmena tathāgataṃ pūjesi, yathābalañca aññe devā manussā ca bimbisārakosalarājādayo.

AI Translation based on Nissaya

Indeed, Brahmā Sahampati worshipped the Tathāgata with a jewel garland the size of Mount Sineru, and other devas and humans, such as King Bimbisāra and the King of Kosala, worshipped according to their ability.

Vietnamese AI Translation

Thật vậy, Phạm Thiên Sahampati đã cúng dường Như Lai bằng một vòng hoa quý giá to bằng núi Tu-di, và các vị trời và người khác, như vua Bimbisāra và vua xứ Kosala, đã cúng dường theo khả năng của họ.

AI Translation Nissaya

tathā taṃ vacanaṃ=that statement. ; hi saccaṃ=is true. ; sahammati=Sahampati. ; brahmā=the Brahmā. ; sinerumattena=of the size of Mount Sineru. ; ratanadāmena=with a garland of jewels. ; tathāgataṃ=the Tathāgata. ; pūjesi=worshipped. ; ca=Furthermore. ; yathābalaṃ=according to their ability. ; aññe=other. ; devā=devas. ; bimbisārakosalarājādayo=such as King Bimbisāra and the King of Kosala. ; manussācaand humans. ; pūjesuṃ=worshipped. ;

Myanmar Nissaya

tathā taṃ vacanaṃ=သည်။ ; hi saccaṃ=သည်။ ; sahammati=သောဗြဟ္မာသည်။ ; sinerumattena=ရှိသော။ ; ratanadāmena=ရတနာ ပန်းဆိုင်းဖြင့်။ ; tathāgataṃ=ကို။ ; pūjesi=ပြီ။ ; ca=ထိုမှ တပါး။ ; yathābalaṃ=အစွမ်းအားလျော်စွာ။ ; aññe=ကုန်သော။ ; devā=တို့သည်လည်းကောင်း။ ; bimbisārakosalarājādayo=အစရှိကုန်သော။ ; manussāca=တို့သည်လည်းကောင်း။ ; pūjesuṃ=ကုန်ပြီ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3881 | Chunk: 65

Parinibbutampi ca bhagavantaṃ uddissa channavutikoṭidhanaṃ vissajjetvā asokamahārājā sakalajambudīpe caturāsīti vihārasahassāni patiṭṭhāpesi, ko pana vādo aññesaṃ pūjāvisesānanti paccayādīnaṃ arahattāpi arahaṃ.

AI Translation based on Nissaya

Moreover, dedicating it to the Blessed One even after he had attained Parinibbāna, the great king Asoka gave away wealth of ninety-six crores and established eighty-four thousand great monasteries throughout all of Jambudīpa. What need is there to speak of the worthiness of other special offerings? Thus, also because of being worthy of requisites and so on, he is an Arahant.

Vietnamese AI Translation

Hơn nữa, để dâng cúng cho đức Thế Tôn ngay cả sau khi Ngài đã nhập Niết-bàn, vua A-dục vĩ đại đã cúng dường tài sản trị giá chín mươi sáu crores và thành lập tám mươi bốn ngàn ngôi chùa lớn trên khắp Jambudīpa. Cần gì phải nói về sự xứng đáng của các vật cúng dường đặc biệt khác? Do đó, cũng vì xứng đáng với các vật dụng, v.v., Ngài là một vị A-la-hán.

AI Translation Nissaya

ca=Furthermore. ; parinibbutampi=even though he had attained final Nibbāna. ; bhagavantaṃ=the Blessed One. ; uddissa=having dedicated to. ; channavutikoṭidhanaṃ=wealth of ninety-six crores. ; vissajjetvā=having given away. ; asokamahārājā=the great king Asoka. ; sakalajambudīpe=throughout all of Jambudīpa. ; caturāsītivihārasahassāni=eighty-four thousand monasteries. ; patiṭṭhāpeti=established. ; aññesaṃ=of others. ; pūjāvi sesānaṃ=of special offerings. ; rahābhāve=in the state of being worthy. ; kopanavādo=what need is there to speak? ; iti=Thus. ; paccayādīnaṃ arahattāpi=also because of being worthy of requisites such as robes and special offerings. ; arahaṃ=he is called an Arahant. ;

Myanmar Nissaya

ca=ထိုမှတပါး။ ; parinibbutampi=လည်းဖြစ်သော။ ; bhagavantaṃ=ကို။ ; uddissa=၍။ ; channavutikoṭidhanaṃ=ကိုးဆယ့်ခြောက်ကုဋေသော ဥစ္စာတို့ကို။ ; vissajjetvā=၍။ ; asokamahārājā=သည်။ ; sakalajambudīpe=၌။ ; caturāsītivihārasahassāni=ရှစ်သောင်းလေးထောင်သော ကျောင်းကြီးတို့ကို။ ; patiṭṭhāpeti=တည်စေပြီ။ ; aññesaṃ=တပါးသော သူတို့၏။ ; pūjāvi sesānaṃ=ပူဇော်အထူးတို့ကို။ ; rahābhāve=ခံထိုက်သည်၏ အဖြစ်၌။ ; kopanavādo=အဘယ်ဆိုဖွယ်ရှိရာအံံနည်း။ ; iti=သို့။ ; paccayādīnaṃ arahattāpi=သင်္ကန်းအစရှိသော ပူဇော် အထူးတို့ကို ခံတော်မူထိုက်သည်၏ အဖြစ်ကြောင့်လည်း။ ; arahaṃ=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3882 | Chunk: 65

Yathā ca loke ye keci paṇḍitamānino bālā asilokabhayena raho pāpaṃ karonti, evamesa na kadāci karotīti pāpakaraṇe rahābhāvatopi arahaṃ.

AI Translation based on Nissaya

And just as in the world some foolish people who imagine themselves to be wise do evil in secret for fear of a bad reputation, he never does so. Thus, also because he has no secret place (raha) for doing evil, he is an Arahant.

Vietnamese AI Translation

Và giống như trong thế gian, một số kẻ ngu si tự cho mình là thông thái làm điều ác một cách bí mật vì sợ tai tiếng, Ngài không bao giờ làm như vậy. Do đó, cũng vì Ngài không có nơi bí mật (raha) để làm điều ác, Ngài là một vị A-la-hán.

AI Translation Nissaya

ca=Now I shall explain further with the phrase 'because he has no secret place for doing evil.' ; sattepi=in the world of beings and the physical world. ; paṇḍitamānino=who pretend to be wise. ; bālā=the fools. ; asiloka bhayena=out of fear of being without fame. ; vā=or, out of fear of being censured. ; rato=in a place. ; pāpaṃ=evil. ; karontiyakā=just as they do. ; evaṃtathā=in the same way. ; esa eso bhagavā=this Blessed One. ; kadāci=ever. ; nakaroti=does not do. ; iti tasmā=therefore. ; pāpakaraṇe=in the doing of evil. ; rahābhāvatopi=also because of having no secret place. ; arahaṃ=he is 'Arahant'. ;

Myanmar Nissaya

ca=ပါပကရဏေ ရဟာဘာဝါ ဟူသော ပုဒ်ဖြင့် အကျယ်ကိုဆိုဦးအံ့။ ; sattepi=သတ္တလောက ဩကာသလော၌လည်း။ ; paṇḍitamānino=ပညာရှိဟန်ဆောင်ကုန်သော။ ; bālā=တို့သည်။ ; asiloka bhayena=အကျော်အစောမဲ့အပ်သည်မှ ကြောက်သော ကြောင့်။ ; vā=ကဲ့ရဲ့ အပ်သည်မှ ကြောက်သောကြောင့်။ ; rato=အရပ်၌။ ; pāpaṃ=မှုကို။ ; karontiyakā=ကဲ့သို့။ ; evaṃtathā=အတူ။ ; esa eso bhagavā=သည်။ ; kadāci=မျှလည်း။ ; nakaroti=မမူ။ ; iti tasmā=ကြောင့်။ ; pāpakaraṇe=၌။ ; rahābhāvatopi=ကြောင့်လည်း။ ; arahaṃ=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3883 | Chunk: 65

Rahābhāvena tenesa, arahaṃ iti vissuto.

AI Translation based on Nissaya

Because he has no secret place, he is renowned as an Arahant.

Vietnamese AI Translation

Bởi vì Ngài không có nơi bí mật, Ngài nổi tiếng là một vị A-la-hán.

AI Translation Nissaya

Verse meaning: ; tādino=of the steadfast one, who is endowed with the quality of patience, the Blessed One. ; yasmā=because. ; pāpakammesu=in evil deeds. ; rahonāma=what is called a secret place. ; natthi=does not exist. ; tenarahābhāvena=because of that absence of a secret place. ; esa eso bhāgavā=this Blessed One. ; arahaṃiti=as 'Arahant'. ; vissuto=is renowned. ; evaṃ imināvuttanayena=In this way that has been explained, beginning with 'because of being far from defilements'. ; sabbathāpi=in every way. ; vuccati=he is called. ;

Myanmar Nissaya

ဂါထာအနက်။ ။ ; tādino=သည်းခံခြင်း ဂုဏ်ကျေးဇူးနှင့် ပြည့်စုံတော်မူသော မြတ်စွာဘုရားအား။ ; yasmā=ကြောင့်။ ; pāpakammesu=တို့၌။ ; rahonāma=မည်သည်။ ; natthi=မရှိ။ ; tenarahābhāvena=အဖြစ်ကြောင့်။ ; esa eso bhāgavā=သည်။ ; arahaṃiti=ဟူ၍။ ; vissuto=ထင်ရှားတော်မူ၏။ ; evaṃ imināvuttanayena=ဤကိလေသေဟိ အာရကတ္တာ အစရှိသည်တို့ဖြင့် ဆိုအပ်ပြီးသည့် နည်းဖြင့်။ ; sabbathāpi=ဖြင့်လည်း။ ; vuccati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3884 | Chunk: 65

Na raho karoti pāpāni, arahaṃ tena vuccatīti.

AI Translation based on Nissaya

He does no evil in secret; for that reason he is called Arahant.

Vietnamese AI Translation

Ngài không làm điều ác một cách bí mật; vì lý do đó Ngài được gọi là A-la-hán.

AI Translation Nissaya

Verse meaning: ; ārakattā=because of being far from the defilements... etc. ; kilesārīnaṃ=the enemies, the defilements. ; hatattāca=and because of having destroyed. ; arahaṃ=he is called an Arahant. ; somuni=that sage. ; hatasaṃsāra cakkāro=has destroyed the spokes of the wheel of saṃsāra. ; paccayādīnaṃ=requisites and so on. ; arahoca=he is worthy. ; raho=in secret. ; pāpāni=evil deeds. ; nakaroti=he does not do. ; tena=for that reason. ; arahaṃas 'Arahant'. ; vuccati=he is called. ; itiayaṃ=this. ; saṅgahavāthā=is the summary verse. ;

Myanmar Nissaya

ဂါထာအနက်။ ။ ; ārakattā=ကိလေသာတို့မှ။ပ။ ကြောင့်လည်းကောင်း။ ; kilesārīnaṃ=တို့ကို။ ; hatattāca=လည်းကောင်း။ ; arahaṃ=မည်တော်မူ၏။ ; somuni=ထိုမြတ်စွာဘုရားသည်။ ; hatasaṃsāra cakkāro=ဖျက်ဆီးအပ်ပြီးသော သံသရာစက်၏ အကန့်လည်းရှိတော်မူ၏။ ; paccayādīnaṃ=တို့ကို။ ; arahoca=ထိုက်၏။ ; raho=အရပ်၌။ ; pāpāni=တို့ကို။ ; nakaroti=မမူ။ ; tena=ကြောင့်။ ; arahaṃ=ဟူ၍။ ; vuccati=၏။ ; itiayaṃ=ကား။ ; saṅgahavāthā=အကျဉ်းပေါင်း၌ယူသော ဂါထာတည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3885 | Chunk: 65

Yasmā [V1.182 P1.215] pana sabbabuddhā arahattaguṇenāpi samasamā, tasmā sabbesaṃ vasena ‘‘arahantānan’’ ti āha.

AI Translation based on Nissaya

But since [V1.182 P1.215] all Buddhas are exactly equal also in regard to the quality of Arahantship, he therefore said “of the Arahants,” by way of all of them.

Vietnamese AI Translation

Nhưng vì [V1.182 P1.215] tất cả các vị Phật đều hoàn toàn bình đẳng về phẩm chất A-la-hán, do đó, ngài đã nói “của các bậc A-la-hán,” để chỉ tất cả các vị ấy.

AI Translation Nissaya

yasmā=Because. ; sabbabuddhā=all Buddhas. ; arahattaguṇenāpi=also by the quality of the fruit of Arahantship. ; samasamā=are exactly equal. ; tasmā=Therefore. ; sabbesaṃ=of all of them. ; vasena=by way of. ; arahantānanti=as 'arahantānaṃ'. ; āha=he spoke in the plural. ;

Myanmar Nissaya

yasmā=ကြောင့်။ ; sabbabuddhā=တို့သည်။ ; arahattaguṇenāpi=အရဟတ္တဖိုလ်ဂုဏ်အားဖြင့်လည်း။ ; samasamā=ထပ်တူထပ်မျှ ရှိကုန်၏။ ; tasmā=ကြောင့်။ ; sabbesaṃ=တို့၏။ ; vasena=ဖြင့်။ ; arahantānanti=ဟူ၍။ ; āha=ဗဟုဝစနအားဖြင့် ဟောတော်မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3886 | Chunk: 65

Sammāsambuddhānan ti sammā sāmañca sabbadhammānaṃ buddhattā sammāsambuddho.

AI Translation based on Nissaya

As for **of the Perfectly Self-Enlightened Ones**: he is a Perfectly Self-Enlightened One because he has understood all things rightly and by himself.

Vietnamese AI Translation

Đối với **của các bậc Chánh Đẳng Chánh Giác**: Ngài là một vị Chánh Đẳng Chánh Giác vì Ngài đã hiểu tất cả các pháp một cách đúng đắn và tự mình.

AI Translation Nissaya

sammāsambuddhānanti=As for 'of the Perfectly Self-Enlightened Ones'. ; sammā=rightly. ; sāmañca=and by himself. ; sabbadhammānaṃall things. ; buddhattā=because of having understood. ; sammāsambuddho=he is called Perfectly Self-Enlightened. ;

Myanmar Nissaya

sammāsambuddhānanti=ကား။ ; sammā=မပြန်။ ; sāmañca=သာလျှင်။ ; sabbadhammānaṃ=တို့ကို။ ; buddhattā=ကြောင့်။ ; sammāsambuddho=မည်တော်မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3887 | Chunk: 65

Tathā hesa sabbadhamme sammā sambuddho, abhiññeyye dhamme abhiññeyyato buddho, pariññeyye dhamme pariññeyyato, pahātabbe dhamme pahātabbato, sacchikātabbe dhamme sacchikātabbato, bhāvetabbe dhamme bhāvetabbato.

AI Translation based on Nissaya

Indeed, he has understood all things rightly and by himself. He has understood things to be understood as they should be understood; he has fully understood things to be fully understood as they should be fully understood; he has abandoned things to be abandoned as they should be abandoned; he has realized things to be realized as they should be realized; he has developed things to be developed as they should be developed.

Vietnamese AI Translation

Thật vậy, Ngài đã hiểu tất cả các pháp một cách đúng đắn và tự mình. Ngài đã hiểu những điều cần được hiểu như chúng nên được hiểu; Ngài đã liễu tri những điều cần được liễu tri như chúng nên được liễu tri; Ngài đã đoạn tận những điều cần được đoạn tận như chúng nên được đoạn tận; Ngài đã chứng ngộ những điều cần được chứng ngộ như chúng nên được chứng ngộ; Ngài đã phát triển những điều cần được phát triển như chúng nên được phát triển.

AI Translation Nissaya

tathā taṃ vacanaṃ=that statement. ; hi saccaṃ=is true. ; esa eso bhagavā=this Blessed One. ; sabbadhamme=all things. ; sammā=rightly. ; sambuddho=understood by himself. ; abhiññeyya=by their nature, such as impermanence, characteristic, function, etc. ; vipassanānaṃ=by means of wisdom, i.e., insight-wisdom, path-wisdom, and omniscience, which should be known. ; dhamme=the four noble truths. ; abhiññeyyato=because of having known. ; buddho=he has known. ; pariññeyya=which are to be fully understood. ; dhamme=the truths of suffering. ; pariññeyyato=because of having fully understood. ; buddho=he has known. ; pahātabbe=which are to be abandoned. ; dhamme=the truths of the origin. ; pahātabbato=because of having abandoned. ; buddho=he has known. ; sacchikātabbe=which are to be realized. ; dhamme=the truths of cessation, which are distinguished as with and without residue. ; sacchikātabbato=because of having realized. ; buddhohe has known. ; bhāvetabbe=which are to be developed. ; dhamme=the truths of the path. ; bhāvetabbato=because of having developed. ; buddhohe has known. ;

Myanmar Nissaya

tathā taṃ vacanaṃ=သည်။ ; hi saccaṃ=သည်။ ; esa eso bhagavā=သည်။ ; sabbadhamme=တို့ကို။ ; sammā=မပြန်။ ; sambuddho=အလိုလို သိတော်မူ၏။ ; abhiññeyya=အနိစ္စ အစရှိသော သဘော, လက္ခဏ ရသ အစရှိသော သဘောအားဖြင့်။ ; vipassanānaṃ=ဝိပဿနာဉာဏ် မဂ်ဉာဏ် သဗ္ဗညုတဉာဏ် တည်းဟူသော ဉာဏ်အားဖြင့် သိအပ်ကုန်သော။ ; dhamme=သစ္စာလေးပါးတရားတို့ကို။ ; abhiññeyyato=သိတော်မူသည်၏ အဖြစ်ကြောင့်။ ; buddho=သိတော်မူပြီ။ ; pariññeyya=ပိုင်းခြား၍ သိအပ်ကုန်သော။ ; dhamme=ဒုက္ခသစ္စာ တရားတို့ကို။ ; pariññeyyato=ပိုင်းခြား၍ သိတော်မူသည်၏ အဖြစ်ကြောင့်။ ; buddho=သိတော်မူပြီ။ ; pahātabbe=ပယ်အပ်ကုန်သော။ ; dhamme=သမုဒယ သစ္စာတို့ကို။ ; pahātabbato=အဖြစ်ကြောင့်။ ; buddho=ပြီ။ ; sacchikātabbe=မျက်မှောက်ပြုအပ်ကုန်သော။ ; dhamme=ဥပါဒိသေသ စသော အားဖြင့် ပြားသော နိရောဓသစ္စာတို့ကို။ ; sacchikātabbato=အဖြစ်ကြောင့်။ ; buddho=ပြီ။ ; bhāvetabbe=ပွားစေအပ်ကုန်သော။ ; dhamme=မဂ္ဂသစ္စာတို့ကို။ ; bhāvetabbato=အဖြစ်ကြောင့်။ ; buddho=ပြီ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3888 | Chunk: 65

Tenevāha –

AI Translation based on Nissaya

For that very reason he said:

Vietnamese AI Translation

Chính vì lý do đó Ngài đã nói:

AI Translation Nissaya

teneva=For that very reason. ;

Myanmar Nissaya

teneva=ထိုကြောင့်သာလျှင်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3889 | Chunk: 65

‘‘Abhiññeyyaṃ abhiññātaṃ, bhāvetabbañca bhāvitaṃ;

AI Translation based on Nissaya

“'What should be directly known has been directly known, what should be developed has been developed,

Vietnamese AI Translation

“'Những gì cần được trực tiếp biết đã được trực tiếp biết, những gì cần được phát triển đã được phát triển,

AI Translation Nissaya

abhiññeyyaṃ.la.=What is to be directly known... etc. ;

Myanmar Nissaya

abhiññeyyaṃ.la.= ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3890 | Chunk: 65

Pahātabbaṃ pahīnaṃ me, tasmā buddhosmi brāhmaṇā’’ ti. ( ma. ni. 2.399; su. ni. 563);

AI Translation based on Nissaya

“What should be abandoned has been abandoned by me, therefore, O brahmin, I am a Buddha.” (Majjhima Nikāya II, 399; Suttanipāta 563).

Vietnamese AI Translation

“Những gì cần được đoạn tận đã được Ta đoạn tận, do đó, hỡi vị bà-la-môn, Ta là một vị Phật.” (Majjhima Nikāya II, 399; Suttanipāta 563).

AI Translation Nissaya

brahmāṇāti=thus. ; (majjhimāpaṇṇāsake=in the Majjhimāpaṇṇāsaka. ; brahmāyusutteca=and in the Brahmāyu Sutta. ; majjhimapaṇṇāsaka suttanipātesu=in the Majjhimapaṇṇāsaka and Suttanipāta. ; selasutteca=and in the Sela Sutta.). ; āha=he said. ; Meaning of the verse. ; brāhmaṇa=O Brahmin Brahmāyu. ; vā=or Brahmin Sela. ; abhiññeyyaṃ=the truth of suffering, which is to be directly known by means of insight knowledge, etc. ; memayā=by me. ; abhiññātaṃ=has been directly known. ; bhāvetabbañca=and the truth of the path and the truth of cessation, which are to be developed and realized. ; me mayā=by me. ; bhāvitaṃ=have been developed and realized. ; pahātabbaṃ=the truth of the origin, which is to be abandoned. ; mema yā=by me. ; pahīnaṃ=has been abandoned. ; tasmā=Therefore. ; buddho=I am a Buddha. ; asmi=I am. ;

Myanmar Nissaya

brahmāṇāti=ဟူ၍။ ; (majjhimāpaṇṇāsake=၌။ ; brahmāyusutteca=၌လည်းကောင်း။ ; majjhimapaṇṇāsaka suttanipātesu=တို့၌။ ; selasutteca=၌လည်းကောင်း။) ; āha=၏။ ; ဂါထာအနက်။ ။ ; brāhmaṇa=ဗြဟ္မာယုပုဏ္ဏား။ ; vā=သေလပုဏ္ဏား။ ; abhiññeyyaṃ=ဝိပဿနာဉာဏ်စသည်ဖြင့် သိအပ်သော ဒုက္ခသစ္စာကို။ ; memayā=သည်။ ; abhiññātaṃ=၌ သိအပ်၏။ ; bhāvetabbañca=ပွားစေအပ် မျက်မှောက် ပြုအပ်သော မဂ္ဂသစ္စာ နိရောဓသစ္စာကိုလည်း။ ; me mayā=သည်။ ; bhāvitaṃ=ပွားစေအပ် မျက်မှောက်ပြုအပ်၏။ ; pahātabbaṃ=ပယ်အပ်သော သမုဒယသစ္စာကို။ ; mema yā=သည်။ ; pahīnaṃ=ပယ်အပ်ပြီ။ ; tasmā=ကြောင့်။ ; buddho=မည်သည်။ ; asmi=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3891 | Chunk: 66

Atha [M1.199] vā cakkhu dukkhasaccaṃ, tassa mūlakāraṇabhāvena samuṭṭhāpikā purimataṇhā samudayasaccaṃ, ubhinnaṃ appavatti nirodhasaccaṃ, nirodhappajānanā paṭipadā maggasaccanti evaṃ ekekapaduddhārenāpi sabbadhamme sammā sāmañca buddho.

AI Translation based on Nissaya

Alternatively, the eye is the truth of suffering; the previous craving that brings it into existence by being its root cause is the truth of the origin; the non-occurrence of both is the truth of cessation; the practice of knowing cessation is the truth of the path. Thus, even by way of analyzing each single term, he has rightly and by himself understood all things.

Vietnamese AI Translation

Hoặc cách khác, mắt là chân lý về khổ; ái trước đó mang nó vào hiện hữu bằng cách là nguyên nhân gốc rễ của nó là chân lý về nguồn gốc; sự không xảy ra của cả hai là chân lý về sự chấm dứt; sự thực hành để biết sự chấm dứt là chân lý về con đường. Do đó, ngay cả bằng cách phân tích từng thuật ngữ đơn lẻ, Ngài đã hiểu tất cả các pháp một cách đúng đắn và tự mình.

AI Translation Nissaya

athavā=Alternatively. ; cakkhu=the eye. ; dukkhasaccaṃ=is the truth of suffering. ; tassa=Of that eye. ; mūlakāraṇabhāvena=by being the root cause. ; samuṭṭhāpikā=which brings into existence. ; purimataṇhā=the previous craving that arose in a former existence. ; samudayasaccaṃ=is the truth of the origin. ; ubhinnaṃ=of both the eye and craving. ; appavatti=the non-occurrence. ; nirodhasaccaṃ=is the truth of cessation. ; nirodhappajānanā=knowing the truth of cessation through direct realization and penetration. ; paṭipadā=the practice. ; maggasaccaṃ=is the truth of the path. ; iti evaṃ=Thus. ; ekekapaduddhārenāpi=even by way of extracting each single term. ; sabbadhamme=all things. ; sammā=rightly. ; sāmañca=and by himself. ; buddho=he has understood. ;

Myanmar Nissaya

athavā=ကား။ ; cakkhu=သည်။ ; dukkhasaccaṃ=မည်၏။ ; tassa=ထိုစက္ခု၏။ ; mūlakāraṇabhāvena=မူလဖြစ်၍ ဖြစ်သော အကြောင်း၏ အဖြစ်ဖြင့်။ ; samuṭṭhāpikā=ဖြစ်စေတတ်သော။ ; purimataṇhā=ရွေ့ဘဝ၌ ဖြစ်ပြီးသော တဏှာသည်။ ; samudayasaccaṃ=မည်၏။ ; ubhinnaṃ=ကုန်သော စက္ခုတဏှာတို့၏။ ; appavatti=မဖြစ်ခြင်း၏ အကြောင်းသည်။ ; nirodhasaccaṃ=မည်၏။ ; nirodhappajānanā=မျက်မှောက်ပြုခြင်း ထိုးထွင်း၍ အစွမ်းဖြင့် နိရောဓ သစ္စာကို သိတတ်သော။ ; paṭipadā=အကျင့်သည်။ ; maggasaccaṃ=မည်၏။ ; iti evaṃ=သို့။ ; ekekapaduddhārenāpi=တစ်ခုတစ်ခုသော အဖို့အစုကို ထုတ်ခြင်းအားဖြင့်လည်း။ ; sabbadhamme=တို့ကို။ ; sammā=မပြန်။ ; sāmañca=သာလျှင်။ ; buddho=မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3892 | Chunk: 66

Esa nayo sotaghānajivhākāyamanesu.

AI Translation based on Nissaya

This same method applies to the ear, nose, tongue, body, and mind.

Vietnamese AI Translation

Phương pháp tương tự này áp dụng cho tai, mũi, lưỡi, thân và ý.

AI Translation Nissaya

sonaghānajivhākāyamanesu=in the cases of the ear, nose, tongue, body, and mind. ; esa nayo=this is the method. ;

Myanmar Nissaya

sonaghānajivhākāyamanesu=တို့၌။ ; esa nayo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3893 | Chunk: 66

Eteneva nayena rūpādīni cha āyatanāni, cakkhuviññāṇādayo cha viññāṇakāyā, cakkhusamphassādayo cha phassā, cakkhusamphassajādayo cha vedanā, rūpasaññādayo cha saññā, rūpasañcetanādayo cha cetanā, rūpataṇhādayo cha taṇhākāyā, rūpavitakkādayo cha vitakkā, rūpavicārādayo cha vicārā, rūpakkhandhādayo pañcakkhandhā, dasa kasiṇāni, dasa anussatiyo, uddhumātakasaññādivasena dasa saññā, kesādayo dvattiṃsākārā, dvādasāyatanāni, aṭṭhārasa dhātuyo, kāmabhavādayo nava bhavā, paṭhamādīni cattāri jhānāni, mettābhāvanādayo catasso appamaññā, catasso arūpasamāpattiyo, paṭilomato jarāmaraṇādīni, anulomato avijjādīni paṭiccasamuppādaṅgāni ca yojetabbāni.

AI Translation based on Nissaya

By this very same method, the following should be analyzed: the six sense bases beginning with forms; the six classes of consciousness beginning with eye-consciousness; the six contacts beginning with eye-contact; the six feelings beginning with feeling born of eye-contact; the six perceptions beginning with perception of form; the six volitions beginning with volition regarding form; the six classes of craving beginning with craving for forms; the six thoughts beginning with thought on forms; the six examinations beginning with examination of forms; the five aggregates beginning with the form aggregate; the ten kasiṇas; the ten recollections; the ten perceptions by way of the perception of a bloated corpse and so on; the thirty-two parts of the body beginning with head-hair; the twelve sense bases; the eighteen elements; the nine kinds of existence beginning with existence in the desire realm; the four jhānas beginning with the first; the four immeasurables beginning with the development of loving-kindness; the four formless attainments; and the links of dependent origination in reverse order beginning with aging-and-death, and in forward order beginning with ignorance.

Vietnamese AI Translation

Theo đúng phương pháp này, những điều sau đây cần được phân tích: sáu xứ bắt đầu bằng sắc; sáu loại thức bắt đầu bằng nhãn thức; sáu xúc bắt đầu bằng nhãn xúc; sáu thọ bắt đầu bằng thọ sanh từ nhãn xúc; sáu tưởng bắt đầu bằng sắc tưởng; sáu tư bắt đầu bằng tư về sắc; sáu loại ái bắt đầu bằng ái đối với sắc; sáu tầm bắt đầu bằng tầm về sắc; sáu tứ bắt đầu bằng tứ về sắc; năm uẩn bắt đầu bằng sắc uẩn; mười đề mục kasiṇa; mười niệm; mười tưởng theo cách tưởng về tử thi sình trương, v.v.; ba mươi hai thể trược bắt đầu bằng tóc; mười hai xứ; mười tám giới; chín loại hữu bắt đầu bằng dục hữu; bốn thiền bắt đầu bằng sơ thiền; bốn vô lượng tâm bắt đầu bằng sự phát triển tâm từ; bốn thiền vô sắc; và các chi của duyên khởi theo thứ tự ngược bắt đầu bằng lão-tử, và theo thứ tự xuôi bắt đầu bằng vô minh.

AI Translation Nissaya

eteneva nayena=By this very same method. ; rūpādīni=forms and so on, which are. ; chaāyatanāni=the six sense bases, and also. ; cakkhuviññāṇādayo=eye-consciousness and so on, which are. ; cha viññāṇakāyā=the six classes of consciousness, and also. ; cakkhusambassādayo=eye-contact and so on, which are. ; chaphassā=the six contacts, and also. ; cakkhusambassajādayo=feeling born of eye-contact and so on, which are. ; chavedanā=the six feelings, and also. ; rūpasaññādayeū=perception of form and so on, which are. ; chasaññā=the six perceptions, and also. ; rūpasañcetanādayo=volition regarding form and so on, which are. ; cha cetanā=the six volitions, and also. ; rūpataṇhā dayo=craving for form and so on, which are. ; tataṇhākāyā=the six classes of craving, and also. ; rūpavitakkādayo=thought on forms and so on, which are. ; chavitakkā=the six thoughts, and also. ; rūpavicārādayo=examination of forms and so on, which are. ; chavicārā=the six examinations, and also. ; rūpakkhandhādayo=the form aggregate and so on, which are. ; pañcakkhandhā=the five aggregates, and also. ; dasakasiṇāni=the jhānas that have the ten kasiṇas as their object, and also. ; dasaanussatiyo=the access-jhānas that have the ten recollections as their object, and also. ; uddhumātakasaññādivasena=by way of the perception of a bloated corpse, etc. ; dasasaññā=the ten perceptions, and also. ; kesādayo=head-hair and so on, which are. ; dvattiṃsakārā=the jhānas that have the thirty-two parts of the body as their object, and also. ; dvādasāyatanāni=the twelve sense bases, and also. ; aṭaṭhārasadhātuyo=the eighteen elements, and also. ; kāmabhavādayo=existence in the desire realm and so on, which are. ; navabhavā=the nine kinds of existence, and also. ; paṭhamādīni=the first jhānas and so on, which are. ; cattāri jhānāni=the four jhānas, and also. ; mettābhāvanādayo=the development of loving-kindness and so on, which are. ; catasso=the four. ; appamaññā=immeasurables, and also. ; catasso=the four. ; arūpasamāpattiyo=formless attainments, and also. ; paṭilomato=by way of the reverse order. ; jarāmaraṇādīni=aging-and-death and so on, which are. ; paṭiccasamuppādaṅgāni=the links of dependent origination, and also. ; anulomato=by way of the forward order. ; avijjādīni=ignorance and so on, which are. ; paṭiccasamuppādaṅgānica=the links of dependent origination as well. ; yojetabbāni=should be connected. ;

Myanmar Nissaya

eteneva nayena=ဖြင့်သာလျှင်။ ; rūpādīni=ကုန်သော။ ; chaāyatanāni=တို့ကိုလည်းကောင်း။ ; cakkhuviññāṇādayo=ကုန်သော။ ; cha viññāṇakāyā=တို့ကိုလည်းကောင်း။ ; cakkhusambassādayo=ကုန်သော။ ; chaphassā=တို့ကိုလည်းကောင်း။ ; cakkhusambassajādayo=ကုန်သော။ ; chavedanā=တို့ကိုလည်းကောင်း။ ; rūpasaññādayeū=ကုန်သော။ ; chasaññā=တို့ကိုလည်းကောငး်။ ; rūpasañcetanādayo=ကုန်သော။ ; cha cetanā=တို့ကိုလည်းကောင်း။ ; rūpataṇhā dayo=ကုန်သော။ ; tataṇhākāyā=တို့ကိုလည်းကောင်း။ ; rūpavitakkādayo=ကိန်သော။ ; chavitakkā=တို့ကိုလည်းကောင်း။ ; rūpavicārādayo=ကုန်သော။ ; chavicārā=တို့ကိုလည်းကောင်း။ ; rūpakkhandhādayo=ကုန်သော။ ; pañcakkhandhā=တို့ကိုလည်းကောင်း။ ; dasakasiṇāni=ကသိုဏ်းဆယ်ပါးလျှင် အာရုံရှိသော ဈာန်တို့ကို လည်းကောင်း။ ; dasaanussatiyo=ဆယ်ပါးသော အနုဿတိလျှင် အာရုံရှိသော ဥပစာရဈာန်တို့ကိုလည်းကောင်း။ ; uddhumātakasaññādivasena=တို့၏အစွမ်းဖြင့်။ ; dasasaññā=တို့ကို့လည်းကောင်း။ ; kesādayo=ကုန်သော။ ; dvattiṃsakārā=သုံးဆယ့်နှစ်ပါးသော အစုလျှင် အာရုံရှိသော ဈာန်တို့ကိုလည်းကောင်း။ ; dvādasāyatanāni=တို့ကိုလည်းကောင်း။ ; aṭaṭhārasadhātuyo=တို့ကိုလည်းကောင်း။ ; kāmabhavādayo=ကုန်သော။ ; navabhavā=ကိုပါးသော ဘဝတို့ကိုလည်းကောင်း။ ; paṭhamādīni=ပဌမဈာန် အစရှိကုန်သော။ ; cattāri jhānāni=တို့ကိုလည်းကောင်း။ ; mettābhāvanādayo=ကုန်သော။ ; catasso=ကုန်သော။ ; appamaññā=တို့ကိုလည်းကောင်း။ ; catasso=ကုန်သော။ ; arūpasamāpattiyo=တို့ကိုလည်းကောင်း။ ; paṭilomato=အားဖြင့်။ ; jarāmaraṇādīni=အစရှိကုန်သော။ ; paṭiccasamuppādaṅgāni=တို့ကိုလည်းကောင်း။ ; anulomato=အားဖြင့်။ ; avijjādīni=ကုန်သော။ ; paṭiccasamuppādaṅgānica=တို့ကိုလည်းကောင်း။ ; yojetabbāni=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3894 | Chunk: 66

Tatrāyaṃ ekapadayojanā – jarāmaraṇaṃ dukkhasaccaṃ, jāti samudayasaccaṃ, ubhinnaṃ nissaraṇaṃ nirodhasaccaṃ, nirodhappajānanā paṭipadā maggasaccanti evaṃ ekekapaduddhārena sabbadhamme sammā sāmañca buddho anubuddho paṭividdho.

AI Translation based on Nissaya

Herein, this is the application to a single term: aging and death is the truth of suffering; birth is the truth of the origin; the escape from both is the truth of cessation; the practice of knowing cessation is the truth of the path. In this way, by analyzing each single term, he has rightly and by himself understood, sequentially understood, and penetrated all things.

Vietnamese AI Translation

Ở đây, đây là sự áp dụng cho một thuật ngữ đơn lẻ: lão và tử là chân lý về khổ; sanh là chân lý về nguồn gốc; sự thoát khỏi cả hai là chân lý về sự chấm dứt; sự thực hành để biết sự chấm dứt là chân lý về con đường. Theo cách này, bằng cách phân tích từng thuật ngữ đơn lẻ, Ngài đã hiểu một cách đúng đắn và tự mình, hiểu một cách tuần tự, và thâm nhập tất cả các pháp.

AI Translation Nissaya

ekapadayojanā=The application to a single term is. ; jarāmaracaṃ=aging and death. ; dukkhasaccaṃ=is the truth of suffering. ; jāti=Birth. ; samudayasaccaṃ=is the truth of the origin. ; ubhinnaṃ=Of the two truths. ; nissaraṇaṃ=the escape. ; nirodhasaccaṃ=is the truth of cessation. ; nirodhappajānanā=knowing the truth of cessation through direct realization and penetration. ; paṭipadā=the practice. ; maggasaccaṃ=is the truth of the path. ; itievaṃ=Thus. ; ekekapaduddhārena=by way of extracting each single term. ; sabbadhamme=all things. ; sammā=rightly. ; sāmañca=and by oneself. ; buddho=he has understood. ; anubuddho=he has sequentially understood. ; paṭividdho=he has penetrated. ;

Myanmar Nissaya

ekapadayojanā=တခုသော အဖို့ကို ယှဉ်ခြင်းသည်။ ; jarāmaracaṃ=သည်။ ; dukkhasaccaṃ=ဒုက္ခသစ္စာမည်၏။ ; jāti=သည်။ ; samudayasaccaṃ=သည်။ ; ubhinnaṃ=နှစ်ပါးသော သစ္စာတို့၏။ ; nissaraṇaṃ=ထွက်မြောက်ရာ သ်ည။ ; nirodhasaccaṃ=မည်၏။ ; nirodhappajānanā=မျက်မှောက်ပြုခြင်းထိုးထွင်း၍ သိခြင်းဖြင့် နိရောမသစ္စာကို သိတတ်သော။ ; paṭipadā=အကျင့်သည်။ ; maggasaccaṃ=မည်၏။ ; itievaṃ=သို့။ ; ekekapaduddhārena=အားဖြင့်။ ; sabbadhamme=တို့ကို။ ; sammā=ပြန်။ ; sāmañca=လျှင်။ ; buddho=မူ၏။ ; anubuddho=သိအပ်သော တရားအာလျော်သောအာဖြင့် သိတော်မူ၏။ ; paṭividdho=ထိုးထွင်း၍ သိတော်မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3895 | Chunk: 66

Yaṃ vā pana kiñci atthi neyyaṃ nāma, sabbassa sammā sambuddhattā vimokkhantikañāṇavasena sammāsambuddho.

AI Translation based on Nissaya

Furthermore, because he has rightly and by himself fully awakened to whatever knowable phenomena exist, by the power of the knowledge that is the culmination of liberation—that is, the knowledge of omniscience which is obtained immediately after the reviewing knowledge that occurs at the end of the fruit of Arahantship—he is called a Perfectly Self-Enlightened One.

Vietnamese AI Translation

Hơn nữa, vì Ngài đã hoàn toàn giác ngộ tất cả các pháp có thể biết, bằng sức mạnh của trí tuệ là đỉnh cao của sự giải thoát—đó là trí tuệ toàn giác (omniscience) đạt được ngay sau khi phản khán trí xảy ra vào cuối quả A-la-hán—Ngài được gọi là một vị Chánh Đẳng Chánh Giác.

AI Translation Nissaya

vāpana=Furthermore. ; yaṃ kiñci=whatever. ; neyyaṃ nāma=is called knowable phenomena. ; atthi=that exists. ; sabbassa=all those knowable phenomena. ; sammā=rightly. ; sambuddhattā=because of having fully awakened to them by himself. ; vimokkhantikañāṇavasena=by the power of the knowledge that is the culmination of liberation, which is the omniscience obtained immediately after the reviewing knowledge that occurs at the end of the fruit of Arahantship. ; sammā sambuddho=he is called a Perfectly Self-Enlightened One. ;

Myanmar Nissaya

vāpana=တပါး။ ; yaṃ kiñci=အလုံးစုံသော။ ; neyyaṃ nāma=သိအပ်သော တရားမည်သည်။ ; atthi=ရှိ၏။ ; sabbassa=အလုံးစုံသိအပ်သော တရားကို။ ; sammā=ပြန်။ ; sambuddhattā=အလိုလိုသိတော်မူသည်၏ အဖြစ်ကြောင့်။ ; vimokkhantikañāṇavasena=အရဟတ္တဖိုလ်၏ အဆုံး၌ ဖြစ်သော ပစ္စဝေက္ခဏာဉာဏ်၏ အခြားမဲ့၌ ရအပ်သော သဗ္ဗညုဉာဏ်၏ အစွမ်းဖြင့်။ ; sammā sambuddho=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3896 | Chunk: 66

Tassa pana vibhāgo upari āvi bhavissatīti.

AI Translation based on Nissaya

The analysis of that knowledge will become clear later on.

Vietnamese AI Translation

Sự phân tích về trí tuệ đó sẽ trở nên rõ ràng sau này.

AI Translation Nissaya

pana=To avoid prolixity. ; tassa ñāṇassa=of that knowledge. ; vibhāgo=the analysis. ; upari=later on. ; āvi=clearly. ; bhavissati=will become. ;

Myanmar Nissaya

pana=ဂန္ထဂရုကို ပယ်ဦးအံ့။ ; tassa ñāṇassa=ထိုဉာဏ်၏။ ; vibhāgo=ဝေဖန်ခြင်းသည်။ ; upari=အထက်၌။ ; āvi=စွာ။ ; bhavissati=လတ္တံ့။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3897 | Chunk: 66

Yasmā pana sabbabuddhā sammāsambuddhaguṇenāpi samasamā, tasmā sabbesaṃ vasena ‘‘sammāsambuddhānan’’ ti āha.

AI Translation based on Nissaya

Furthermore, since all Buddhas are exactly equal in regard to the quality of a Perfectly Self-Enlightened One, therefore, referring to all of them, the Elder, the General of the Dhamma, spoke in the plural, as “of the Perfectly Self-Enlightened Ones.”

Vietnamese AI Translation

Hơn nữa, vì tất cả các vị Phật đều hoàn toàn bình đẳng về phẩm chất của một vị Chánh Đẳng Chánh Giác, do đó, để chỉ tất cả các vị ấy, vị Trưởng lão, vị Tướng quân của Giáo pháp, đã nói ở số nhiều, là “của các bậc Chánh Đẳng Chánh Giác.”

AI Translation Nissaya

pana=To state an external meaning. ; yasmā=Because. ; tabbabuddhā=all Buddhas. ; sammāsambuddhaguṇenāpi=even by means of the quality of a Perfectly Self-Enlightened One. ; samasamā=are exactly equal. ; tasmā=therefore. ; sabbesaṃ=of all of them. ; vasena=by way of. ; sammāsambuddhānanti=as “of the Perfectly Self-Enlightened Ones”. ; dhammasenāpatitthero=the Elder, the General of the Dhamma. ; āha=spoke in the plural. ;

Myanmar Nissaya

pana=ဗာဟိရတ္ထကိုဆိုဦးအံ့။ ; yasmā=ကြောင့်။ ; tabbabuddhā=တို့သည် ။ ; sammāsambuddhaguṇenāpi=အားဖြင့်လည်း။ ; samasamā=ထပ်တူထပ်မျှဖြစ်တော်မူကြကုန်၏။ ; tasmā=ကြောင့်။ ; sabbesaṃ=တို့၏။ ; vasena=အားဖြင့်။ ; sammāsambuddhānanti=ဟူ၍။ ; dhammasenāpatitthero=သည်။ ; āha=ဗဟုဝစနအားဖြင့် ဟောတော်မူ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3898 | Chunk: 66

38. Idāni [V1.183 P1.216] pariyantapārisuddhiapariyantapārisuddhisīladvaye ekekameva sīlaṃ pañcadhā bhinditvā dassetuṃ atthi sīlaṃ pariyantaṃ , atthi sīlaṃ apariyantan tiādimāha.

AI Translation based on Nissaya

Now, in order to show the division of each one of the two kinds of morality—morality of limited purity and morality of unlimited purity—into five kinds, he spoke the passage beginning, “There is a morality that is limited, there is a morality that is unlimited.”

Vietnamese AI Translation

Bây giờ, để chỉ ra sự phân chia của mỗi một trong hai loại giới—giới có sự thanh tịnh hữu hạn và giới có sự thanh tịnh vô hạn—thành năm loại, ngài đã nói đoạn văn bắt đầu, “Có giới có giới hạn, có giới không có giới hạn.”

AI Translation Nissaya

idāni=Now. ; pariyantapāriapariyantapārisuddhisīladvaye=in the pair of morality of limited purity and morality of unlimited purity. ; ekekameva=each one. ; sīlaṃ=morality. ; pañcadhā=in five ways. ; bhinditvā=having divided. ; dassetuṃ=in order to show. ; atthi sīlaṃ.la. apariyantanti ādiṃ=the passage beginning “There is a morality that is limited, there is a morality that is unlimited”. ; āha=he said. ;

Myanmar Nissaya

idāni=၌။ ; pariyantapāriapariyantapārisuddhisīladvaye=ပရိယန္တပါရိသုဒ္ဓိ သီလ အပရိယန္တ ပါရိသုဒ္ဓိသီလ နှစ်ပါး အပေါင်း၌။ ; ekekameva=တပါးတပါးသာလျှင်ဖြစ်သော။ ; sīlaṃ=ကို။ ; pañcadhā=ဖြင့်။ ; bhinditvā=ခွဲဝေတော်မူ၍။ ; dassetuṃ=ငှါ။ ; atthi sīlaṃ.la. apariyantanti ādiṃ=ကို။ ; āha=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3899 | Chunk: 66

Itaresu pana tīsu sīlesu tathāvidho bhedo natthīti.

AI Translation based on Nissaya

However, it should be understood that in the other three kinds of morality—morality of fulfilled purity, morality of unattached purity, and morality of tranquilized purity—such a division does not exist.

Vietnamese AI Translation

Tuy nhiên, cần phải hiểu rằng trong ba loại giới khác—giới có sự thanh tịnh viên mãn, giới có sự thanh tịnh không vướng mắc, và giới có sự thanh tịnh đã được an tịnh—không có sự phân chia như vậy.

AI Translation Nissaya

pana=To speak of what is not finished. ; itaresu=in the other. ; tīsu=three. ; sīlesu=moralities: morality of fulfilled purity, morality of unattached purity, and morality of tranquilized purity. ; tathāvidho=such a. ; bhedo=division, with distinctions such as being limited by gain. ; natthi=does not exist. ; iti=Thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

pana=မပြီးသည်ကို ဆိုအံ့။ ; itaresu=ဤနှစ်ပါးသော သီလမှ တပါးကုန်သော။ ; tīsu=ကုန်သော။ ; sīlesu=ပရိပုဏ္ဏပါရိသုဒ္ဓိသီလ အပရိမာဏပါရိသုဒ္ဓိသီလ ပဋိပဿဒ္ဓိပါရိသုဒ္ဓိသီလတို့၌။ ; tathāvidho=ထိုသို့ လာဘပရိယန္တစသည် အပြားရှိသော။ ; bhedo=အပြးသည်။ ; natthi=မရှိ။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3900 | Chunk: 66

Tattha lābhapariyantan ti lābhena pariyanto bhedo etassāti lābhapariyantaṃ.

AI Translation based on Nissaya

Therein, regarding the phrase “limited by gain”: its limit or breach is due to gain, therefore it is called “limited by gain”.

Vietnamese AI Translation

Trong đó, liên quan đến cụm từ “giới hạn bởi lợi lộc”: giới hạn hoặc sự vi phạm của nó là do lợi lộc, do đó nó được gọi là “giới hạn bởi lợi lộc”.

AI Translation Nissaya

tattha=In that passage beginning “There is a morality...”. ; lābhapariyantanti=as for “limited by gain”. ; etassa=For this morality. ; lābhena=by gain and honor. ; pariyanto=the limit. ; bhedo=or breach. ; vā=or. ; pariyantābhedo=the breach of the limit. ; atthi=exists. ; iti tasmaṃ=therefore. ; lābhapariyantaṃ=it is called 'limited by gain'. ;

Myanmar Nissaya

tattha=ထိုအတ္ထိ သီလံ အစရှိသော ပါဌ်၌။ ; lābhapariyantanti=ကား။ ; etassa=ထိုသီလအား။ ; lābhena=လာဘသက္ကာရဖြင့်။ ; pariyanto=အပိုင်းအခြားသည်။ ; bhedo=ပျက်ခြငး်သည်။ ; vā= ; pariyantābhedo=ပျက်စီးခြင်းသည်။ ; atthi=၏။ ; iti tasmaṃ=ကြောင့်။ ; lābhapariyantaṃ=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3901 | Chunk: 66

Evaṃ sesānipi.

AI Translation based on Nissaya

The remaining items should be understood in the same way.

Vietnamese AI Translation

Các mục còn lại nên được hiểu theo cách tương tự.

AI Translation Nissaya

evaṃ=In this same way. ; sesānipi=the remaining moralities also. ; daṭṭhabbāni=should be understood. ;

Myanmar Nissaya

evaṃ=ဤအတူ။ ; sesānipi=ကြွင်းသော သီလတို့ကိုလည်း။ ; daṭṭhabbāni=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3902 | Chunk: 66

Yasoti panettha parivāro.

AI Translation based on Nissaya

Herein, among the remaining terms, “fame” (yaso) refers to one's retinue.

Vietnamese AI Translation

Ở đây, trong số các thuật ngữ còn lại, “danh vọng” (yaso) ám chỉ đoàn tùy tùng của một người.

AI Translation Nissaya

pana=As a special point. ; ettha=among these remaining terms. ; yassoti=as for “fame” (yaso). ; parivāro=it means retinue. ;

Myanmar Nissaya

pana=အထူးကား။ ; ettha=ဤကြွင်းသော ပုဒ်တို့တွင်။ ; yassoti=ကား။ ; parivāro=အခြံအရံတည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3903 | Chunk: 66

Idhāti imasmiṃ loke.

AI Translation based on Nissaya

“Here” (idha) means in this world of beings.

Vietnamese AI Translation

“Ở đây” (idha) có nghĩa là trong thế giới chúng sanh này.

AI Translation Nissaya

idhāti=As for “here” (idha). ; imasmiṃ loke=it means in this world of beings. ;

Myanmar Nissaya

idhāti=ကား။ ; imasmiṃ loke=ဤသတ္တလောက၌။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3904 | Chunk: 66

Ekaccoti eko.

AI Translation based on Nissaya

“A certain person” (ekacco) means some person.

Vietnamese AI Translation

“Một người nào đó” (ekacco) có nghĩa là một người nào đó.

AI Translation Nissaya

ekaccoti=As for “a certain person” (ekacco). ; eko=it means some person. ;

Myanmar Nissaya

ekaccoti=ကား။ ; eko=အချို့သော ပုဂ္ဂိုလ်သည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3905 | Chunk: 66

Lābhahetūti lābhoyeva hetu lābhahetu, tasmā lābhahetutoti vuttaṃ hoti.

AI Translation based on Nissaya

As for “for the sake of gain” (lābhahetu): the obtaining of gain itself is the cause. Therefore, it is said “because of the cause of gain”; this is a synonym.

Vietnamese AI Translation

Đối với “vì lợi lộc” (lābhahetu): việc có được lợi lộc tự nó là nguyên nhân. Do đó, người ta nói “vì nguyên nhân của lợi lộc”; đây là một từ đồng nghĩa.

AI Translation Nissaya

lābhahetūti=As for “for the sake of gain” (lābhahetu). ; lābhoyeva=the obtaining of gain itself. ; hetu=is the cause. ; lābhahetu=cause of gain. ; tasmā lābhahetuto=because of the cause of gain. ; iti=This. ; vevacanaṃ=is a synonym. ; iti=Thus. ; vuttaṃ vutto=it is said. ; hoti=it is. ;

Myanmar Nissaya

lābhahetūti=ကား။ ; lābhoyeva=လာဘ်ရခြင်းသည်ပင်လျှင်။ ; hetu=အကြောင်းတည်း။ ; lābhahetu=အကြောင်း။ ; tasmā lābhahetuto=အကြောင်းကြောင့်။ ; iti=ဤသည်လျှင်။ ; vevacanaṃ=ဝေဝုစ်ပရိယာယ်ပုဒ်တည်း။ ; iti=သို့။ ; vuttaṃ vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3906 | Chunk: 66

Hetvatthe nissakkavacanaṃ.

AI Translation based on Nissaya

The word is in the nominative case, used in the sense of a cause.

Vietnamese AI Translation

Từ này ở dạng chủ cách, được dùng theo nghĩa của một nguyên nhân.

AI Translation Nissaya

hetvatthe=In the sense of cause. ; nissakkavacanaṃ=it is the first case ending (nominative). ;

Myanmar Nissaya

hetvatthe=၌။ ; nissakkavacanaṃ=ပဌမာဝိဘက်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3907 | Chunk: 66

‘‘Lābhapaccayā lābhakāraṇā’’ ti tasseva vevacanaṃ.

AI Translation based on Nissaya

“On account of gain, for the reason of gain” are synonyms for that same word “lābhahetu”.

Vietnamese AI Translation

“Do lợi lộc, vì lý do của lợi lộc” là các từ đồng nghĩa cho cùng một từ “lābhahetu”.

AI Translation Nissaya

lābhapaccayā lābhakāraṇāti=As for “on account of gain, for the reason of gain”. ; tasseva=of that same word. ; vevacanaṃ=it is a synonym. ;

Myanmar Nissaya

lābhapaccayā lābhakāraṇāti=ကား။ ; tasseva=ထို လာဘဟေတု ဟူသော ပုဒ်၏သာလျှင်။ ; vevacanaṃ=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3908 | Chunk: 66

Hetumeva hi paṭicca etaṃ phalametīti paccayoti ca, phaluppattiṃ kārayatīti kāraṇan ti ca vuccati.

AI Translation based on Nissaya

Indeed, because the result arises depending on the cause, it is called a 'condition' (paccayo); and because it brings about the arising of a result, it is called a 'reason' (kāraṇa).

Vietnamese AI Translation

Thật vậy, vì kết quả phát sinh tùy thuộc vào nguyên nhân, nó được gọi là 'điều kiện' (paccayo); và vì nó mang lại sự phát sinh của một kết quả, nó được gọi là 'lý do' (kāraṇa).

AI Translation Nissaya

hi saccaṃ=Indeed. ; hetumeva=the cause itself. ; etaṃ=this cause. ; paṭicca=depending on. ; phalaṃ=the result. ; eti=arises. ; iti iminā vacanatthena=because of this meaning. ; paccayotica=it is also called 'condition' (paccaya). ; vuccati=it is said. ; phaluppattiṃ=the arising of a result. ; kārayati=it makes happen. ; iti iminā vacanatthena=because of this meaning. ; kāraṇantica=it is also called 'reason' (kāraṇa). ; vuccati=it is said. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; hetumeva=အကြောင်းကို ပင်လျှင်။ ; etaṃ=ဤအကြောင်းကို။ ; paṭicca=စွဲ၍။ ; phalaṃ=အကျိုးသည်။ ; eti=ဖြစ်တတ်၏။ ; iti iminā vacanatthena=ကြောင့်။ ; paccayotica=ဟူ၍လည်း။ ; vuccati=၏။ ; phaluppattiṃ=ခြင်းကို။ ; kārayati=ပြုတတ်၏။ ; iti iminā vacanatthena=ကြောင့်။ ; kāraṇantica=ဟူ၍လည်း။ ; vuccati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3909 | Chunk: 66

Yathāsamādinnan ti [M1.200] yaṃ yaṃ samādinnaṃ gahitaṃ.

AI Translation based on Nissaya

“As undertaken” means whatever training rule has been undertaken and accepted.

Vietnamese AI Translation

“Như đã thọ trì” có nghĩa là bất kỳ học giới nào đã được thọ trì và chấp nhận.

AI Translation Nissaya

yathāsamādinnanti=As for “as undertaken”. ; yaṃyaṃsamādinnaṃ gahitaṃ=whatever has been undertaken and accepted. ;

Myanmar Nissaya

yathāsamādinnanti=ကား။ ; yaṃyaṃsamādinnaṃ gahitaṃ=အကြင်အကြင် ယူအပ်သော။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3910 | Chunk: 66

Vītikkamatīti ajjhācarati.

AI Translation based on Nissaya

“Transgresses” means he transgresses and acts.

Vietnamese AI Translation

“Vi phạm” có nghĩa là người đó vi phạm và hành động.

AI Translation Nissaya

vītikkamatīti=As for “transgresses”. ; ajjhācarati=he transgresses and acts. ;

Myanmar Nissaya

vītikkamatīti=ကား။ ; ajjhācarati=လွန်ကျူး၍ ကျင့်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3911 | Chunk: 66

Evarūpānīti evaṃsabhāvāni, vuttappakārānīti adhippāyo.

AI Translation based on Nissaya

“Of such a kind” means they are of such a nature, having the characteristics mentioned; this is the intended meaning.

Vietnamese AI Translation

“Thuộc loại như vậy” có nghĩa là chúng có bản chất như vậy, có các đặc tính đã được đề cập; đây là ý nghĩa dự định.

AI Translation Nissaya

evarūpānīti=As for “of such a kind”. ; evaṃ sabhāvāni=they are of such a nature. ; vuttappakārāni=having the characteristics mentioned. ; itiayaṃ=this is. ; adhippāyo=the intention. ;

Myanmar Nissaya

evarūpānīti=ကား။ ; evaṃ sabhāvāni=ရှိကုန်သည်။ ; vuttappakārāni=ရှိကုန်သော။ ; itiayaṃ=ကား။ ; adhippāyo=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3912 | Chunk: 66

Sīlānīti gahaṭṭhasīlāni vā hontu pabbajitasīlāni vā, yesaṃ ādimhi vā ante vā ekaṃ bhinnaṃ, tāni pariyante chinnasāṭako viya khaṇḍāni.

AI Translation based on Nissaya

As for “moralities”: whether they are the moral precepts of householders or the moral precepts of the ordained, if one precept or one offense among them is broken at the beginning or at the end, then those moralities are “broken” (khaṇḍāni), like a cloth torn at the edge.

Vietnamese AI Translation

Đối với “các giới”: dù đó là các giới luật của người tại gia hay các giới luật của người xuất gia, nếu một giới hoặc một tội trong số đó bị vi phạm ở đầu hoặc ở cuối, thì các giới đó là “bị gãy” (khaṇḍāni), giống như một tấm vải bị rách ở mép.

AI Translation Nissaya

sīlānīti=As for “moralities”. ; gahaṭṭhasīlānivā=whether they be the moral precepts of householders. ; honti=they are. ; pabbajitasīlānivā=or the moral precepts of the ordained. ; honti=they are. ; yesaṃ=of which (five precepts or seven classes of offenses). ; vā=among them. ; ādimhivā=at the beginning. ; antevā=or at the end. ; etaṃ=one precept or one offense. ; bhinnaṃ=is broken by way of transgression. ; hoti=it is. ; tāni=those moralities or offenses. ; pariyante=at the edge. ; channasāṭakovīya=like a torn cloth. ; khaṇḍāni=are broken. ; vā=or are called broken. ;

Myanmar Nissaya

sīlānīti=ကား။ ; gahaṭṭhasīlānivā=လူတို့၏ သီလတို့သည်မူလည်း။ ; honti=ကုန်၏။ ; pabbajitasīlānivā=မူလည်း။ ; honti=ကုန်၏။ ; yesaṃ=အကြင်ငါးပါးသော သီလ ခုနစ်ပါးသော အာပတ်တို့၏။ ; vā=တို့တွင်။ ; ādimhivā=၌လည်းကောင်း။ ; antevā=၌လည်းကောင်း။ ; etaṃ=တပါးသော သီလ တပါးသော အာပတ်သည်။ ; bhinnaṃ=လွန်ကျူးသည်၏ အစွမ်းဖြင့် ပျက်သည်။ ; hoti=၏။ ; tāni=ထိုသီလ အာပတ်တို့သည်။ ; pariyante=အစွန်း၌။ ; channasāṭakovīya=ပြတ်သော ပုဆိုးကဲံသို့။ ; khaṇḍāni=ပြတ်ကုန်၏။ ; vā=ပြတ်သည် မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3913 | Chunk: 66

Yesaṃ vemajjhe ekaṃ bhinnaṃ, tāni majjhe vinividdhasāṭako viya chiddāni.

AI Translation based on Nissaya

If one precept or offense in the middle is broken, they are called “perforated” (chiddāni), like a cloth pierced through the middle.

Vietnamese AI Translation

Nếu một giới hoặc tội ở giữa bị vi phạm, chúng được gọi là “bị thủng” (chiddāni), giống như một tấm vải bị đâm thủng ở giữa.

AI Translation Nissaya

yesaṃ=Of which moralities or offenses. ; vemajjhe=in the middle. ; ekaṃ=one precept or offense. ; bhinnaṃ=is broken. ; tāni=those moralities or offenses. ; majjhe=in the middle. ; vinividdhasāṭakoviya=like a cloth pierced through. ; chiddāni=are called perforated. ;

Myanmar Nissaya

yesaṃ=အကြင်သီလအာပတ်တို့၏။ ; vemajjhe=၌။ ; ekaṃ=တပါးသော သီလ အာပတ်သည်။ ; bhinnaṃ=၏။ ; tāni=ထိုသီလအာပတ်တို့သည်။ ; majjhe=အလယ်၌။ ; vinividdhasāṭakoviya=ထုတ်ချင်းပေါက်သော ပုဆိုးကဲံသို့။ ; chiddāni=ပေါင်သည်မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3914 | Chunk: 66

Yesaṃ paṭipāṭiyā dve vā tīṇi vā bhinnāni, tāni piṭṭhiyā vā kucchiyā vā uṭṭhitena dīghavaṭṭādisaṇṭhānena visabhāgavaṇṇena kāḷarattādīnaṃ aññatarasarīravaṇṇā gāvī viya sabalāni.

AI Translation based on Nissaya

If two or three precepts or offenses are broken in sequence, they are called “spotted” (sabalāni), like a cow that has a patch of dissimilar color—black, red, or another color—in a long or round shape on its back or belly.

Vietnamese AI Translation

Nếu hai hoặc ba giới hoặc tội bị vi phạm liên tiếp, chúng được gọi là “lốm đốm” (sabalāni), giống như một con bò có một mảng màu khác biệt—đen, đỏ, hoặc một màu khác—ở dạng dài hoặc tròn trên lưng hoặc bụng của nó.

AI Translation Nissaya

yesā=Of which moralities or offenses. ; paṭipāṭiyā=in sequence. ; dvevā=two precepts or offenses, and. ; tīṇivā=or three, and. ; bhinnāni=are broken. ; tāni=those moralities or offenses. ; piṭṭhiyāvā=on the back of a cow. ; kucchiyāvā=or on the belly of a cow. ; uṭṭhitena=arising. ; dīghavaṭṭādisaṇṭhānena=with a long, round, etc. shape. ; visabhāgavaṇṇena=with a dissimilar color. ; kāḷarattādīnaṃ=among black, red, etc. ; aññatarasarīravaṇṇā=having some body color. ; gāvīviya=like a cow. ; sabalāni=are called spotted. ;

Myanmar Nissaya

yesā=အကြင်သီလအာပတ်တို့၏။ ; paṭipāṭiyā=အစဉ်အားဖြင့်။ ; dvevā=နှစ်ပါးသော သီလ အာပတ်တို့သည်လည်းကောင်း။ ; tīṇivā=လည်းကောင်း။ ; bhinnāni=ပျက်ကုန်၏။ ; tāni=ထိုသီလအာပတ်တို့သည်။ ; piṭṭhiyāvā=နွား၏ ကျောက်ကုန်း၌ လည်းကောင်း။ ; kucchiyāvā=နွား၏ ဝမ်း၌လည်းကောင်း။ ; uṭṭhitena=ပေါက်သော။ ; dīghavaṭṭādisaṇṭhānena=အရှည်အဝန်းအစရှိသော သဏ္ဌာန်ရှိသော။ ; visabhāgavaṇṇena=သဘောမတူသော အဆင်းဖြင့်။ ; kāḷarattādīnaṃ=အမည်း အနီ အစရှိသည်တို့တွင်။ ; aññatarasarīravaṇṇā=တပါးပါးသော ကိုယ်အဆင်းရှိသော။ ; gāvīviya=နွားမကဲ့သို့။ ; sabalāni=ပြောက်ကြားသည်မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3915 | Chunk: 66

Yesaṃ antarantarā ekekāni bhinnāni, tāni antarantarā visabhāgavaṇṇabinduvicitrā gāvī viya kammāsāni.

AI Translation based on Nissaya

If they are broken one by one, here and there, they are called “variegated” (kammāsāni), like a cow that is variegated with spots of a dissimilar color.

Vietnamese AI Translation

Nếu chúng bị vi phạm từng cái một, đây đó, chúng được gọi là “loang lổ” (kammāsāni), giống như một con bò có nhiều đốm màu khác biệt.

AI Translation Nissaya

yesaṃ=Of which moralities or offenses. ; antarantarā=in between. ; ekekāni=one by one the precepts or offenses. ; bhinnāni=are broken. ; tāni=those moralities or offenses. ; antarantarā=in between. ; visabhāgavaṇṇabinduvicitrā=adorned with spots of a dissimilar color. ; gāvīviya=like a cow. ; kammāsāni=are called variegated. ;

Myanmar Nissaya

yesaṃ=အကြင်သီလအာပတ်တို့၏။ ; antarantarā=အကြားအကြား၌။ ; ekekāni=တပါးပါးသော သီလ အာပတ်တို့သည်။ ; bhinnāni=ပျက်ကုန်၏။ ; tāni=ထိုသီလအာပတ်တို့သည်။ ; antarantarā=၌။ ; visabhāgavaṇṇabinduvicitrā=သဘောမတူသော အဆင်းရှိသော အပေါက်တို့ဖြင့် ဆန်းကျင့်သော။ ; gāvīviya=နွားမကဲ့သို့။ ; kammāsāni=ပျောက်ကျားသည်မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3916 | Chunk: 66

Avisesena vā sabbānipi sattavidhena methunasaṃyogena kodhūpanāhādīhi ca pāpadhammehi upahatattā khaṇḍāni chiddāni sabalāni kammāsānīti.

AI Translation based on Nissaya

Alternatively, it should be understood that, generally, because they are afflicted by the seven kinds of sexual engagement (such as delighting in physical contact) and by other evil, unwholesome states like anger and malice, all such moralities are called broken, perforated, spotted, and variegated. (Note: The seven kinds of sexual engagement, as explained in texts like the Aṅguttara Nikāya, are: delighting in a woman's touch, in playing with her, in looking at her, in hearing her voice, in reminiscing about past interactions, in seeing others enjoy sensual pleasures, and in practicing for the sake of future sensual pleasures.)

Vietnamese AI Translation

Hoặc cách khác, cần phải hiểu rằng, nói chung, vì chúng bị ô nhiễm bởi bảy loại giao hợp tính dục (như thích thú trong việc tiếp xúc thân thể) và bởi các trạng thái xấu ác, bất thiện khác như sân và ác ý, tất cả các giới luật như vậy được gọi là bị gãy, bị thủng, lốm đốm, và loang lổ. (Ghi chú: Bảy loại giao hợp tính dục, như được giải thích trong các kinh văn như Aṅguttara Nikāya, là: thích thú khi chạm vào một người phụ nữ, khi vui đùa với cô ấy, khi nhìn cô ấy, khi nghe giọng nói của cô ấy, khi hồi tưởng về những tương tác trong quá khứ, khi thấy người khác hưởng thụ dục lạc, và khi thực hành vì mục đích hưởng thụ dục lạc trong tương lai.)

AI Translation Nissaya

vā=Alternatively. ; avisesena=generally. ; sabbānipi=all moralities and offenses. ; sattavidhena=sevenfold. ; methunasaṃyegena=by engagement in sexual intercourse, starting with enjoying physical contact. ; kodhūpanāhādīhica=and by evil states such as anger and malice. ; pāpadhammehi=by unwholesome states. ; upahatattā=because of being afflicted. ; khaṇḍāni=are called broken. ; chiddāni=are called perforated. ; sabalāni=are called spotted. ; sammāsāni=are called variegated. ; iti=Thus. ; veditabbaṃ=it should be understood. ; (Here, in the Visuddhimagga, regarding the seven kinds of sexual engagement, one should refer to the Aṅguttara Nikāya, Suttanta of the Sevens. The seven are: delighting in a woman's touch; delighting in playing with a woman; delighting in looking at a woman; listening to a woman's voice; reminiscing about past talking and playing with a woman; seeing men and women delighting in sensual pleasures; and fulfilling moral precepts with the desire for sensual pleasures.) ;

Myanmar Nissaya

vā=တနည်းကား။ ; avisesena=သာမညအားဖြင့်။ ; sabbānipi=အလုံးစုံသော သီလာအပတ်တို့သည်လည်း။ ; sattavidhena=သော။ ; methunasaṃyegena=ကာယသံသဂ္ဂသမာပဇ္ဇန အစရှိသောခုနစ်ပါးအပြားရှိသော မေထုန်နှင့် ယှဉ်ခြင်းသည်လည်းကောင်း။ ; kodhūpanāhādīhica=အမျက်ထါက်ခြင်း ရန်ငြိုးဖွဲ့ခြင်း အစရှိကုန်သော။ ; pāpadhammehi=အကုသိုလ်တရားတို့သည်လည်းကောငး်။ ; upahatattā=ဖျက်ဆီးအပ်သည်၏ အဖြစ်ကြောင့်။ ; khaṇḍāni=ခဏ္ဍမည်ကုန်၏။ ; chiddāni=မည်ကုန်၏။ ; sabalāni=မည်ကုန်၏။ ; sammāsāni=မည်ကုန်၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ; (ဤတွင် ဝိသုဒ္ဓိမဂ်၌ သတ္တဝါဓမေထုနသံယောဂကို သတ္တဤင်္ဂုတ္တရပါဠိနှင့်ပြည်သည် ရှုလေ။ ခုနစ်ပါးဟူသော်ကား မာတုဂါမ၏ ဆုပ်နယ်သည်ကို သာယာခြင်း၊မာတုဂေါမနှင့် ကစားခြင်းကို သာယာခြင်း၊ မာတုဂါမကို ရှုခြင်းကို သာယာခြင်း၊ မာတုဂါမ၏ အသံကို နားထောင်ခြင်း၊ မာတုဂါမနှင့် ပြောဆို ကစားဖူးသည်ကို အောက်မေ့ခြင်း၊ မိန်းမ ယောင်္ကျားတို့ ကာမဂဂုဏ်ဖြင့် မွေ့လျော်သည်ကို ရှုခြင်း၊ ကာမဂုဏ်ကို တောင့်တ၍ သီလကိုဖြည့်ခြင်း၊ ဤခုနစ်ပါးတို့တည်း။) ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3917 | Chunk: 66

Tāniyeva taṇhādāsabyato mocetvā bhujissabhāvākaraṇena na bhujissāni.

AI Translation based on Nissaya

Those same moralities, being freed from the state of slavery to craving and not being rebellious, are thus called “not leading to freedom” (na bhujissāni).

Vietnamese AI Translation

Những giới luật đó, vì được giải thoát khỏi tình trạng nô lệ của ái dục và không nổi loạn, do đó được gọi là “không dẫn đến tự do” (na bhujissāni).

AI Translation Nissaya

tāniyeva=Those same moralities that are broken, perforated, spotted, and variegated. ; taṇhādāsabyato=from the state of being a slave to craving. ; mocatvā=being freed. ; bhujissabhāvā karaṇena=by the making of a state of non-rebellion. ; vā=or because of. ; nabhujissāni=are called 'not leading to freedom'. ;

Myanmar Nissaya

tāniyeva=ထိုခဏ္ဍဆိဒ္ဒသဗလကမ္မာသသီလတို့သည်ပင်လျှင်။ ; taṇhādāsabyato=တဏှာ၏ ကျွန်၏အဖြစ်။ ; mocatvā=လွတ်၍။ ; bhujissabhāvā karaṇena=တော်လှန်ခြင်းမရှိသည်ကို ပြုခြင်းဖြင့်။ ; vā=ကြောင့်။ ; nabhujissāni=မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3918 | Chunk: 66

Buddhādīhi viññūhi na pasatthattā na viññuppasatthāni.

AI Translation based on Nissaya

Because they are not praised by the wise, such as the Buddha, they are called “not praised by the wise” (na viññuppasatthāni).

Vietnamese AI Translation

Bởi vì chúng không được các bậc trí tuệ, như đức Phật, tán thán, chúng được gọi là “không được bậc trí tán thán” (na viññuppasatthāni).

AI Translation Nissaya

buddhādihi=by the Buddha and others. ; viññūhi=by the wise. ; napasatthattā=because of not being praised. ; naviññuppasattāni=they are called 'not praised by the wise'. ;

Myanmar Nissaya

buddhādihi=ဘုရားအစရှိကုန်သော။ ; viññūhi=ပညာရှိတို့သည်။ ; napasatthattā=မချီးမွမ်းအပ်သည်၏ အဖြစ်ကြောင့်။ ; naviññuppasattāni=မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3919 | Chunk: 66

Taṇhādiṭṭhīhi parāmaṭṭhattā, kenaci vā ‘‘ayaṃ te sīlesu doso’’ ti parāmaṭṭhuṃ sakkuṇeyyatāya parāmaṭṭhāni.

AI Translation based on Nissaya

Because they are wrongly grasped by craving and wrong view, or because it is possible for someone to misapprehend them, saying, “This is the fault in your morality,” they are called “grasped” (parāmaṭṭhāni).

Vietnamese AI Translation

Bởi vì chúng bị nắm giữ sai lầm bởi ái dục và tà kiến, hoặc vì có thể có người hiểu sai về chúng, nói rằng, “Đây là lỗi trong giới luật của ông,” chúng được gọi là “bị nắm giữ” (parāmaṭṭhāni).

AI Translation Nissaya

taṇhā diṭṭhīti=craving and wrong view. ; parāmaṭṭhattāvā=because of being wrongly grasped, and. ; kenaci=by someone. ; ayaṃ=this is. ; te=your. ; sīlesu=in the moralities. ; doso=the fault. ; iti=thus. ; parāmaṭṭhaṃ=to be wrongly grasped. ; sakkuṇeyyatāyavā=because of the possibility of, and. ; parāmaṭṭhāni=they are called 'grasped'. ;

Myanmar Nissaya

taṇhā diṭṭhīti=တို့သည်။ ; parāmaṭṭhattāvā=မှားသော အားဖြင့် သုံးသပ်အပ်သည်၏ အဖြစ်ကြောင့်လည်းကောင်း။ ; kenaci=တစ်စုံတစ်ယောက်သော သူသည်။ ; ayaṃ=ဤသည်ကား။ ; te=သင်၏။ ; sīlesu=တို့၌။ ; doso=အပြစ်တည်း။ ; iti=သို့။ ; parāmaṭṭhaṃ=မှားသောအားဖြင့် သုံးသပ်ခြင်းငှါ။ ; sakkuṇeyyatāyavā=တတ်ကောင်း သည်၏ အဖြစ်ကြောင့်လည်းကောင်း။ ; parāmaṭṭhāni=မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3920 | Chunk: 66

Upacārasamādhiṃ appanāsamādhiṃ vā, atha vā maggasamādhiṃ phalasamādhiṃ vā na saṃvattayantīti asamādhisaṃvattanikāni.

AI Translation based on Nissaya

Because they do not lead to access concentration or absorption concentration, or to path concentration or fruit concentration, they are called “not conducive to concentration” (asamādhisaṃvattanikāni).

Vietnamese AI Translation

Bởi vì chúng không dẫn đến cận định hay an chỉ định, hoặc đến đạo định hay quả định, chúng được gọi là “không đưa đến định” (asamādhisaṃvattanikāni).

AI Translation Nissaya

upacārasamādhiṃ=access concentration, and also. ; vā=or for the sake of access concentration. ; appanāsamādhiṃvā=absorption concentration, and also. ; vā=or for the sake of. ; vā=or for the sake of. ; maggasamādhiṃ=path concentration, and also. ; vā=or for the sake of. ; phalasamā dhiṃvā=fruit concentration, and also. ; vā=or for the sake of. ; nasaṃvattayanti=they do not lead to. ; vā=they do not become. ; ititasmā=therefore. ; asamādhisaṃvattanikāni=they are called 'not conducive to concentration'. ;

Myanmar Nissaya

upacārasamādhiṃ=ဥပစာရသမာဓိကိုလည်းကောင်း။ ; vā=ဥပစာရသမာဓိအလို့ငှါ လည်းကောင်း။ ; appanāsamādhiṃvā=ကိုလည်းကောင်း။ ; vā=ငှါလည်းမကောင်း။ ; vā=ငှါလည်းကောငး်။ ; maggasamādhiṃ=ကိုလည်းကောင်း။ ; vā=ငှါလည်းကောင်း။ ; phalasamā dhiṃvā=ကိုလည်းကောင်း။ ; vā=ငှါလည်းကောင်း။ ; nasaṃvattayanti=မဖြစ်စေကုန်။ ; vā=မဖြစ်ကုန်။ ; ititasmā=ကြောင့်။ ; asamādhisaṃvattanikāni=မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3921 | Chunk: 66

Na samādhisaṃvattanikānītipi pāṭho.

AI Translation based on Nissaya

There is also the reading, “na samādhisaṃvattanikāni.”

Vietnamese AI Translation

Cũng có cách đọc, “na samādhisaṃvattanikāni.”

AI Translation Nissaya

nasamādhisaṃvattanikānītipi=Also as 'na samādhisaṃvattanikāni'. ; pāṭho=there is a reading. ;

Myanmar Nissaya

nasamādhisaṃvattanikānītipi=ဟူ၍လည်း‌။ ; pāṭho=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3922 | Chunk: 66

Keci pana ‘‘khaṇḍānīti kusalānaṃ dhammānaṃ appatiṭṭhābhūtattā, chiddānītipi evaṃ.

AI Translation based on Nissaya

However, some teachers explain the meaning thus: They are called “broken” (khaṇḍāni) because they are not a foundation for wholesome states; similarly, they are also called “perforated” (chiddāni).

Vietnamese AI Translation

Tuy nhiên, một số vị thầy giải thích ý nghĩa như sau: Chúng được gọi là “bị gãy” (khaṇḍāni) vì chúng không phải là nền tảng cho các trạng thái thiện; tương tự, chúng cũng được gọi là “bị thủng” (chiddāni).

AI Translation Nissaya

pana=To state a special point. ; keci=some teachers. ; khaṇḍānīti=as for 'broken'. ; kusalānaṃ=of wholesome. ; dhammānaṃ=states. ; appatiṭṭhābhūtattā=because of being a non-foundation. ; khaṇḍāni=they are called 'broken'. ; chiddānītipi=also as for 'perforated'. ; evaṃ=in this same way. ; kusalānaṃ=of wholesome. ; dhammānaṃ=states. ; appatiṭṭhābhūtattā=because of being a non-foundation. ; chiddāni=they are called 'perforated'. ;

Myanmar Nissaya

pana=အထူးကို ဆိုအံ့။ ; keci=တို့သည်။ ; khaṇḍānīti=ကား။ ; kusalānaṃ=ကုသိုလ်ဖြစ်ကုန်သော။ ; dhammānaṃ=တို့၏။ ; appatiṭṭhābhūtattā=တည်ရာမဟုတ်သည်၏ အဖြစ်ကြောင့်။ ; khaṇḍāni=မည်ကုန်၏။ ; chiddānītipi=ဟူ၍လည်း။ ; evaṃ=ဤအတူ။ ; kusalānaṃ=ကုန်သော။ ; dhammānaṃ=တို့၏။ ; appatiṭṭhābhūtattā=ကြောင့်။ ; chiddāni=အပေါက်မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3923 | Chunk: 66

Sabalānīti vivaṇṇakaraṇattā, kammāsānītipi [P1.217] evaṃ.

AI Translation based on Nissaya

They are called “spotted” (sabalāni) because they cause discoloration; similarly, they are also called “variegated” (kammāsāni).

Vietnamese AI Translation

Chúng được gọi là “lốm đốm” (sabalāni) vì chúng gây ra sự đổi màu; tương tự, chúng cũng được gọi là “loang lổ” (kammāsāni).

AI Translation Nissaya

sabalānīti=As for 'spotted'. ; vivaṇṇakaraṇattā=because of causing discoloration. ; sabalāni=they are called 'spotted'. ; kammāsānītipi=Also as 'variegated' (kammāsāni). ; evaṃ=in this same way. ; vivaṇṇakaraṇattā=because of causing discoloration. ; kammāsāni=they are variegated. ;

Myanmar Nissaya

sabalānīti=ကား။ ; vivaṇṇakaraṇattā=အဆင်းပျက်ခြင်းကို ပြုတတ်သည်၏ အဖြစ်ကြောင့်။ ; sabalāni=ကျားသည်မည်ကုန်၏။ ; kammāsānītipi=ကမ္မာသာနိ ဟူသည်လည်း။ ; evaṃ=ဤအတူ။ ; vivaṇṇakaraṇattā=ကြောင့်။ ; kammāsāni=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3924 | Chunk: 66

Na bhujissānīti taṇhādāsabyaṃ gatattā.

AI Translation based on Nissaya

They are “not leading to freedom” (na bhujissāni) because they have fallen into the state of being a slave to craving.

Vietnamese AI Translation

Chúng “không dẫn đến tự do” (na bhujissāni) vì chúng đã rơi vào tình trạng nô lệ của ái dục.

AI Translation Nissaya

nabhujissānīti=As for 'not leading to freedom'. ; kusalānaṃ=of wholesome. ; dhammānaṃ=states. ; taṇhādāsabyaṃ=the state of being a slave to craving. ; gatattā=because of having gone to. ; nabhujissāni=they are not free. ;

Myanmar Nissaya

nabhujissānīti=ကား။ ; kusalānaṃ=ကုန်သော။ ; dhammānaṃ=တို့၏။ ; taṇhādāsabyaṃ=တဏှာ၏ ကျွန်၏ အဖြစ်ကို။ ; gatattā=ရောက်ခြင်းကြောင့်။ ; nabhujissāni=မတော်လှန်ကုန်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3925 | Chunk: 66

Na viññuppasatthānīti kusalehi garahitattā.

AI Translation based on Nissaya

They are “not praised by the wise” (na viññuppasatthāni) because they are censured by the skillful.

Vietnamese AI Translation

Chúng “không được bậc trí tán thán” (na viññuppasatthāni) vì chúng bị những người thiện xảo khiển trách.

AI Translation Nissaya

naviññuppasatthānīti=As for 'not praised by the wise'. ; kusalehi=by the skillful. ; garahitattā=because of being censured. ; naviññuppasatthāni=they are not praised by the wholesome states. ;

Myanmar Nissaya

naviññuppasatthānīti=ကား။ ; kusalehi=တို့သည်။ ; garahitattā=ကဲ့ရဲ့အပ်သည်၏ အဖြစ်ကြောင့်။ ; naviññuppasatthāni=ကုသိုလ်တရားတို့သည် မချီးမွမ်းအပ်ကုန်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3926 | Chunk: 66

Parāmaṭṭhānīti taṇhāya gahitattā.

AI Translation based on Nissaya

They are “grasped” (parāmaṭṭhāni) because they are seized by craving.

Vietnamese AI Translation

Chúng “bị nắm giữ” (parāmaṭṭhāni) vì chúng bị ái dục chiếm giữ.

AI Translation Nissaya

parāmaṭṭhānīti=As for 'grasped'. ; taṇhāya=by craving. ; gahitattā=because of being seized. ; parāmaṭṭhāni=they are wrongly grasped. ;

Myanmar Nissaya

parāmaṭṭhānīti=ကား။ ; taṇhāya=သည်။ ; gahitattā=ယူအပ်သည်၏အဖြစ်ကြောင့်။ ; parāmaṭṭhāni=မှားသောအားဖြင့် သုံးသပ်အပ်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3927 | Chunk: 66

Asamādhisaṃvattanikānīti vippaṭisāravatthubhūtattā’’ ti evamatthaṃ vaṇṇayanti.

AI Translation based on Nissaya

They are “not conducive to concentration” (asamādhisaṃvattanikāni) because they are a basis for remorse. In this way, they explain the meaning.

Vietnamese AI Translation

Chúng “không đưa đến định” (asamādhisaṃvattanikāni) vì chúng là cơ sở cho sự hối hận. Theo cách này, họ giải thích ý nghĩa.

AI Translation Nissaya

asamādhisaṃvattanikānīti=As for 'not conducive to concentration'. ; vippaṭisāravatthubhūtattā=because of being a basis for remorse. ; asamādhisaṃvattanikāni=they do not lead to the two concentrations. ; vā=or they do not lead to the four concentrations. ; itievaṃ=Thus. ; atthaṃ=the meaning. ; vaṇṇayanti=they explain. ;

Myanmar Nissaya

asamādhisaṃvattanikānīti=ကား။ ; vippaṭisāravatthubhūtattā=နှလုံးမသာယာခြင်း၏ အကြောင်း၏ အဖြစ်ကြောင့်။ ; asamādhisaṃvattanikāni=သမာဓိနှစ်ပါးကို မဖြစ်စေတတ်ကုန်။ ; vā=လေးပါးကုန် သမာဓိကို မဖြစ်စေတတ်ကုန်။ ; itievaṃ=ဤသို့။ ; atthaṃ=အနက်ကို။ ; vaṇṇayanti=ဖွင့်ပြကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3928 | Chunk: 66

Na avippaṭisāravatthukānīti vippaṭisārāvahattā avippaṭisārassa patiṭṭhā na hontīti attho.

AI Translation based on Nissaya

As for “not a basis for lack of remorse” (na avippaṭisāravatthukāni): the meaning is that because they bring remorse, they are not a foundation for lack of remorse.

Vietnamese AI Translation

Đối với “không phải là cơ sở cho sự không hối hận” (na avippaṭisāravatthukāni): ý nghĩa là vì chúng mang lại sự hối hận, chúng không phải là nền tảng cho sự không hối hận.

AI Translation Nissaya

naavippaṭisāravatthukānīti=As for “not a basis for lack of remorse”. ; 'vippaṭisārāvahattā=Because they bring remorse. ; avippaṭisārassa=of lack of remorse. ; patiṭṭhā=a foundation. ; nahonti=they are not. ; iviayaṃ=this is. ; attho=the meaning. ;

Myanmar Nissaya

naavippaṭisāravatthukānīti=ကား။ ; 'vippaṭisārāvahattā=နှလုံးမသာခြင်းကို ဆောင်တတ်သည်၏ အဖြစ်ကြောင့်။ ; avippaṭisārassa=နှလုံးမသာယာခြင်း၏။ ; patiṭṭhā=တည်ရာတို့သည်။ ; nahonti=မဖြစ်ကုန်။ ; iviayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3929 | Chunk: 66

Na pāmojjavatthukānīti avippaṭisārajāya dubbalapītiyā na vatthubhūtāni tassā anāvahattā [V1.184].

AI Translation based on Nissaya

As for “not a basis for joy” (na pāmojjavatthukāni): they are not a foundation for weak joy born from lack of remorse, because they do not bring it about.

Vietnamese AI Translation

Đối với “không phải là cơ sở cho sự hân hoan” (na pāmojjavatthukāni): chúng không phải là nền tảng cho sự hân hoan yếu ớt sinh ra từ sự không hối hận, vì chúng không mang lại điều đó.

AI Translation Nissaya

napāmojjavatthukānīti=As for 'not a basis for joy'. ; avippaṭisārajāya=born from lack of remorse. ; dubbalapītiyā=for weak rapture. ; vatthūbhūtāni=a foundation. ; na=they are not. ; kasmā=Why?. ; tassa=of that weak rapture. ; vā=or. ; anāvahattā=because of not bringing it about. ;

Myanmar Nissaya

napāmojjavatthukānīti=ကား။ ; avippaṭisārajāya=နှလုံးသာယာခြင်းကြောင့်ဖြစ်သော။ ; dubbalapītiyā=အားနည်းသော ပီတိ၏။ ; vatthūbhūtāni=တည်ရာဖြစ်၍ ကုန်သည်။ ; na=မဟုတ်ကုန်။ ; kasmā=ကား။ ; tassa=ထိုအားနည်းသောပီတိ၏။ ; vā=ကို။ ; anāvahattā=မဆောင်တတ်သည်၏ အဖြစ်ကြောင့်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3930 | Chunk: 66

Evaṃ sesesupi yojanā kātabbā.

AI Translation based on Nissaya

The application should be made to the remaining terms in the same way.

Vietnamese AI Translation

Sự áp dụng nên được thực hiện cho các thuật ngữ còn lại theo cùng một cách.

AI Translation Nissaya

evūṃ=In this same way. ; sesesupi=in the remaining terms also. ; yojanā=the application. ; kātabbā=should be made. ;

Myanmar Nissaya

evūṃ=ဤအတူ။ ; sesesupi=ကြွင်းသော ပုဒ်တို့၌လည်း။ ; yojanā=ယှဉ်ခြင်းကို။ ; kātabbā=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3931 | Chunk: 66

Na pītivatthukānīti dubbalapītijāya balavapītiyā na vatthubhūtāni.

AI Translation based on Nissaya

As for “not a basis for rapture” (na pītivatthukāni): they are not a foundation for strong rapture born from weak rapture.

Vietnamese AI Translation

Đối với “không phải là cơ sở cho hỷ” (na pītivatthukāni): chúng không phải là nền tảng cho hỷ mạnh mẽ sinh ra từ hân hoan yếu ớt.

AI Translation Nissaya

napītivatthukānīti=As for 'not a basis for rapture'. ; dubbalapītijāya=born from weak rapture. ; balavapītiyā=of strong rapture. ; vatthubhūtāni=a foundation. ; na=they are not. ; (From here on, for every term, one should add 'because of not bringing it about'. The text shortens the explanation with the phrase 'evaṃ sesesu'.) ;

Myanmar Nissaya

napītivatthukānīti=ကား။ ; dubbalapītijāya=အားနည်းသော ပီတိကြောင့်ဖြစ်သော။ ; balavapītiyā=၏။ ; vatthubhūtāni=တည်ရာဖြစ်၍ ဖြစ်ကုန်သ်ည။ ; na=မဟုတ်ကုန်။ ; (ဤမှ စ၍ ပုဒ်တိုင်းမှာ၊ တဿ အနာဝဟတ္တာ ဟူ၍လည်းကောင်း။ ပုံလိန်နှင့် တဿ အနာဝဟတ္တာ ဟူ၍ လည်းကောင်း ဆိုရမည်။ ဧဝံ သေသေသု ဟူသော ပါဌ်ဖြင့် ဂန္ထဂရုကို ပယ်သည်။) ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3932 | Chunk: 66

Na passaddhivatthukānīti balavapītijāya kāyacittapassaddhiyā na vatthubhūtāni.

AI Translation based on Nissaya

As for “not a basis for tranquility” (na passaddhivatthukāni): they are not a foundation for bodily and mental tranquility born from strong rapture.

Vietnamese AI Translation

Đối với “không phải là cơ sở cho sự khinh an” (na passaddhivatthukāni): chúng không phải là nền tảng cho sự khinh an về thân và tâm sinh ra từ hỷ mạnh mẽ.

AI Translation Nissaya

na passaddhivatthukānīti=As for 'not a basis for tranquility'. ; balavapītijāya=born from strong rapture. ; kāyacittapassaddhiyā=of bodily and mental tranquility. ; vatthubhūtāni=a foundation. ; na=they are not. ;

Myanmar Nissaya

na passaddhivatthukānīti=ကား။ ; balavapītijāya=အားကြီးသော ပီတိကြောင့်ဖြစ်သော။ ; kāyacittapassaddhiyā=ကာယပဿဒ္ဓိ စိတ္တပဿဒ္ဓိ၏။ ; vatthubhūtāni=ကုန်သည်။ ; na=မဟုတ်ကုန်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3933 | Chunk: 66

Na sukhavatthukānīti passaddhijassa kāyikacetasikasukhassa na vatthubhūtāni.

AI Translation based on Nissaya

As for “not a basis for happiness” (na sukhavatthukāni): they are not a foundation for bodily and mental happiness born from tranquility.

Vietnamese AI Translation

Đối với “không phải là cơ sở cho lạc” (na sukhavatthukāni): chúng không phải là nền tảng cho lạc về thân và tâm sinh ra từ sự khinh an.

AI Translation Nissaya

na sukhavatthukānīti=As for 'not a basis for happiness'. ; passaddhijassa=born from tranquility. ; kāyikacetasikasukhassa=of bodily and mental happiness. ; vatthubhūtāni=a foundation. ; na=they are not. ;

Myanmar Nissaya

na sukhavatthukānīti=ကား။ ; passaddhijassa=ကာယပဿဒ္ဓိ စိတ္တပဿဒ္ဓိကြောင့်ဖြစ်သော။ ; kāyikacetasikasukhassa=၏။ ; vatthubhūtāni=ကုန်သည်။ ; na=မဟုတ်ကုန်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3934 | Chunk: 66

Na samādhivatthukānīti sukhajassa samādhissa [M1.201] na vatthubhūtāni.

AI Translation based on Nissaya

As for “not a basis for concentration” (na samādhivatthukāni): they are not a foundation for concentration born from happiness.

Vietnamese AI Translation

Đối với “không phải là cơ sở cho định” (na samādhivatthukāni): chúng không phải là nền tảng cho định sinh ra từ lạc.

AI Translation Nissaya

na samādhivatthukānīti=As for 'not a basis for concentration'. ; sukhajassa=born from bodily and mental happiness. ; samādhissa=of concentration. ; vatthūbhūtāni=a foundation. ; na=they are not. ;

Myanmar Nissaya

na samādhivatthukānīti=ကား။ ; sukhajassa=ကာယိကသုခ စေတသိက သုခကြောင့်ဖြစ်သော။ ; samādhissa=၏။ ; vatthūbhūtāni=တို့သည်။ ; na=မဟုတ်ကုန်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3935 | Chunk: 66

Na yathābhūtañāṇadassanavatthukānīti samādhipadaṭṭhānassa yathābhūtañāṇadassanassa na vatthubhūtāni.

AI Translation based on Nissaya

As for “not a basis for the knowledge and vision of things as they really are” (na yathābhūtañāṇadassanavatthukāni): they are not a foundation for the knowledge and vision of things as they really are, which has concentration as its proximate cause, because they do not bring it about.

Vietnamese AI Translation

Đối với “không phải là cơ sở cho tri kiến về các pháp như chúng thực sự là” (na yathābhūtañāṇadassanavatthukāni): chúng không phải là nền tảng cho tri kiến về các pháp như chúng thực sự là, mà có định làm nhân gần, vì chúng không mang lại điều đó.

AI Translation Nissaya

na yathābhūtañāṇadassanavatthukānīti=As for 'not a basis for the knowledge and vision of things as they really are'. ; samādhipadaṭṭhānassa=which has concentration as its proximate cause. ; yathābhūtañāṇadassanassa=of the knowledge and vision of insight and path, which is knowing things as they are. ; vatthubhūtāni=a foundation. ; na=they are not. ; kasmā=Why?. ; tassa=of that knowledge and vision of things as they really are. ; vā=or. ; anāvahattā=because of not bringing it about. ;

Myanmar Nissaya

na yathābhūtañāṇadassanavatthukānīti=ကား။ ; samādhipadaṭṭhānassa=သမာဓိလျှင် နီးစွာသော အကြောင်းရှိသော။ ; yathābhūtañāṇadassanassa=ဟုတ်မှန်စွာ သိသော ဝိပဿနာ ဉာဏ် မဂ်ဉာဏ်အမြင်၏။ ; vatthubhūtāni=ကုန်သည်။ ; na=မဟုတ်ကုန်။ ; kasmā=ကား။ ; tassa=ထိုယထာဘူတဉာဏဒဿန၏။ ; vā=ကို။ ; anāvahattā=မဆောင်တတ်သည်၏ အဖြစ်ကြောင့် တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3936 | Chunk: 66

Na ekantanibbidāyātiādīsu na -kārameva āharitvā ‘‘na virāgāyā’’ tiādinā nayena sesapadehipi yojetabbaṃ.

AI Translation based on Nissaya

In passages beginning “Not for utter disenchantment...”, the negative particle “na” should be carried over and connected with the subsequent terms, according to the method of “not for dispassion,” and so on.

Vietnamese AI Translation

Trong các đoạn bắt đầu “Không phải để hoàn toàn nhàm chán...”, phủ định từ “na” nên được mang theo và kết nối với các thuật ngữ tiếp theo, theo phương pháp “không phải để ly tham,” và vân vân.

AI Translation Nissaya

na ekantanibbidāyā=In passages such as 'not for utter disenchantment'. ; samābhiniviṭṭhaṃ=which is well established. ; na kārameva=the letter 'na' only. ; āharitvā=having brought forward to the following words such as 'virāga'. ; navirāgāyātiādinā=such as 'na virāgāya'. ; nayena=by this method. ; sesepadehipi=with the remaining words such as 'virāga' as well. ; yojetabbaṃ=it should be connected. ;

Myanmar Nissaya

na ekantanibbidāyātiādīsu=တို့၌။ ; samābhiniviṭṭhaṃ=သော။ ; na kārameva=န အက္ခရာကို သာလျှင်။ ; āharitvā=ဝိရာဂ အစရှိသော နောက်ပုဒ်သို့ဆောင်၍။ ; navirāgāyātiādinā=သော။ ; nayena=ဖြင့်။ ; sesepadehipi=ဝိရာဂအစရှိသော ကြွင်းသော ပုဒ်တို့နှင့်လည်း။ ; yojetabbaṃ=ယှဉ်စေအပ်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3937 | Chunk: 66

Na virāgāyātiādīsu sanakāro vā pāṭho.

AI Translation based on Nissaya

In passages beginning with “not for dispassion”, there is also a reading that includes the negative particle “na” with each term.

Vietnamese AI Translation

Trong các đoạn bắt đầu bằng “không phải để ly tham”, cũng có cách đọc bao gồm phủ định từ “na” với mỗi thuật ngữ.

AI Translation Nissaya

navirāgāyādiādīsu=In passages beginning with 'na virāgāya'. ; sanakārovā=with the letter 'na', as in 'na virāgāya'. ; pāṭho=there is a reading. ;

Myanmar Nissaya

navirāgāyādiādīsu=တို့၌။ ; sanakārovā=နဝိရာဂါယ ဤသို့ အစရှိသည်ဖြင့် န အက္ခရာနှင့်တကွလည်း။ ; pāṭho=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3938 | Chunk: 66

Tattha ekantanibbidāyāti ekantena vaṭṭe nibbindanatthāya na saṃvattantīti sambandho.

AI Translation based on Nissaya

Therein, in the passage beginning with “not for utter disenchantment,” the connection is this: they do not conduce to the purpose of becoming utterly disenchanted with the round of existence.

Vietnamese AI Translation

Trong đó, trong đoạn bắt đầu bằng “không phải để hoàn toàn nhàm chán,” sự kết nối là như thế này: chúng không dẫn đến mục đích trở nên hoàn toàn nhàm chán với vòng luân hồi.

AI Translation Nissaya

tattha=In that passage beginning with 'na ekantanibbidāya'. ; ekantanibbidāyāti=as for 'for utter disenchantment'. ; ekantena=absolutely. ; vaṭṭe=in the round of existence (kilesa, kamma, vipāka). ; nibbindanatthāya=for the purpose of becoming disenchanted. ; nasaṃvattanti=they do not conduce. ; itiayaṃ=this is. ; sambandho=the connection between the preceding and following words. ;

Myanmar Nissaya

tattha=ထို နဧကန္တနိဗ္ဗိဒါယ အစရှိသော ပါဌ်၌။ ; ekantanibbidāyāti=ကာဂ။ ; ekantena=စင်စစ်အာဖြင့်။ ; vaṭṭe=ကိလေသဝဋ် ကမ္မဝဋ် ဝိပါကဝဋ်၌။ ; nibbindanatthāya=ငြီးငွေ့ခြင်း အကျိုးငှါ။ ; nasaṃvattanti=မဖြစ်ကုန်။ ; itiayaṃ=ကား။ ; sambandho=ရှေ့ပုဒ်နောက်ပုဒ်တို့၏ စပ်ခြင်းတည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3939 | Chunk: 66

Evaṃ sesesupi yojetabbaṃ.

AI Translation based on Nissaya

This should be applied to the remaining terms as well.

Vietnamese AI Translation

Điều này cũng nên được áp dụng cho các thuật ngữ còn lại.

AI Translation Nissaya

evaṃ=Thus. ; sesesupi=in the remaining terms also. ; yojetabbaṃ=it should be applied. ;

Myanmar Nissaya

evaṃ=သို့။ ; sesesupi=ကြွင်းသော ပုဒ်တို့၌လည်း။ ; yojetabbaṃ=ယောဇနာ အပ်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3940 | Chunk: 66

Virāgāyāti vaṭṭe virajjanatthāya.

AI Translation based on Nissaya

As for “for dispassion” (virāgāya): they do not conduce to the purpose of becoming dispassionate towards the threefold round of existence.

Vietnamese AI Translation

Đối với “để ly tham” (virāgāya): chúng không dẫn đến mục đích trở nên ly tham đối với tam giới luân hồi.

AI Translation Nissaya

virāgāyāti=As for 'for dispassion'. ; vaṭṭe=in the threefold round of suffering. ; virajjanatthāya=for the purpose of becoming dispassionate. ; nasaṃvattanti=they do not conduce. ;

Myanmar Nissaya

virāgāyāti=ကား။ ; vaṭṭe=သုံးပါးအပြားရှိသော သံသရာဝဋ်၌။ ; virajjanatthāya=တပ်ခြင်းကင်းခြင်းအကျိုးငှါ။ ; nasaṃvattanti=ကုန်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3941 | Chunk: 66

Nirodhāyāti vaṭṭassa nirodhanatthāya.

AI Translation based on Nissaya

As for “for cessation” (nirodhāya): for the purpose of the cessation of the threefold round.

Vietnamese AI Translation

Đối với “để chấm dứt” (nirodhāya): vì mục đích chấm dứt tam giới luân hồi.

AI Translation Nissaya

nirodhāyāti=As for 'for cessation'. ; vaṭṭassa=of the threefold round. ; virodhanatthāya=for the purpose of cessation. ;

Myanmar Nissaya

nirodhāyāti=ကား။ ; vaṭṭassa=သုံးပါးသော ဝဋ်၏။ ; virodhanatthāya=ချုပ်ခြင်း အကျိုးငှါ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3942 | Chunk: 66

Upasamāyāti nirodhitassa puna anuppattivasena vaṭṭassa upasamanatthāya.

AI Translation based on Nissaya

As for “for appeasement” (upasamāya): for the purpose of the appeasement of the round of existence by way of its non-rearising, once it has ceased.

Vietnamese AI Translation

Đối với “để an tịnh” (upasamāya): vì mục đích làm an tịnh vòng luân hồi bằng cách không tái sanh, một khi nó đã chấm dứt.

AI Translation Nissaya

upasamāyāti=As for 'for appeasement'. ; nirodhitassa=of the round of kamma, defilements, and results that has reached cessation. ; puna=again. ; anuppattivasena=by way of not arising. ; vaṭṭassa=of the round of existence. ; upasamanatthāya=for the purpose of appeasement. ;

Myanmar Nissaya

upasamāyāti=ကား။ ; nirodhitassa=ချုပ်ခြင်းသို့ ရောက်ပြီးသော ကံ ကိသော ဝိပါကဝဋ်၏။ ; puna=နောက်ပြီးတဖန်။ ; anuppattivasena=မဖြစ်လာသည်၏ အစွမ်းဖြင့်။ ; vaṭṭassa=ဝဋ်တရား၏။ ; upasamanatthāya=ငြိမ်းခြင်းအကျိုးငှါ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3943 | Chunk: 66

Abhiññāyāti vaṭṭassa abhijānanatthāya.

AI Translation based on Nissaya

As for “for direct knowledge” (abhiññāya): for the purpose of directly knowing the round of existence.

Vietnamese AI Translation

Đối với “để thắng tri” (abhiññāya): vì mục đích trực tiếp biết vòng luân hồi.

AI Translation Nissaya

abhiññāyāti=As for 'for direct knowledge'. ; vaṭṭassa=of the round. ; abhijānanatthāya=for the purpose of penetratingly knowing. ;

Myanmar Nissaya

abhiññāyāti=ကား။ ; vaṭṭassa=၏။ ; abhijānanatthāya=ထိုးထွင်း၍ သိခြင်းငှါ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3944 | Chunk: 66

Sambodhāyāti kilesaniddāvigamena vaṭṭato pabujjhanatthāya.

AI Translation based on Nissaya

As for “for awakening” (sambodhāya): for the purpose of awakening from the round of existence by being free from the sleep of defilements.

Vietnamese AI Translation

Đối với “để giác ngộ” (sambodhāya): vì mục đích giác ngộ khỏi vòng luân hồi bằng cách thoát khỏi giấc ngủ của phiền não.

AI Translation Nissaya

sammodhāyāti=As for 'for awakening'. ; kilesaniddāvigamena=by means of being free from the sleep of defilements. ; vaṭṭato=from the round of existence. ; pabujjhanatthāya=for the purpose of awakening. ;

Myanmar Nissaya

sammodhāyāti=ကား။ ; kilesaniddāvigamena=ကိလေသာတည်းဟူသော အိပ်ပျော်ခြင်းမှ ကင်းသော အားဖြင့်။ ; vaṭṭato=ဝဋ်တရားမှ။ ; pabujjhanatthāya=နိုးခြင်းအကျိုးငှါ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3945 | Chunk: 66

Nibbānāyāti amatanibbānatthāya.

AI Translation based on Nissaya

As for “for Nibbāna” (nibbānāya): for the purpose of the deathless Nibbāna.

Vietnamese AI Translation

Đối với “để Niết-bàn” (nibbānāya): vì mục đích của Niết-bàn bất tử.

AI Translation Nissaya

nibbānāyāti=As for 'for Nibbāna'. ; amatanibbānatthāya=for the purpose of the deathless Nibbāna. ;

Myanmar Nissaya

nibbānāyāti=ကား။ ; amatanibbānatthāya=အမတနိဗ္ဗာန်အကျိုးငှါ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3946 | Chunk: 66

Yathāsamādinnaṃ sikkhāpadaṃ vītikkamāyāti yathāsamādinnassa sikkhāpadassa vītikkamanatthāya.

AI Translation based on Nissaya

As for “for transgressing the training rule as it was undertaken”: for the purpose of transgressing the training rule that was undertaken.

Vietnamese AI Translation

Đối với “để vi phạm học giới như đã thọ trì”: vì mục đích vi phạm học giới đã được thọ trì.

AI Translation Nissaya

yathāsamādinnaṃ sikkhāpadaṃ vītikkamāyāti=As for 'for transgressing the training rule as it was undertaken'. ; yathāsamādinnassa=which was undertaken as such. ; sikkhāpadassa=of the training rule. ; vītikkamanatthāya=for the purpose of transgressing. ;

Myanmar Nissaya

yathāsamādinnaṃ sikkhāpadaṃ vītikkamāyāti=ကား။ ; yathāsamādinnassa=အကြင်အကြင်ဆောက်တည်အပ်ပြီးသော။ ; sikkhāpadassa=ကို။ ; vītikkamanatthāya=လွန်ကျူးခြင်း အကျိုးငှါ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3947 | Chunk: 66

Vibhattivipallāsavasena panettha upayogavacanaṃ kataṃ.

AI Translation based on Nissaya

However, here in the phrase “yathāsamādinnaṃ sikkhāpadaṃ vītikkamāya,” the accusative case is used by way of a change of case ending.

Vietnamese AI Translation

Tuy nhiên, ở đây trong cụm từ “yathāsamādinnaṃ sikkhāpadaṃ vītikkamāya,” đối cách được sử dụng bằng cách thay đổi đuôi từ.

AI Translation Nissaya

pana=Indeed. ; ettha=here in this phrase 'yathāsamādinnaṃ sikkhāpadaṃ vītikkamāya'. ; vibhattivipallāsavasena=by way of a change of case ending. ; upayogavacanaṃ=the second case ending (accusative). ; kataṃ=is used. ;

Myanmar Nissaya

pana=စင်စစ်သော်ကား။ ; ettha=ဤ ယထာသမာဒိန္နံ သိက္ခာပဒံ ဝီတိက္ကမာယ ဟူသော ပုဒ်၌။ ; vibhattivipallāsavasena=ဝိဘတ်၏ ဖေါက်ပြန်သည်၏ အစွမ်းဖြင့်။ ; upayogavacanaṃ=ဒုတိယာ ဝိဘတ်ကို။ ; kataṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3948 | Chunk: 66

Cittampi na uppādetīti cittuppādasuddhiyā sīlassa ativisuddhabhāvadassanatthaṃ vuttaṃ, na pana cittuppādamattena sīlaṃ bhijjati.

AI Translation based on Nissaya

The phrase “does not even give rise to the thought” is stated to show the extreme purity of this morality, through the purity of the non-arising of such thoughts. However, the moral precept is not broken merely by the arising of a thought.

Vietnamese AI Translation

Cụm từ “thậm chí không khởi lên ý nghĩ” được nói đến để cho thấy sự trong sạch tột bậc của giới này, thông qua sự trong sạch của việc không khởi lên những ý nghĩ như vậy. Tuy nhiên, giới không bị vi phạm chỉ đơn thuần do sự khởi lên của một ý nghĩ.

AI Translation Nissaya

cittampi na uppādetīti=As for 'does not even give rise to the thought'. ; cittuppādasuddhiyā=because of the purity of the arising of thought. ; sīlassa=of morality. ; ativisuddhabhāvadassanatthaṃ=to show the state of extreme purity. ; vuttaṃ=it is said. ; pana=Indeed. ; cittuppādamattena=merely by the arising of a thought. ; sīlaṃ=the training rule morality. ; nabhijjati=is not broken. ;

Myanmar Nissaya

cittampi na uppādetīti=ကား။ ; cittuppādasuddhiyā=စိတ်ဖြစ်ခြင်းဖြင့် စင်ကြယ်ခြင်းကြောင့်။ ; sīlassa=၏။ ; ativisuddhabhāvadassanatthaṃ=အလွန်စင်ကြယ်သည်၏အဖြစ်ကို ပြုခြင်းငှါ။ ; vuttaṃ=၏။ ; pana=စင်စစ်သော်ကား။ ; cittuppādamattena=စိတ်ဥပါဒ်ကာမျှဖြင့်။ ; sīlaṃ=သိက္ခာပဒသီလသည်။ ; nabhijjati=မပျက်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3949 | Chunk: 66

Kiṃ so vītikkamissatīti kimatthaṃ vītikkamaṃ karissati, neva vītikkamaṃ karissatīti attho.

AI Translation based on Nissaya

As for “how could he transgress?”: the meaning is, “For what purpose would he commit a transgression? He will never commit a transgression.”

Vietnamese AI Translation

Đối với câu “làm sao vị ấy có thể vi phạm?”: ý nghĩa là, “Vị ấy sẽ vi phạm vì mục đích gì? Vị ấy sẽ không bao giờ vi phạm.”

AI Translation Nissaya

kiṃso vītikkamissatīti=As for 'how could he transgress?'. ; kimutthaṃ=for what purpose. ; vītikkamaṃ=transgression. ; karissati=would he commit?. ; vitikkamaṃ=transgression. ; neva karissati=he will never commit. ; itiayaṃ=this is. ; attho=the meaning. ;

Myanmar Nissaya

kiṃso vītikkamissatīti=ကား။ ; kimutthaṃ=အဘယ်အကျိုးငှါ။ ; vītikkamaṃ=အလွန်ကျူးခြင်းကို။ ; karissati=ပြုလတ္တံ့နည်း။ ; vitikkamaṃ=လွန်ကျူးခြင်းကို။ ; neva karissati=မပြုလတ္တံ့သည်သာတည်း။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3950 | Chunk: 66

Akhaṇḍānītiādīni heṭṭhā vuttapaṭipakkhanayena veditabbāni.

AI Translation based on Nissaya

The terms beginning with “unbroken” (akhaṇḍāni) should be understood by the method opposite to what was stated above.

Vietnamese AI Translation

Các thuật ngữ bắt đầu bằng “không bị bể vụn” (akhaṇḍāni) nên được hiểu theo phương pháp ngược lại với những gì đã được trình bày ở trên.

AI Translation Nissaya

akhaṇḍānītiādīni=The words beginning with 'unbroken'. ; heṭṭho=below/before. ; vuttapaṭipakkhanayena=by the method opposite to what was said before. ; veditabbāni=should be understood. ;

Myanmar Nissaya

akhaṇḍānītiādīni=ဤသို့ အစရှိသော စကားတို့ကို။ ; heṭṭho=အောက်၌။ ; vuttapaṭipakkhanayena=ဆိုအပ်ပြီးသည်မှ ပြန်သောနည်းဖြင့်။ ; veditabbāni=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3951 | Chunk: 66

Na khaṇḍānītipi pāṭho.

AI Translation based on Nissaya

There is also the reading, “na khaṇḍāni.”

Vietnamese AI Translation

Cũng có cách đọc là, “na khaṇḍāni.”

AI Translation Nissaya

nakhaṇḍānītipi=Also as 'na khaṇḍāni'. ; pāṭho=there is a reading. ;

Myanmar Nissaya

nakhaṇḍānītipi=ဟု၍လည်း‌။ ; pāṭho=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3952 | Chunk: 66

‘‘Ekantanibbidāyā’’ tiādīsu ekantena vaṭṭe nibbindanatthāyātiādinā nayena yojetabbaṃ [P1.218].

AI Translation based on Nissaya

In the passage beginning with “for utter disenchantment,” it should be connected by the method of “for the purpose of becoming utterly disenchanted with the round of existence,” and so on.

Vietnamese AI Translation

Trong đoạn bắt đầu bằng “vì sự nhàm chán hoàn toàn,” nó nên được liên kết theo phương pháp “với mục đích trở nên nhàm chán hoàn toàn với vòng luân hồi,” và v.v.

AI Translation Nissaya

ekantanibbidāyātiādīsu=In the passage beginning 'for utter disenchantment'. ; ekantena=absolutely. ; vaṭṭe=in the round of existence. ; nibbindanatthāya=for the purpose of becoming disenchanted. ; itiādinā=and so on. ; nayena=by this method. ; yojetabbaṃ=it should be connected. ;

Myanmar Nissaya

ekantanibbidāyātiādīsu=တို့၏။ ; ekantena=စင်စစ်အားဖြင့်။ ; vaṭṭe=သံသရာဝဋ်၌။ ; nibbindanatthāya=ငြီးငွေ့ခြင်းငှာ။ ; itiādinā=သော။ ; nayena=ဖြင့်။ ; yojetabbaṃ=ယှဉ်စေအပ်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3953 | Chunk: 66

Ettha pana nibbidāyāti vipassanā.

AI Translation based on Nissaya

Furthermore, here in this wholesome section, “for disenchantment” refers to insight.

Vietnamese AI Translation

Hơn nữa, ở đây trong phần thiện này, “vì sự nhàm chán” đề cập đến tuệ quán.

AI Translation Nissaya

pana=To state a special point. ; ettha=here in this wholesome section. ; nibbidāyāti=as for 'for disenchantment'. ; vipassanā=it means insight. ;

Myanmar Nissaya

pana=အထူးကို ဆိုဦးအံ့။ ; ettha=ဤသုက္ခပက္ခ၌။ ; nibbidāyāti=ကား။ ; vipassanā=ဝိပဿနာတည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3954 | Chunk: 66

Virāgāyāti maggo.

AI Translation based on Nissaya

“For dispassion” refers to the path.

Vietnamese AI Translation

“Vì sự ly tham” đề cập đến đạo.

AI Translation Nissaya

virāgāyāti=As for 'for dispassion'. ; maggo=it means the path. ;

Myanmar Nissaya

virāgāyāti=ကား။ ; maggo=မဂ်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3955 | Chunk: 66

Nirodhāya upasamāyāti nibbānaṃ.

AI Translation based on Nissaya

“For cessation” and “for appeasement” refer to Nibbāna.

Vietnamese AI Translation

“Vì sự đoạn diệt” và “vì sự an tịnh” đề cập đến Nibbāna.

AI Translation Nissaya

nirodhāya upasamāyāti=As for 'for cessation' and 'for appeasement'. ; nibbānaṃ=it means Nibbāna. ;

Myanmar Nissaya

nirodhāya upasamāyāti=ကား။ ; nibbānaṃ=နိဗ္ဗာန်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3956 | Chunk: 66

Abhiññāya sambodhāyāti maggo.

AI Translation based on Nissaya

“For direct knowledge” and “for awakening” refer to the path.

Vietnamese AI Translation

“Vì thắng trí” và “vì sự giác ngộ” đề cập đến đạo.

AI Translation Nissaya

abhiññā yasambodhāyāti=As for 'for direct knowledge' and 'for awakening'. ; maggo=it means the path. ;

Myanmar Nissaya

abhiññā yasambodhāyāti=ကား။ ; maggo=မဂ်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3957 | Chunk: 66

Nibbānāyāti nibbānameva.

AI Translation based on Nissaya

“For Nibbāna” refers to Nibbāna itself.

Vietnamese AI Translation

“Vì Nibbāna” đề cập đến chính Nibbāna.

AI Translation Nissaya

nibbānāyāti=As for 'for Nibbāna'. ; nibbānameva=it means Nibbāna itself. ;

Myanmar Nissaya

nibbānāyāti=ကား။ ; nibbānameva=နိဗ္ဗာန်ပင်လျှင်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3958 | Chunk: 66

Ekasmiṃ ṭhāne vipassanā, dvīsu maggo, tīsu nibbānaṃ vuttanti evaṃ avatthānakathā veditabbā.

AI Translation based on Nissaya

The defining explanation should be understood thus: in one place, insight is spoken of; in two places, the path is spoken of; and in three places, Nibbāna is spoken of.

Vietnamese AI Translation

Lời giải thích xác định nên được hiểu như sau: ở một nơi, tuệ quán được nói đến; ở hai nơi, đạo được nói đến; và ở ba nơi, Nibbāna được nói đến.

AI Translation Nissaya

ekasmiṃṭhāne=In one place. ; vipassanā=insight. ; vuttā=is spoken of. ; dvīsu=In two places. ; maggo=the path. ; vutto=is spoken of. ; tīsu=In three places. ; nibbānaṃ=Nibbāna. ; vuttaṃ=is spoken of. ; itievaṃ=Thus. ; avatthānakathā=the discourse that defines the scope. ; veditabbā=should be understood. ;

Myanmar Nissaya

ekasmiṃṭhāne=တစ်ခုသော အရာ၌။ ; vipassanā=ကို။ ; vuttā=၏။ ; dvīsu=နှစ်ပါးသော ဌာနတို့၌။ ; maggo=ကို။ ; vutto=ကို။ ; tīsu=သုံးပါးသော ဌာနတို့၌။ ; nibbānaṃ=ကို။ ; vuttaṃ=၏။ ; itievaṃ=သို့။ ; avatthānakathā=ပိုင်းခြားကြောင်းဖြစ်သော စကားကို။ ; veditabbā=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3959 | Chunk: 66

Pariyāyena pana sabbānipetāni maggavevacanānipi nibbānavevacanānipi hontiyeva.

AI Translation based on Nissaya

However, figuratively, all of these terms can indeed be synonyms for the path, and they can also be synonyms for Nibbāna.

Vietnamese AI Translation

Tuy nhiên, theo nghĩa bóng, tất cả những thuật ngữ này thực sự có thể là từ đồng nghĩa với đạo, và chúng cũng có thể là từ đồng nghĩa với Nibbāna.

AI Translation Nissaya

pana=To add a special point. ; pariyāyena=Figuratively. ; sabbānipi=all. ; etāni=these terms. ; maggavevacanānipi=are also synonyms for the path. ; hontiyeva=they are indeed. ; nibbānavevacanānipi=and also synonyms for Nibbāna. ; hontiyeva=they are indeed. ;

Myanmar Nissaya

pana=ဆိုဖွယ်အထူး မိန့်ဆိုဦးအံ့။ ; pariyāyena=ပရိယာယ်အားဖြင့်။ ; sabbānipi=ကုန်သော။ ; etāni=ဤပုဒ်တို့သည်။ ; maggavevacanānipi=မဂ်၏ ဝေဝစနတို့သည်လည်း။ ; hontiyeva=လျှင်တည်း။ ; nibbānavevacanānipi=နိဗ္ဗာန်၏ ဝေဝုစ် ပရိယာယ်တို့သည်လည်း။ ; hontiyeva=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3960 | Chunk: 66

39. Idāni pariyantāpariyantavasena vijjamānapabhedaṃ dassetvā puna dhammavasena jātivasena paccayavasena sampayuttavasena sīlassa pabhedaṃ dassetuṃ kiṃ sīlan tiādimāha.

AI Translation based on Nissaya

Now, having shown the existing division of morality by way of limited and unlimited morality, in order to show the division of morality by way of phenomena, by way of nature, by way of cause, and by way of association, the Elder, the General of the Dhamma, spoke the passage beginning, “What is morality?”

Vietnamese AI Translation

Bây giờ, sau khi đã chỉ ra sự phân chia hiện có của giới theo phương diện giới hữu hạn và giới vô hạn, để chỉ ra sự phân chia của giới theo phương diện các pháp, theo phương diện bản chất, theo phương diện nguyên nhân, và theo phương diện sự liên hợp, vị Trưởng Lão, Pháp Tướng, đã nói đoạn kinh bắt đầu bằng: “Giới là gì?”

AI Translation Nissaya

idāni=Now. ; pariyantāpariyantavasena=by way of limited and unlimited morality. ; vijjamānapabhedaṃ=the existing division in morality. ; vā=or the existing division of unbroken morality. ; dassetvā=having shown. ; puna=again. ; dhammavasena=by way of phenomena, and also. ; jātivasena=by way of nature, and also. ; paccayavasena=by way of cause, and also. ; sampayuttavasena=by way of association, and also. ; sīlassa=of morality. ; pabhedaṃ=the division. ; dassetuṃ=in order to show. ; kiṃ sīlantiādiṃ=the passage beginning with 'What is morality?'. ; dhammasenāpatitthero=the Elder, the General of the Dhamma. ; āha=said. ;

Myanmar Nissaya

idāni=၌။ ; pariyantāpariyantavasena=ပရိယန္တသီလ အပရိယန္တသီလ၏ အစွမ်းဖြင့်။ ; vijjamānapabhedaṃ=သီလ၌ ထင်ရှားရှိသော အပြားကို။ ; vā=ထင်ရှားရှိသော မပြတ်သော သီလ၏ အပြားကို။ ; dassetvā=ပြပြီး၍။ ; puna=နောက်ပြီးတဖန်။ ; dhammavasena=တရား၏ အစွမ်းဖြင့် လည်းကောင်း။ ; jātivasena=လည်းကောင်း။ ; paccayavasena=အကြောင်း၏အစွမ်းဖြင့် လည်းကောင်း။ ; sampayuttavasena=လည်းကောင်း။ ; sīlassa=၏။ ; pabhedaṃ=အပြားကို။ ; dassetuṃ=ပြခြင်းငှါ။ ; kiṃ sīlantiādiṃ=ကို။ ; dhammasenāpatitthero=သည်။ ; āha=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3961 | Chunk: 66

Tattha samuṭṭhāti etenāti samuṭṭhānaṃ.

AI Translation based on Nissaya

Therein, 'it arises from this,' thus it is an origin (samuṭṭhāna).

Vietnamese AI Translation

Trong đó, 'nó sanh khởi từ cái này,' do đó nó là một nguồn gốc (samuṭṭhāna).

AI Translation Nissaya

tattha=In that text beginning with 'kiṃ sīlaṃ'. ; (avayavattho=The meaning of the components. ; evaṃ=in the following way. ; veditabbo=should be understood.). ; etena=by this. ; samuṭṭhāti=it arises. ; iti=thus. ; samuṭṭhānaṃ=it is called 'origin' (samuṭṭhāna). ;

Myanmar Nissaya

tattha=ထို ကိံ သီလံ အစရှိသော ပါဌ်၌။ ; (avayavattho=အစိတ်ဖြစ်သော အနက်ကို။ ; evaṃ=ဤဆိုလတ္တံ့သော နည်းဖြင့်။ ; veditabbo=၏။) ; etena=ဤအကြောင်းဖြင့်။ ; samuṭṭhāpeti=အကျိုးဖြစ်တတ်၏။ ; itismā=ကြောင့်။ ; samuṭṭhānaṃ=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3962 | Chunk: 67

Paccayassetaṃ nāmaṃ.

AI Translation based on Nissaya

This is a name for a cause (paccaya).

Vietnamese AI Translation

Đây là một tên gọi cho một nguyên nhân (paccaya).

AI Translation Nissaya

etaṃ=This. ; paccayassa=of a cause. ; nāmaṃ=is a name. ;

Myanmar Nissaya

evaṃ=ဤသမုဋ္ဌာနဟူသော အမည်သည်။ ; paccayassa=အကြောင်း၏။ ; nāmaṃ=အမည်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3963 | Chunk: 67

Kiṃ samuṭṭhānamassāti kiṃsamuṭṭhānaṃ.

AI Translation based on Nissaya

'What is its origin?' thus it is called 'what is its origin' (kiṃsamuṭṭhānaṃ).

Vietnamese AI Translation

'Nguồn gốc của nó là gì?' do đó nó được gọi là 'nguồn gốc của nó là gì' (kiṃsamuṭṭhānaṃ).

AI Translation Nissaya

assa=For it (this virtue). ; kiṃ=What. ; samuṭṭhānaṃ=is the origin?. ; atthi=is there?. ; iti=Thus. ; kiṃ samuṭṭhānaṃ=it is called 'what is its origin'. ;

Myanmar Nissaya

assa=ထိုသီလအား။ ; kiṃ=အဘယ်မည်သော။ ; samuṭṭhānaṃ=ဖြစ်ကြောင်းသည်။ ; atthi=သနည်း။ ; iti tasmā=ကြောင့်။ ; kiṃ samuṭṭhānaṃ=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3964 | Chunk: 67

Katinaṃ dhammānaṃ samodhānaṃ samavāyo assāti katidhammasamodhānaṃ.

AI Translation based on Nissaya

'Of how many states is the combination for it?' thus it is called 'the combination of how many dhammas' (katidhammasamodhānaṃ).

Vietnamese AI Translation

'Sự kết hợp của bao nhiêu pháp dành cho nó?' do đó nó được gọi là 'sự kết hợp của bao nhiêu pháp' (katidhammasamodhānaṃ).

AI Translation Nissaya

assa=For it. ; katinaṃdhammānaṃ=of how many states. ; samodhānaṃ samavāyo=is the combination. ; atthi=is there?. ; iti tasmā=Therefore. ; katidhammasamodhānaṃ=it is called 'the combination of how many dhammas'. ;

Myanmar Nissaya

assa=ထိုသီလအား။ ; katinaṃdhammānaṃ=အဘယ်မျှလောက်သော တရားတို့၏။ ; samodhānaṃ samavāyo=ပေါင်းခြင်းသည်။ ; atthi=ရှိသနည်း။ ; ititasmā=ကြောင့်။ ; katidhammasamodhānaṃ=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3965 | Chunk: 67

Cetanā [V1.185] sīlan ti pāṇātipātādīhi viramantassa, vattapaṭipattiṃ vā pūrentassa cetanā.

AI Translation based on Nissaya

Volition [V1.185] is virtue means the volition of one who is abstaining from killing living beings and so on, or of one who is fulfilling the practice of duties.

Vietnamese AI Translation

Tư [V1.185] là giới có nghĩa là tư của người đang kiêng cữ việc sát sanh v.v., hoặc của người đang chu toàn việc thực hành các bổn phận.

AI Translation Nissaya

cetanā sīlan ti=[The phrase] 'volition [V1.185] is virtue' means. ; pāṇātipātādīhi viramantassa=of one abstaining from killing living beings, etc.. ; vā=or. ; vattapaṭipattiṃ pūrentassa=of one fulfilling the practice of duties. ; cetanā=it is the volition. ;

Myanmar Nissaya

cetanāsīlanti=ကား။ ; pāṇātipātādihi=တို့မှ။ ; viramantassavā=ကြဉ်ဆဲသော ပုဂ္ဂိုလ်၏ လည်းကောင်း။ ; vattapaṭipattiṃ=ဝတ်၌ ကျင့်ခြင်းကို။ ; pūrentassavā=ဖြည့်ဆဲသော ပုဂ္ဂိုလ်၏ လည်းကောင်း။ ; cetanā=စေတနာတည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3966 | Chunk: 67

Cetasikaṃ sīlan ti pāṇātipātādīhi viramantassa virati.

AI Translation based on Nissaya

A mental factor is virtue means the abstinence of one who abstains from killing living beings and so on.

Vietnamese AI Translation

Tâm sở là giới có nghĩa là sự kiêng cữ của người kiêng cữ việc sát sanh v.v.

AI Translation Nissaya

cetasikaṃ sīlan ti=[The phrase] 'A mental factor is virtue' means. ; pāṇātipātādīhi viramantassa=of one who abstains from killing living beings, etc.. ; vīrati=it is the abstinence. ; vā=is. ; cetasikaṃ sīlanti=called 'mental factor as virtue'. ;

Myanmar Nissaya

cetasikaṃ sīlanti=ကား။ ; pāṇātipātādīhi=တို့မှ။ ; viramantassa=ကြဉ်သော ပုဂ္ဂိုလ်၏။ ; vīrati=ဝီရတီတည်း။ ; vā=သည်။ ; cetasikaṃ sīlanti=စေတသိကံ သီလနံ နာမ မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3967 | Chunk: 67

Apica cetanā sīlaṃ nāma pāṇātipātādīni pajahantassa sattakammapathacetanā [M1.202].

AI Translation based on Nissaya

Furthermore, what is called 'volition as virtue' are the seven volitions of the paths of action [M1.202] for one who abandons killing living beings and so on.

Vietnamese AI Translation

Hơn nữa, cái được gọi là 'tư như là giới' là bảy tư của các nghiệp đạo [M1.202] đối với người từ bỏ việc sát sanh v.v.

AI Translation Nissaya

apica=Furthermore. ; cetanāsīlaṃnāma=what is called 'volition as virtue'. ; pāṇātipātādīni pajahantassa=of a person who abandons killing living beings, etc.. ; satta kammapathacetanā=are the seven volitions of the paths of action [M1.202]. ;

Myanmar Nissaya

apica=တနည်းလည်း။ ; cetanāsīlaṃnāma=မည်သည်ကား။ ; pāṇātipātādīni=တို့ကို။ ; pajahantassaca=စွန့်ပယ်သော ပုဂ္ဂိုလ်၏လည်း။ ; satta kammapathacetanā=ခုနစ်ပါးသော ကမ္မပထစေတနာတည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3968 | Chunk: 67

Cetasikaṃ sīlaṃ nāma ‘‘abhijjhaṃ loke pahāya vigatābhijjhena cetasā viharatī’’ tiādinā ( dī. ni. 1.217) nayena vuttā anabhijjhāabyāpādasammādiṭṭhidhammā.

AI Translation based on Nissaya

What is called 'a mental factor as virtue' are the states of non-covetousness, non-ill will, and right view, spoken of by the method beginning with the phrase (dī. ni. 1.217): 'Having abandoned covetousness in the world, one dwells with a mind devoid of covetousness.'

Vietnamese AI Translation

Cái được gọi là 'tâm sở như là giới' là các trạng thái vô tham, vô sân và chánh kiến, được nói đến theo phương pháp bắt đầu bằng cụm từ (dī. ni. 1.217): 'Sau khi từ bỏ tham ái trên thế gian, vị ấy trú với tâm không có tham ái.'

AI Translation Nissaya

cetasikaṃ sīlaṃnāma=What is called 'a mental factor as virtue' are. ; loke=in the world of beings. ; abhijjhaṃ=covetousness. ; pahāya=having abandoned. ; vigatābhijjhena=with a mind devoid of covetousness. ; cetasā=with a mind. ; viharati=one dwells. ; itiādinā=by the beginning of this phrase. ; nayena=by the method. ; vuttā=spoken of. ; anabhijjhāabyāpādasammādiṭṭhidhammā=the states of non-covetousness, non-ill will, and right view. ; cetasikaṃ sīlaṃnāma=is called 'a mental factor as virtue'. ;

Myanmar Nissaya

cetasikaṃ sīlaṃnāma=မည်သည်ကား။ ; loke=သတ္တလောက၌။ ; abhijjhaṃ=ကို။ ; pahāya=၍။ ; vigatābhijjhena=ကင်းသော အဘိဇ္ဈာရှိသော။ ; cetasā=စိတ်ဖြင့်။ ; viharati=၏။ ; itiādinā=သော။ ; nayena=ဖြင့်။ ; vuttā=ကုန်၏။ ; anabhijjhāabyāpādasammādiṭṭhidhammā=တို့သည်။ ; cetasikaṃ sīlaṃnāma=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3969 | Chunk: 67

Saṃvaro sīlan ti ettha pañcavidho saṃvaro veditabbo – pātimokkhasaṃvaro, satisaṃvaro, ñāṇasaṃvaro, khantisaṃvaro, vīriyasaṃvaroti.

AI Translation based on Nissaya

Herein, in the phrase Restraint is virtue, the fivefold restraint should be understood as: restraint of the Pātimokkha, restraint by mindfulness, restraint by knowledge, restraint by patience, and restraint by energy.

Vietnamese AI Translation

Trong đó, trong cụm từ Thu thúc là giới, năm loại thu thúc nên được hiểu là: thu thúc Pātimokkha, thu thúc bằng niệm, thu thúc bằng trí, thu thúc bằng kham nhẫn và thu thúc bằng tinh tấn.

AI Translation Nissaya

saṃvaro sīlan ti ettha=Herein, in the phrase 'restraint is virtue'. ; pātimokkhasaṃvaro=restraint of the Pātimokkha. ; satisaṃvaro=restraint by mindfulness. ; ñāṇasaṃvaro=restraint by knowledge. ; khantisaṃvaro=restraint by patience. ; vīriyasaṃvaro=and restraint by energy. ; iti=thus. ; pañcavidho=fivefold. ; saṃvaro=restraint. ; veditabbo=should be understood. ;

Myanmar Nissaya

saṃvaro sīlantiettha=၌။ ; pātimokkhasaṃvaro=လည်းကောင်း။ ; satisaṃvaro=လည်းကောင်း။ ; uāṇasaṃvaro=လည်းကောင်း။ ; khandhasaṃvaro=လည်းကောင်း။ ; vīriyasaṃvaro=လည်းကောင်း။ ; iti=သို့။ ; pañcavidho=သော။ ; saṃvaro=ကို။ ; veditabbo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3970 | Chunk: 67

Tattha ‘‘iminā pātimokkhasaṃvarena upeto hoti samupeto’’ ti ( vibha. 511) ayaṃ pātimokkhasaṃvaro.

AI Translation based on Nissaya

Among these, this restraint, [as in the quote] 'one is endowed, well endowed with this restraint of the Pātimokkha' (vibha. 511), is the restraint of the Pātimokkha.

Vietnamese AI Translation

Trong số này, sự thu thúc này, [như trong câu trích dẫn] 'vị ấy được phú bẩm, được phú bẩm tốt đẹp với sự thu thúc Pātimokkha này' (vibha. 511), là sự thu thúc Pātimokkha.

AI Translation Nissaya

tattha=Among those five kinds of restraint. ; iminā pātimokkhasaṃvarena=with this virtue of the restraint of the Pātimokkha. ; upeto=endowed. ; samupeto=well endowed. ; hoti=one is. ; iti ayaṃ saṃvaro=This restraint (taught in the text of the Jhāna Vibhaṅga). ; pātimokkhasaṃvaro=is called the restraint of the Pātimokkha. ;

Myanmar Nissaya

tattha=ထိုငါးပါးသော သံဝရတို့တွင်။ ; iminā pātimokkhasaṃvarena=ဤပါတိမောက္ခသံဝရသီလနှင့်။ ; upeto=ပြည့်စုံသည်။ ; samupeto=ကောင်းစွာ ပြည့်စုံသည်။ ; hoti=၏။ ; itiayaṃsaṃvaro=ဤ( ဈာနဝိဘင်းပါဌ်၌ ဟောသော) သံဝရသည်။ ; pātimokkhasaṃvaro=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3971 | Chunk: 67

‘‘Rakkhati cakkhundriyaṃ, cakkhundriye saṃvaraṃ āpajjatī’’ ti ( dī. ni. 1.213; ma. ni. 1.295; saṃ. ni. 4.239; a. ni. 3.16) ayaṃ satisaṃvaro.

AI Translation based on Nissaya

This restraint, [as in the quote] 'one guards the eye faculty, one attains restraint in the eye faculty' (dī. ni. 1.213; ma. ni. 1.295; saṃ. ni. 4.239; a. ni. 3.16), is the restraint by mindfulness.

Vietnamese AI Translation

Sự thu thúc này, [như trong câu trích dẫn] 'vị ấy hộ trì nhãn căn, vị ấy đạt được sự thu thúc trong nhãn căn' (dī. ni. 1.213; ma. ni. 1.295; saṃ. ni. 4.239; a. ni. 3.16), là sự thu thúc bằng niệm.

AI Translation Nissaya

cakkhundriyaṃ=the eye faculty. ; rakkhati=one guards. ; cakkhundriye=in the eye faculty. ; saṃvaraṃ=to restraint. ; āpajjati=one attains. ; iti ayaṃ saṃvaro=This restraint (which comes in the Pāḷi of the Tika, Catukka, Pañcaka, and Dasaka Aṅguttara). ; satisaṃvaro=is called restraint by mindfulness. ;

Myanmar Nissaya

cakkhundriyaṃ=ကို။ ; rakkhati=စောင့်၏။ ; cakkhundriye=၌။ ; saṃvaraṃ=စောက်ရှောက်ခြင်းသို့။ ; āpajjati=ရောက်၏။ ; iti ayaṃ saṃvaro=ဤ (တိက စတုက္က ပဉ္စထ ဒဿအင်္ဂုတ္တိုရ်ပါဠိတို့၌ လာသော ) သံဝရသည်။ ; satisaṃvaro=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3972 | Chunk: 67

‘‘Yāni sotāni lokasmiṃ, ( ajitāti bhagavā; )

AI Translation based on Nissaya

The Blessed One addressed him, 'Ajita, whatever streams there are in the world, (Ajitāti bhagavā);

Vietnamese AI Translation

Đức Thế Tôn ngỏ lời với vị ấy: 'Này Ajita, bất cứ dòng chảy nào có trên thế gian, (Ajitāti bhagavā);

AI Translation Nissaya

Meaning of the verse. . ; ajitāti=as 'Ajita'. ; bhagavā=the Blessed One. ; ālapati=addressed. ; lokasmiṃ=In the world of beings. ; yāni sotāni=whatever streams, such as craving. ; santi=there are. ;

Myanmar Nissaya

ဂါထာအနက်။ ။ ; ajitāti=အဇိတဟူ၍။ ; bhagavā=သည်။ ; ālapati=ခေါ်တော်မူ၏။ ; lokasmiṃ=သတ္တလောက၌။ ; yāni sotāni=အကြင်တဏှာအစရှိသော သောတတို့သည်။ ; santi=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3973 | Chunk: 67

Sati tesaṃ nivāraṇaṃ;

AI Translation based on Nissaya

mindfulness is their prevention;

Vietnamese AI Translation

niệm là sự ngăn ngừa chúng;

AI Translation Nissaya

tesaṃ=of those streams, such as craving. ; nivāraṇaṃ=the means of preventing. ; sati=is solely the state of mindfulness. ;

Myanmar Nissaya

tesaṃ=ထိုတဏှာ အစရှိသော သောတတို့ကို။ ; nivāraṇaṃ=ပိတ်ပင်ကြောင်းကား။ ; sati=သတိတရား သာလျှင်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3974 | Chunk: 67

Sotānaṃ saṃvaraṃ brūmi, paññāyete pidhīyare’’ ti. ( su. ni. 1041)–

AI Translation based on Nissaya

I declare the restraint of the streams; they are blocked by wisdom.' (su. ni. 1041)–

Vietnamese AI Translation

Ta tuyên bố sự thu thúc các dòng chảy; chúng bị chặn lại bởi trí tuệ.' (su. ni. 1041)–

AI Translation Nissaya

sotānaṃ=of the streams, such as craving. ; saṃvaraṃ=the restraint. ; brūmi=I, the Buddha, teach. ; ete=those streams, such as craving. ; paññāya=by wisdom. ; pidhīyare=are blocked/obstructed. ;

Myanmar Nissaya

sotānaṃ=တဏှာသောတအစရှိသည်တို့ကို။ ; saṃvaraṃ=စောင့်ရှောက်ခြင်းကို။ ; brūmi=ငါဘုရားဟောတော်မူ၏။ ; ete=ထိုတဏှာသောတအစရှိသည်တို့ကို။ ; paññāya=ဖြင့်။ ; pidhīyare=ပိဓီယန္တိ ဆို့ပိတ်အပ်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3975 | Chunk: 67

Ayaṃ ñāṇasaṃvaro.

AI Translation based on Nissaya

This is restraint by knowledge.

Vietnamese AI Translation

Đây là sự thu thúc bằng trí.

AI Translation Nissaya

iti ayaṃ saṃvaro=This restraint (which comes in the Ajita Sutta of the Suttanipāta Mahāniddesa). ; ñāṇasaṃvaro=is called restraint by knowledge. ;

Myanmar Nissaya

iti ayaṃ saṃvaro=ဤ (သုတ္တနိပါတ် မဟာနိဒ္ဒေသ အဇိတသုတ်၌လာသော) သံဝရသည်။ ; ñāṇasaṃvaro=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3976 | Chunk: 67

Paccayapaṭisevanampi ettheva samodhānaṃ gacchati.

AI Translation based on Nissaya

The partaking of the requisites is also included right here.

Vietnamese AI Translation

Việc thọ dụng các vật dụng cũng được bao gồm ngay tại đây.

AI Translation Nissaya

paccayapaṭisevanampi=The partaking of the four requisites also. ; ettheva=in this very restraint by knowledge. ; samādhānaṃ=to combination. ; gacchati=goes. ;

Myanmar Nissaya

paccayapaṭisevanampi=ပစ္စည်းလေးပါးကို မှီဝဲခြင်းသည်လည်း။ ; ettheva=ဤဉာဏသံဝရ၌သာလျှင်။ ; samādhānaṃ=ပေါင်းခြင်းသို့။ ; gacchati=ရောက်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3977 | Chunk: 67

Yo panāyaṃ ‘‘khamo hoti sītassa uṇhassā’’ tiādinā ( ma. ni. 1.24; a. ni. 4.114;6.58) nayena āgato, ayaṃ khantisaṃvaro nāma.

AI Translation based on Nissaya

Furthermore, that which comes by the method beginning with 'one is able to endure cold and heat' (ma. ni. 1.24; a. ni. 4.114; 6.58), this is called restraint by patience.

Vietnamese AI Translation

Hơn nữa, điều được đề cập theo phương pháp bắt đầu bằng 'vị ấy có khả năng chịu đựng lạnh và nóng' (ma. ni. 1.24; a. ni. 4.114; 6.58), đây được gọi là sự thu thúc bằng kham nhẫn.

AI Translation Nissaya

pana=Furthermore. ; sītassa=cold. ; uṇhassa=heat. ; khamo=one can endure. ; vā=by enduring, one can strive for the two burdens. ; hoti=is. ; iti ādinā=by this beginning. ; nayena=by the method. ; āgato=which comes in the Sabbāsava Sutta of the Mūlapaṇṇāsa, the ūnavīsati sikkhāpada, and the Sāriputta Sutta of the Mahāniddesa. ; yo ayaṃ saṃvaro=that restraint. ; khantisaṃvaro nāma=is called restraint by patience. ;

Myanmar Nissaya

pana=ထိုမှတပါး။ ; sītassa=အချမ်းကို။ ; uṇhassa=အပူကို။ ; khamo=သည်းခံနိုင်သည်။ ; vā=သည်းခံ၍ ဓူရနှစ်ပါးကို အားထုတ်နိုင်သည်။ ; hoti=၏။ ; iti ādinā=သော။ ; nayena=ဖြင့်။ ; āgato=မူလပဏ္ဏာသ သဗ္ဗာသဝသုတ် ဦနဝီသတိသိက္ခာပုဒ် မဟာနိဒ္ဒေသသာရိပုတ္တသုတ်တို့၌ လာသော။ ; yo ayaṃ saṃvaro=သည်။ ; khantisaṃvaro nāma=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3978 | Chunk: 67

Yo cāyaṃ ‘‘uppannaṃ kāmavitakkaṃ nādhivāsetī’’ tiādinā ( ma. ni. 1.26; a. ni. 4.114;6.58) nayena āgato, ayaṃ vīriyasaṃvaro nāma.

AI Translation based on Nissaya

And that which comes by the method beginning with 'one does not tolerate an arisen thought of sensual pleasure' (ma. ni. 1.26; a. ni. 4.114; 6.58), this is called restraint by energy.

Vietnamese AI Translation

Và điều được đề cập theo phương pháp bắt đầu bằng 'vị ấy không dung thứ một ý nghĩ dục lạc đã khởi lên' (ma. ni. 1.26; a. ni. 4.114; 6.58), đây được gọi là sự thu thúc bằng tinh tấn.

AI Translation Nissaya

uppannaṃ=that has arisen. ; kāmavitakkaṃ=a thought of sensual pleasure. ; nādhivāseti=one does not tolerate. ; itiādinā=by this beginning. ; nayena(in the Pātheyya Vagga, Saṅgīti Sutta; Mūlapaṇṇāsa, Sabbāsava Sutta; Dasaka Aṅguttara, Girimānanda Sutta). ; āgato=which has come. ; yo ca ayaṃ saṃvaro=that restraint also. ; atthi=is. ; ayaṃ=This. ; vīriya saṃvaronāma=is called restraint by energy. ;

Myanmar Nissaya

uppannaṃ=ဖြစ်သော။ ; kāmavitakkaṃ=ကို။ ; nādhivāseti=သည်းမခံနိုင်။ ; itiādinā=သော။ ; nayena=ဖြင့်။ ; āgato=(ပါထေယျဝဂ်၊ သင်္ဂီတိသုတ်။ မူလပဏ္ဏာသ၊ သဗ္ဗာသဝသုတ်။ ဒသအင်္ဂုတ္တိုရ်၊ ဂိရိမာနန္ဒနန္ဒသုတ်တို့၌) လာသော။ ; yocāyaṃ yo ca ayaṃ saṃvaro=သည်လည်း။ ; atthi=၏။ ; ayaṃ=သည်။ ; vīriya saṃvaronāma=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3979 | Chunk: 67

Ājīvapārisuddhipi [P1.219] ettheva samodhānaṃ gacchati.

AI Translation based on Nissaya

The purity of livelihood [P1.219] is also included right here.

Vietnamese AI Translation

Sự thanh tịnh về mạng [P1.219] cũng được bao gồm ngay tại đây.

AI Translation Nissaya

ājīvapārisuddhipi=The purity of livelihood also. ; ettheva=in this very restraint by energy. ; samodhānaṃ=to combination. ; gacchati=goes. ;

Myanmar Nissaya

ājīvapārisuddhipi=အာဇီဝပါရိသုဒ္ဓိသည်လည်း။ ; ettheva=ဤဝီရိယသံဝရ ၌ သာလျှင်။ ; samodhānaṃ=ပေါင်းခြင်းသို့။ ; gacchati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3980 | Chunk: 67

Iti ayaṃ pañcavidhopi saṃvaro, yā ca pāpabhīrukānaṃ kulaputtānaṃ sampattavatthuto virati, sabbametaṃ saṃvarasīlanti veditabbaṃ.

AI Translation based on Nissaya

Thus, it should be understood that this fivefold restraint, and whatever abstinence from an encountered object there is for clansmen who are fearful of evil, all this is virtue of restraint.

Vietnamese AI Translation

Do đó, nên hiểu rằng năm loại thu thúc này, và bất kỳ sự kiêng cữ nào đối với một đối tượng gặp phải đối với những người con trong gia tộc có lòng sợ hãi điều ác, tất cả điều này là giới thu thúc.

AI Translation Nissaya

iti=Thus. ; ayaṃ saṃvaro=this restraint. ; pañcavidhopi=is fivefold. ; hoti=is. ; pāpabhīrukānaṃ=of those who are fearful of evil. ; kulaputtānaṃ=of clansmen of good birth and good conduct. ; sampattavatthuto=from an object that has been encountered. ; yā ca virati=whatever abstinence. ; atthi=there is. ; etaṃ sabbaṃ=all this abstinence also. ; saṃvarasīlaṃ=is called virtue of restraint. ; iti=Thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

iti=သို့။ ; ayaṃ saṃvaro=သည်။ ; pañcavidhopi=ရှိသည်လည်း။ ; hoti=၏။ ; pāpabhīrukānaṃ=မကောင်းမှုမှ ကြောက်တတ်ကုန်သော။ ; kulaputtānaṃ=ဇာတိကုလပုတ္တ၊ အာစာရကုလပုတ္တတို့အား။ ; sampattavatthuto=ရောက်လာသော ဝတ္ထုမှ။ ; yā ca virati=အကြင်ရှောင် ကြဉ်ခြင်းသည်လည်း။ ; atthi=၏။ ; etaṃ sabbaṃ=ဤဥဿုံသော ကြဉ်ခြင်း သည်လည်း။ ; saṃvarasīlaṃ=မည်၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3981 | Chunk: 67

Avītikkamo sīlan ti samādinnasīlassa kāyikavācasiko avītikkamo.

AI Translation based on Nissaya

Non-transgression as virtue is the bodily and verbal non-transgression of a person who has undertaken the precepts.

Vietnamese AI Translation

Sự không vi phạm như là giới là sự không vi phạm về thân và khẩu của một người đã thọ trì các học giới.

AI Translation Nissaya

avītikkamo sīlanti=As for 'non-transgression as virtue'. ; samādinnasīlassa=of a person who has undertaken the precepts. ; kāyikavāca siko=occurring in body and speech. ; avītikkamo=it is the non-transgression. ;

Myanmar Nissaya

avītikkamo sīlanti=ကား။ ; samādinnasīlassa=ဆောက်တည်အပ်သော သီလရှိသော ပုဂ္ဂိုလ်၏။ ; kāyikavāca siko=ကိုယ်နှုတ်၌ဖြစ်သော။ ; avītikkamo=မလွန်ကျူးခြင်းတည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3982 | Chunk: 67

Idaṃ tāva kiṃ sīlan ti pañhassa vissajjanaṃ.

AI Translation based on Nissaya

This, firstly, is the answer to the question, 'What is virtue?'

Vietnamese AI Translation

Đây, trước hết, là câu trả lời cho câu hỏi, 'Giới là gì?'

AI Translation Nissaya

idaṃ=This which has been said. ; tāva=firstly. ; kiṃ sīlanti pañhassa=of the question 'What is virtue?'. ; vissajjanaṃ=is the answer. ;

Myanmar Nissaya

idaṃ=ဤဆိုအပ်ခဲ့ပြီး သည်ကား။ ; tāva=လက်မွန်။ ; kiṃ sīlantipañhassa=ကိံ သီလံဟူသော ပြဿနာ၏။ ; vissajjanaṃ=အဖြေတည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3983 | Chunk: 67

Kati sīlānīti pañhassa vissajjane kusalasīlaṃ akusalasīlaṃ abyākatasīlan ti ettha yasmā loke tesaṃ tesaṃ sattānaṃ pakati sīlanti vuccati, yaṃ sandhāya ‘‘ayaṃ sukhasīlo, ayaṃ dukkhasīlo, ayaṃ kalahasīlo, ayaṃ maṇḍanasīlo’’ ti bhaṇanti.

AI Translation based on Nissaya

In the answer to the question, 'How many are the virtues?', in the statement 'wholesome virtue, unwholesome virtue, indeterminate virtue,' because in the world the nature or habit of various beings is called 'virtue'—referring to which they say, 'This one is of a pleasant disposition,' 'This one is of a miserable disposition,' 'This one is of a quarrelsome disposition,' 'This one is of an ornamental disposition.'

Vietnamese AI Translation

Trong câu trả lời cho câu hỏi, 'Giới có bao nhiêu?', trong câu nói 'giới thiện, giới bất thiện, giới vô ký,' bởi vì trên thế gian, bản chất hay thói quen của các chúng sanh khác nhau được gọi là 'giới'—mà khi đề cập đến, người ta nói: 'Người này có tánh nết dễ chịu,' 'Người này có tánh nết khổ sở,' 'Người này có tánh nết hay gây gổ,' 'Người này có tánh nết thích trang sức.'

AI Translation Nissaya

katisīlānītipañhassa=Of the question 'How many virtues are there?'. ; vissajjane=in the answer. ; vā=or, in answering. ; kusalasīlaṃ akusalasīlaṃ abyākatasīlantiettha=in this statement 'wholesome virtue, unwholesome virtue, indeterminate virtue'. ; yasmā=because. ; loke=in the world. ; tesaṃ tesaṃ sattānaṃ=of those various beings. ; pakati=the nature. ; vā=or habit. ; sīlanti=as 'virtue'. ; vuccati=is said. ; ayaṃ=this nature or habit. ; sandhāya=referring to. ; ayaṃ=this person. ; sukhasīlo=has a pleasant nature. ; vā=or has a pleasant habit. ; ayaṃ=this person. ; dukkhasīlo=has a nature prone to suffering. ; ayaṃ=this person. ; kalahasīlo=has a quarrelsome habit. ; vā=or has a habit of being hostile. ; ayaṃ=this person. ; maṇḍanasīlo=has a habit of adorning oneself. ; iti=thus. ; bhaṇanti=they say. ;

Myanmar Nissaya

katisīlānītipañhassa=ဟူသော ပြဿနာ၏။ ; vissajjane=အဖြေ၌။ ; vā=ဖြေရာဖြစ်သော။ ; kusalasīlaṃ akusalasīlaṃ abyākatasīlantiettha=သီလံဟူသော ဤစကား၌။ ; yasmā=ကြောင့်။ ; loke=ရွာ၌။ ; tesaṃ tesaṃ sattānaṃ=ထိုထိုသတ္တဝါခပဲတို့၏။ ; pakati=သဘောကို။ ; vā=အလေ့ကို။ ; sīlanti=ဟူ၍။ ; vuccati=၏။ ; ayaṃ=ဤသဘောအလေ့ကို။ ; sandhāya=ရည်၍။ ; ayaṃ=ဤသူသည်။ ; sukhasīlo=ချမ်းသာသော သဘောရှိ၏။ ; vā=ချမ်းသောသော အလေ့ရှိ၏။ ; ayaṃ=ဤသူသည်။ ; dukkhasīlo=ဆင်းရဲတတ်သော သဘောရှိ၏။ ; ayaṃ=ဤသူသည်။ ; kalahasīlo=ငြင်းခုံသော အလေ့ရှိ၏။ ; vā=ရန်မူတတ်သော အလေ့ရှိ၏။ ; ayaṃ=ဤသူသည်။ ; maṇḍanasīlo=တန်ဆာဆင်တတ်သော အလေ့ရှိ၏။ ; iti=သို့။ ; bhaṇanti=ပြောဆိုကြကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3984 | Chunk: 67

Tasmā tena pariyāyena atthuddhāravasena akusalasīlamapi sīlanti vuttaṃ.

AI Translation based on Nissaya

Therefore, by that figurative sense, by way of extracting the meaning, even unwholesome virtue is called 'virtue'.

Vietnamese AI Translation

Do đó, theo nghĩa bóng đó, bằng cách rút ra ý nghĩa, ngay cả giới bất thiện cũng được gọi là 'giới'.

AI Translation Nissaya

tasmā=Therefore. ; pana=indeed. ; taṃ=that unwholesome virtue and indeterminate virtue. ; sutvāna saṃvarepaññāti=by 'Having heard, one restrains with wisdom'. ; vacanato=because of the statement. ; tena pariyoyena=by that reason. ; atthuddhāravasena=by way of extracting the meaning of the word 'sīla'. ; akusalasīlamapi=unwholesome virtue also. ; sīlanti=as 'virtue'. ; vuttaṃ=is stated. ;

Myanmar Nissaya

tasmā=ကြောင့်။ ; pana=စင်စစ်သော်ကား။ ; taṃ=ထိုအကုသလသီလ အဗျာကတသီလသည်။ ; sutvāna saṃvarepaññāti=ဟူ၍။ ; vacanato=ကြောင့်။ ; tena pariyoyena=ထိုအကြောင်းဖြင့်။ ; atthuddhāravasena=သီလ သဒ္ဒါ၏ အနက်ကို ထုတ်သည်၏ အစွမ်းဖြင့်။ ; akusalasīlamapi=အကုသိုလ်သီလကိုလည်း‌။ ; sīlanti=ဟူ၍။ ; vuttaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3985 | Chunk: 67

Taṃ pana ‘‘sutvāna saṃvare paññā’’ ti ( paṭi. ma. 1.37) vacanato idhādhippetasīlaṃ na hotīti.

AI Translation based on Nissaya

But it should be known that because of the statement, 'Having heard, one restrains with wisdom' (paṭi. ma. 1.37), this is not the virtue intended here.

Vietnamese AI Translation

Nhưng nên biết rằng vì câu nói, 'Sau khi nghe, vị ấy thu thúc bằng trí tuệ' (paṭi. ma. 1.37), đây không phải là giới được nói đến ở đây.

AI Translation Nissaya

pana=But indeed. ; taṃ=that unwholesome virtue and indeterminate virtue. ; sutvāna saṃvare paññāti=as in 'Having heard, one restrains with wisdom'. ; vacanato=because of the statement. ; idha=here in [the context of] knowledge arising from virtue. ; adhippetasīlaṃ=the intended virtue. ; na hoti=it is not. ; iti=Thus. ; veditabbaṃ=it should be known. ;

Myanmar Nissaya

pana=စင်စစ်သော်ကား။ ; taṃ=ထိုအကုသလသီလ အဗျာကတသီလသည်။ ; sutvāna saṃvare paññāti=ဟူ၍။ ; vacanato=ခြင်းကြောင့်။ ; idha=ဤသီလမယဉာဏ်၌။ ; adhippetasīlaṃ=အလိုရှိအပ်သော သီလသည်။ ; na hoti=မဖြစ်။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3986 | Chunk: 67

Yasmā [M1.203 V1.186] pana cetanādibhedassa sīlassa sampayuttacittaṃ samuṭṭhānaṃ, tasmā kusalacittasamuṭṭhānaṃ kusalasīlan tiādimāha.

AI Translation based on Nissaya

Now, [M1.203 V1.186] because the associated mind is the origin of virtue, which is differentiated as volition and so on, he therefore said, 'Wholesome virtue has a wholesome mind as its origin,' and so on.

Vietnamese AI Translation

Bây giờ, [M1.203 V1.186] bởi vì tâm tương ưng là nguồn gốc của giới, mà giới được phân biệt là tư, v.v., do đó ngài đã nói, 'Giới thiện có tâm thiện làm nguồn gốc,' và v.v.

AI Translation Nissaya

pana=Now, to speak of virtue by way of origin. ; yasmā=Because. ; cetanādibhedassa=which is distinguished by volition, etc.. ; sīlassa=of virtue. ; sampayuttacittaṃ=the associated mind with volition and abstinence. ; samuṭṭhānaṃ=is the cause of arising. ; tasmā=Therefore. ; kusalacittasamuṭṭhānaṃ kusalasīlantiādiṃ='Wholesome virtue has a wholesome mind as its origin', etc.. ; āha=was said. ;

Myanmar Nissaya

pana=သမုဋ္ဌာန သီလကို ဆိုအံ့။ ; yasmā=ကြောင့်။ ; cetanādibhedassa=စေတနာ အစရှိသော အားဖြင့် ပြားသော။ ; sīlassa=၏။ ; sampayuttacittaṃ=စေတနာဝီရတီတို့နှင့် ယှဉ်သော စိတ်သည်။ ; samuṭṭhānaṃ=ဖြစ်ကြောင်းတည်း။ ; tasmā=ကြောင့်။ ; kusalacittasamuṭṭhānaṃ kusalasīlantiādiṃ=ကို။ ; āha=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3987 | Chunk: 67

Saṃvarasamodhānaṃ sīlan ti saṃvarasampayuttakhandhā.

AI Translation based on Nissaya

Virtue as the combination of restraint means the aggregates associated with restraint.

Vietnamese AI Translation

Giới như là sự kết hợp của thu thúc có nghĩa là các uẩn tương ưng với thu thúc.

AI Translation Nissaya

saṃvarasamodhānaṃ sīlanti=As for 'virtue as the combination of restraint'. ; saṃvarasampayuttakhandhā=it is the aggregates associated with the five kinds of restraint. ;

Myanmar Nissaya

saṃvarasamodhānaṃ sīlanti=ကား။ ; saṃvarasampayuttakhandhā=သံဝရ ငါးပါးတို့နှင့်ယှဉ်သော ခန္ဓာတို့တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3988 | Chunk: 67

Te hi saṃvarena samāgatā missībhūtāti saṃvarasamodhānanti vuttā.

AI Translation based on Nissaya

Indeed, they are called 'combination of restraint' because they have come together and are blended with restraint.

Vietnamese AI Translation

Thật vậy, chúng được gọi là 'sự kết hợp của thu thúc' bởi vì chúng đã cùng nhau sanh khởi và hòa trộn với thu thúc.

AI Translation Nissaya

hi saccaṃ=Truly. ; te=those aggregates associated with the five restraints. ; vā=or. ; saṃvarena=with the five restraints. ; samāgatā missībhūtā=having come together, they are blended. ; iti tasmā=Therefore. ; saṃvarasamodhānanti=as 'combination of restraint'. ; vuttā=they are called. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; te=ထိုသံဝရငါးပါးတို့နှင့် ယှဉ်သော ခန္ဓာတို့သည်။ ; vā=တို့ကို။ ; saṃvarena=သံဝရငါးပါးနှင့်။ ; samāgatā missībhūtā=ရောနှောသည်ဖြစ်၍ ဖြစ်ကုန်၏။ ; iti tasmā=ကြောင့်။ ; saṃvarasamodhānanti=ဟူ၍။ ; vuttā=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3989 | Chunk: 67

Evaṃ avītikkamasamodhānaṃ sīlampi veditabbaṃ.

AI Translation based on Nissaya

In the same way, virtue as the combination of non-transgression should also be understood.

Vietnamese AI Translation

Tương tự như vậy, giới như là sự kết hợp của sự không vi phạm cũng nên được hiểu như thế.

AI Translation Nissaya

evaṃ=In the same way. ; avītikkamasamodhānaṃ sīlampi=virtue as the combination of non-transgression also. ; veditabbaṃ=should be understood. ;

Myanmar Nissaya

evaṃ=ဤအတူ။ ; avītikkamasamodhānaṃ sīlampi=အဝီတိက္ကမသမောဓာနသီလကိုလည်း။ ; veditabbaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3990 | Chunk: 67

Tathābhāve jātacetanā samodhānaṃ sīlan ti saṃvarabhāve avītikkamabhāve jātacetanāsampayuttā khandhā.

AI Translation based on Nissaya

Virtue as the combination of volition arisen in that state means the aggregates associated with the volition that has arisen in the state of restraint or in the state of non-transgression.

Vietnamese AI Translation

Giới như là sự kết hợp của tư sanh khởi trong trạng thái đó có nghĩa là các uẩn tương ưng với tư đã sanh khởi trong trạng thái thu thúc hoặc trong trạng thái không vi phạm.

AI Translation Nissaya

tathābhāvejātacetanā samodhānaṃ sīlanti=As for 'virtue as the combination of volition arisen in that state'. ; saṃvarabhāve=in the state of restraint. ; vā=or in the nature of restraint. ; avītikkamabhāve=in the state of non-transgression. ; jātacetanāsampayuttā=associated with volition that has arisen. ; khandhā=it is the aggregates. ;

Myanmar Nissaya

tathābhāvejātacetanā samodhānaṃ sīlanti=ကား။ ; saṃvarabhāve=သံဝရ၏ အဖြစ်၌။ ; vā=သံဝရ၏ သဘော၌။ ; avītikkamabhāve=အဝီတိက္ကမ၏ အဖြစ်၌။ ; jātacetanāsampayuttā=ဖြစ်သော စေတနာနှင့် ယှဉ်ကုန်သော။ ; khandhā=တို့တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3991 | Chunk: 67

Yasmā ca tīsupi cetesu taṃsampayuttā dhammā adhippetā, tasmā cetanāsamodhānena cetasikānampi saṅgahitattā cetasikasamodhānasīlaṃ visuṃ na niddiṭṭhanti veditabbaṃ.

AI Translation based on Nissaya

And it should be understood that because in all three of these the associated states are intended, virtue as the combination of mental factors was not pointed out separately, since it is included by virtue as the combination of volition.

Vietnamese AI Translation

Và nên hiểu rằng vì trong cả ba trường hợp này, các trạng thái tương ưng đều được nhắm đến, nên giới như là sự kết hợp của các tâm sở đã không được chỉ ra một cách riêng biệt, vì nó được bao gồm bởi giới như là sự kết hợp của tư.

AI Translation Nissaya

ca=To state a special point. ; yasmā=Because. ; tīsupi=in all three. ; etesu=of those: virtue as the combination of restraint, virtue as the combination of non-transgression, and virtue as the combination of volition. ; taṃsampayuttā=associated with that restraint and non-transgression. ; dhammā

=the states. ; adhippetā=are intended. ; tasmā=Therefore. ; cetanāsamodhānena=by virtue as the combination of volition. ; cetasikānampi=the mental virtues called restraint and non-transgression also. ; saṅgahitattā=because of being included. ; cetasikasamādhānasīlaṃ=virtue as the combination of mental factors. ; visuṃ=separately. ; dhammasenāpatittherena=by the Elder, the General of the Dhamma. ; naniddiṭṭhaṃ=was not pointed out. ; iti=Thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

ca=အထူးကို ဆိုအံ့။ ; yasmā=ကြောင့်။ ; tīsupi=ကုန်သော။ ; etesu=ထိုသံဝရသမောဓာနသီလ - ဝီတိက္ကမသမောဓာနသီလ စေတနာသမော ဓာနသီလတို့၌။ ; taṃsampayuttā=ထိုသံဝရဝီတိက္ကမတို့နှင့် ယှဉ်ကနု်သော။ ; dhammā=တို့ကို။ ; adhippetā=ကုန်၏။ ; tasmā=ကြောင့်။‌‌ ; cetanāsamodhānena=စေတနာ သမာဓာနသီလဖြင့်။ ; cetasikānampi=သံဝရအဝီ တိက္ကမဟုဆိုအပ်သော စေတသိကသီလတို့ကိုလည်း။ ; aṅgahitattā=ကြောင့်။ ; cetasikasamādhānasīlaṃ=ကို။ ; visuṃ=အသီး။ ; dhammasenāpatittherena=သည်။ ; naniddiṭṭhaṃ=ပြတော်မမူအပ်။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3992 | Chunk: 67

Heṭṭhā cetanādayo dhammā ‘‘sīlan’’ ti vuttā.

AI Translation based on Nissaya

Previously, the states beginning with volition were called 'virtue'.

Vietnamese AI Translation

Trước đây, các trạng thái bắt đầu bằng tư được gọi là 'giới'.

AI Translation Nissaya

heṭṭhā=Below, in the exposition of 'What is virtue?'. ; cetanādayo=volition and so on. ; vā=or, the states called volition, mental factor, restraint, and non-transgression. ; dhammā=the states. ; sīlanti=as 'virtue'. ; vuttā=were spoken of. ;

Myanmar Nissaya

heṭṭhā=အောက်ဖြစ်သော ကိံ သီလံ ဟူသော နိဒ္ဒေသ၌။ ; cetanādayo=ကုန်သော။ ; vā=စေတနာ စေတသိက အသံဝရအဝီတိက္ကမဟု ဆိုအပ်ကုန်သော။ ; dhammā=တို့ကို။ ; sīlanti=ဟူ၍။ ; vuttā=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3993 | Chunk: 67

Na kevalaṃ te eva sīlaṃ, taṃsampayuttā dhammāpi sīlamevāti dassanatthaṃ ayaṃ tiko vuttoti veditabbo.

AI Translation based on Nissaya

It should be known that this triad was stated to show that not only are those states themselves virtue, but the states associated with them are also virtue.

Vietnamese AI Translation

Nên biết rằng bộ ba này đã được nêu ra để cho thấy rằng không chỉ bản thân các trạng thái đó là giới, mà các trạng thái tương ưng với chúng cũng là giới.

AI Translation Nissaya

kevalaṃ=Merely. ; teeva=those very states of volition, mental factor, restraint, and non-transgression spoken of below. ; sīlaṃ=are called virtue. ; na=not. ; taṃ sampayuttā=associated with those states of volition, mental factor, restraint, and non-transgression. ; dhammāpi=the states also. ; sīlameva=are indeed called virtue. ; iti imassa atthassa=this meaning. ; dassanatthaṃ=in order to show. ; ayaṃ tiko=this triad of combinations. ; vutto=was stated. ; iti=Thus. ; veditabbo=it should be known. ;

Myanmar Nissaya

kevalaṃ=သက်သက်။ ; teeva=ထိုအောက်၌ ဟောအပ်ကုန်သော စေတနာစေတသိက သံဝရ အဝီတိက္ကမတို့သည်သာလျှင်။ ; sīlaṃ=သီလမည်သည်။ ; na=မဟုတ်သေး။ ; taṃ sampayuttā=ထိုစေတနာ စေတသိက သံဝရအဝီတိက္ကမတို့နှင့် ယှဉ်ကုန်သော။ ; dhammāpi=တို့သည်လည်း။ ; sīlameva=သီလမည်သည်သာလျှင်။ ; itiimassaatthassa=ကို။ ; dassanatthaṃ=ပြခြင်းငှါ။ ; ayaṃ tiko=ဤသမောဓာနတိက်ကို။ ; vutto=၏။ ; iti=သို့။ ; veditabbo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3994 | Chunk: 67

40. Idāni yasmā cetanācetasikā saṃvarāvītikkamāyeva honti na visuṃ, tasmā saṃvarāvītikkameyeva yāva arahattamaggā sādhāraṇakkamena yojento pāṇātipātaṃ saṃvaraṭṭhena sīlaṃ , avītikkamaṭṭhena sīlan tiādimāha.

AI Translation based on Nissaya

40. Now, because the virtues of volition and mental factors are just restraint and non-transgression and not something separate, the General of the Dhamma, applying only restraint and non-transgression in a common sequence up to the path of Arahantship, said, 'From killing living beings... is virtue in the sense of restraint, virtue in the sense of non-transgression,' and so on.

Vietnamese AI Translation

40. Bây giờ, vì giới của tư và tâm sở chỉ là sự thu thúc và sự không vi phạm chứ không phải là một cái gì đó riêng biệt, nên Pháp Tướng, chỉ áp dụng sự thu thúc và sự không vi phạm trong một trình tự chung cho đến đạo A-la-hán, đã nói: 'Từ việc sát sanh... là giới theo nghĩa thu thúc, giới theo nghĩa không vi phạm,' và v.v.

AI Translation Nissaya

idāni=Now. ; yasmā=because. ; cetanā cetasikā=the virtues of volition and mental factors. ; saṃvarāvītikkamāyeva=are simply the virtues of restraint and non-transgression. ; honti=they are. ; visuṃ=separate from restraint and non-transgression. ; na honti=they are not. ; tasmā=Therefore. ; saṃvarāvītikkameyeva=only the virtues of restraint and non-transgression. ; yāva arahattamaggā=up to the path of Arahantship. ; sādhāraṇakkamena=by a common method. ; yojento=wishing to apply. ; dhammasenāpati=the General of the Dhamma. ; pāṇātipātaṃ.la. sīlantiādiṃ='Killing living beings... virtue,' etc.. ; āha=said. ;

Myanmar Nissaya

idāni=၌။ ; yasmā=ကြောင့်။ ; cetanā cetasikā=စေတနာ စေတသိက သီလတို့သည်။ ; saṃvarāvītikkamāyeva=သံဝရသီလ အဝီတိက္ကမသီလတို့သည်သာလျှင်။ ; honti=ကုန်၏။ ; visuṃ=သံဝရ အဝီတိက္ကမတို့မှ အသီးအခြားသည်။ ; na honti=ကုန်။ ; tasmā=ကြောင့်။ ; saṃvarāvītikkameyeva=သံဝရသီလ အဝီတိက္ကမသီလတို့ကိုသာလျှင်။ ; yāva arahattamaggā=အရဟတ္တမဂ်တိုင်အောင်။ ; sādhāraṇakkamena=ဆက်ဆံသော အစဉ်ဖြင့်။ ; yojento=ယှဉ်တော် မူလိုသော။ ; dhammasenāpati=သည်။ ; pāṇātipātaṃ.la. sīlantiādiṃ=ကို။ ; āha=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3995 | Chunk: 67

Pāṇātipātā veramaṇiādayo hi yasmā attano attano paccanīkaṃ saṃvaranti, taṃ na vītikkamanti ca, tasmā saṃvaraṇato avītikkamanato ca saṃvaraṭṭhena sīlaṃ avītikkamaṭṭhena sīlaṃ nāma hoti.

AI Translation based on Nissaya

Indeed, because abstinence from killing living beings and so on both restrains and does not transgress its respective opposite, therefore, by way of restraining and not transgressing, it is called virtue in the sense of restraint and virtue in the sense of non-transgression.

Vietnamese AI Translation

Thật vậy, vì sự kiêng cữ sát sanh v.v. vừa thu thúc vừa không vi phạm đối tượng tương ứng của nó, do đó, theo phương diện thu thúc và không vi phạm, nó được gọi là giới theo nghĩa thu thúc và giới theo nghĩa không vi phạm.

AI Translation Nissaya

hi saccaṃ=Truly. ; pāṇātipātā=from the swift destruction of the life faculty. ; veramaṇiādayo=abstinence and so on. ; yasmā=because. ; attano attano=of one's own, that is, of volition and abstinence. ; =the opposite, which is killing, etc.. ; saṃvaranti=they both guard and restrain. ; taṃ=that opposite, which is killing, etc.. ; navītikkamantica=and they do not transgress. ; tasmā=Therefore. ; saṃvaraṇato=by way of restraining. ; avītikkamatoca=and by way of not transgressing. ; saṃvaraṭṭhena=due to the meaning or quality of restraining. ; sīlaṃnāma=it is called virtue. ; hoti=is. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; pāṇātipāto=ဇီဝိတိန္ဒြေကို လျင်စွာ ချခြင်းမှ။ ; veramaṇiādayo=ကြဉ်ခြင်း အစရှိသည်တို့သည်။ ; yasmā=ကြောင့်။ ; attano attano=မိမိ မိမိဟု ဆိုအပ်သော စေတနာဝိရတီ၏။ ; paccanīkaṃ=ဆန့်ကျင်ဘက် ဖြစ်သော ပါဏာတိပါတအစရှိသည်ကို။ ; saṃvaranti=စောင့်လည်းစောင့်ရှောက်ကုန်၏။ ; taṃ=ထိုဆန့်ကျင်ဘက်ဖြစ်သော ပါဏာတိပါတအစရှိသည်ကို။ ; navītikkamantica=လွန်လည်းမလွန်ကျူး၍။ ; tasmā=ကြောင့်။ ; saṃvaraṇato=စောင့်ရှောက်သောအားဖြင့် လည်းကောင်း။ ; avītikkamatoca=မလွန်ကျူးသော အားဖြင့်လည်းကောင်း။ ; saṃvaraṭṭhena=စောင့်ရှောက်ခြင်းတည်းဟူသော အနက်သဘော သတ္တိကြောင့်။ ; sīlaṃnāma=သီလမည်သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3996 | Chunk: 67

Tattha pāṇātipātaṃ saṃvaraṭṭhenāti pāṇātipātassa pidahanaṭṭhena sīlaṃ.

AI Translation based on Nissaya

Therein, by restraining from killing means virtue in the sense of obstructing it.

Vietnamese AI Translation

Trong đó, bằng cách thu thúc khỏi việc sát sanh có nghĩa là giới theo nghĩa ngăn chặn nó.

AI Translation Nissaya

tattha=Therein, in the passage beginning with 'pāṇātipātaṃ'. ; pāṇātipātaṃ saṃvaraṭṭhenāti=the phrase 'in the sense of restraining from killing'. ; pāṇāti pātassa=the unwholesome volition of killing. ; pidahanaṭṭhena=because of the meaning of obstructing. ; sīlaṃ=it is called virtue. ;

Myanmar Nissaya

tattha=ထိုပါဏာတိပါတံ အစရှိသော ပါဌ်၌။ ; pāṇātipātaṃ saṃvaraṭṭhenāti=ကား။ ; pāṇāti pātassa=ပါဏာတိပါတအကုသိုလ်စေတနာကို။ ; pidaenaṭṭhena=ပိတ်ပင်တတ်သော အနက်ကြောင့်။ ; sīlaṃ=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3997 | Chunk: 67

Kiṃ taṃ ?

AI Translation based on Nissaya

What is that?

Vietnamese AI Translation

Cái đó là gì?

AI Translation Nissaya

taṃ=That virtue which obstructs. ; kiṃ=what is it?. ;

Myanmar Nissaya

taṃ=ထိုပိတ်ပင်တတ်သော သီလဟူသည်။ ; kiṃ=နည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3998 | Chunk: 67

Pāṇātipātā veramaṇī.

AI Translation based on Nissaya

Abstinence from killing living beings.

Vietnamese AI Translation

Sự kiêng cữ sát sanh.

AI Translation Nissaya

pāṇātipātā=from the volition of killing. ; veramaṇī=it is the volition and state of abstinence which is the cause of refraining. ;

Myanmar Nissaya

pāṇātipātā=ပါဏာတိပါတစေတနာမှ။ ; veramaṇī=ကြဉ်ကြောင်းဖြစ်သော စေတနာတရား ဝိရတီတရားတည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 3999 | Chunk: 67

Sā ca taṃ saṃvarantīyeva taṃ na vītikkamatīti avītikkamaṭṭhena sīlaṃ.

AI Translation based on Nissaya

And since it restrains it, it does not transgress it; therefore it is virtue in the sense of non-transgression.

Vietnamese AI Translation

Và vì nó thu thúc nó, nó không vi phạm nó; do đó nó là giới theo nghĩa không vi phạm.

AI Translation Nissaya

sāca=And that state of volition and abstinence. ; taṃ=killing. ; saṃvarantiyeva=only restrains. ; hoti=it is. ; taṃ=that killing. ; navītikkamati=it does not transgress. ; ititasmā=Therefore. ; avītikkamaṭṭhena sīlaṃ=it is called virtue in the sense of non-transgression. ;

Myanmar Nissaya

sāca=ထိုစေတနာ တရား ဝိရတီ တရားသည်လည်း။ ; taṃ=ပါဏာတိပါတကို။ ; saṃvarantiyeva=စောင့်ရှောက်တတ်သည်သာလျှင်။ ; hoti=၏။ ; taṃ=ထိုပါဏာတိပါတကို။ ; navītikkamati=မလွန်ကျူးတတ်။ ; ititasmā=ကြောင့်။ ; avītikkamaṭṭhenasīlaṃ=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4000 | Chunk: 67

Evameva adinnādānā veramaṇi ādayo anabhijjhāabyāpādasammādiṭṭhiyo yojetabbā.

AI Translation based on Nissaya

In the very same way, abstinence from taking what is not given and so on, and non-covetousness, non-ill will, and right view should be applied.

Vietnamese AI Translation

Theo cùng một cách, sự kiêng cữ lấy của không cho v.v., và vô tham, vô sân, và chánh kiến nên được áp dụng.

AI Translation Nissaya

evameva=Just so. ; adinnādānā=from taking what is not given. ; veramaṇi ādayo=abstinence and so on. ; anabhijjā abyāpādasammādiṭṭhiyo=and non-covetousness, non-ill will, and right view. ; yojetabbā=should be applied. ;

Myanmar Nissaya

evameva=လျှင်။ ; adinnādānā=ခိုးယူခြင်းမှ။ ; veramaṇi ādayo=ကြဉ်ကြောင်းဖြစ်သော ဝိရတီအစရှိသည်တို့ကို လည်းကောင်း။ ; anabhijjā abyāpādasammādiṭṭhiyo=အနဘိဇ္ဈာ အဗျာပါဒ သမ္မာဒိဋ္ဌိတို့ကို လည်းကောင်း။ ; yojetabbā=ယှဉ်စေအပ်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4001 | Chunk: 67

Pāṇātipātan tiādīsu [P1.220] pana dasasu akusalakammapathesu pāṇassa atipāto pāṇātipāto.

AI Translation based on Nissaya

In the sections beginning with **killing living beings** [P1.220], among the ten unwholesome paths of action, **killing a living being** is the destruction of a living being's life.

Vietnamese AI Translation

Trong các đoạn bắt đầu bằng **sát sanh** [P1.220], trong mười nghiệp đạo bất thiện, **sát sanh** là sự hủy diệt mạng sống của một chúng sanh.

AI Translation Nissaya

pana=Now, to explain the components apart from the collective meaning. ; pāṇātipātantiādīsu=In the ten. ; dasasu=ten. ; akusalakammapathesu=unwholesome paths of action beginning with 'pāṇātipāta'. ; (attho=the meaning. ; evaṃ=in the following way. ; veditabbo=should be understood.). ; pāṇassa=of a living being's life faculty. ; atipāto=is the excessive destruction. ; pāṇātipāto=killing a living being. ;

Myanmar Nissaya

pana=ပိဏ္ဍတ္ထမှ တပါး အဝယဝဋ္ဌကို ဆိုအံ့။ ; pāṇātipātantiādīsu=ကုန်သော။ ; dasasu=ကုန်သော။ ; akusalakammapathesu=တို့၌။ ; (attho=ကို။ ; evaṃ=ဤသို့ ဆိုလတ္တံ့သော နည်းဖြင့်။ ; veditabbo=၏။) ; pāṇassa=သတ္တဝါဇီဝိတိန္ဒြေကို။ ; atipāto=လွန်စွာချခြင်းတည်း။ ; pāṇātipāto=ခြင်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4002 | Chunk: 67

Pāṇavadho pāṇaghātoti vuttaṃ hoti.

AI Translation based on Nissaya

It is said to be the slaughter of a living being, the slaying of a living being.

Vietnamese AI Translation

Nó được nói là sự tàn sát một chúng sanh, sự giết hại một chúng sanh.

AI Translation Nissaya

pāṇavadho=Killing a living being. ; pāṇaghāto=slaying a living being. ; iti=thus. ; vuttaṃ vutto=is said. ; hoti=to be. ;

Myanmar Nissaya

pāṇavadho=သတ္တဝါသတ်ခြင်း။ ; pāṇaghāto=သတ္တဝါကို သတ်ခြင်း။ ; iti=သို့။ ; vuttaṃ vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4003 | Chunk: 67

Pāṇoti cettha vohārato satto, paramatthato jīvitindriyaṃ.

AI Translation based on Nissaya

And here, living being (pāṇa) is conventionally a being, but in the ultimate sense, it is the life faculty.

Vietnamese AI Translation

Và ở đây, chúng sanh (pāṇa) theo quy ước là một sinh vật, nhưng theo nghĩa rốt ráo, nó là mạng căn.

AI Translation Nissaya

ca=To state a special point. ; ettha=here in this term 'pāṇātipāta'. ; pāṇoti=the word 'pāṇa'. ; vohārato=by way of convention. ; satto=is a being. ; paramatthato=by way of ultimate reality. ; jīvitindriyaṃ=it is the two, the physical life faculty and the mental life faculty. ;

Myanmar Nissaya

ca=ဆိုဖွယ်အထူးကို ဆိုအံ့။ ; ettha=ဤပါဏာတိ ပါတောဟူသော ပုဒ်၌။ ; pāṇoti=ကား။ ; vohārato=ဝေါဟာရအားဖြင့်။ ; satto=သတ္တဝါတည်း။ ; paramatthato=ပရမတ္ထအားဖြင့်။ ; jīvitindriyaṃ=ရုပ်ဇီဝိတ နာမ်ဇိဝိတ နှစ်ပါးတည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4004 | Chunk: 67

Tasmiṃ pana pāṇe pāṇasaññino jīvitindriyupacchedakaupakkamasamuṭṭhāpikā kāyavacīdvārānaṃ aññataradvārappavattā vadhakacetanā pāṇātipāto.

AI Translation based on Nissaya

But killing a living being is the volition to kill, for one who perceives it as a living being, which arises through either the body-door or the speech-door, and which instigates the effort to cut off the life faculty in that living being.

Vietnamese AI Translation

Nhưng sát sanh là tư tâm muốn giết, đối với người nhận thức đó là một chúng sanh, khởi lên qua thân môn hoặc khẩu môn, và kích động nỗ lực cắt đứt mạng căn của chúng sanh đó.

AI Translation Nissaya

pana=Now, to speak of pāṇātipāta apart from pāṇa. ; tasmiṃpāṇe=in that being or life faculty. ; pāṇasaññino=of a person who perceives it as a living being. ; jīvitindriyupacchedakaupakkamasamuṭṭhāpitā=which produces the effort that cuts off the life faculty. ; kāyavacīdvārānaṃ=of the body and speech doors. ; aññatradvārappavattā=occurring through one or the other door. ; vadhakacetanā=the volition which is the cause of killing. ; pāṇātipāto=is called killing a living being. ;

Myanmar Nissaya

pana=ပါဏမှ တပါး ပါဏာတိပါတကိုဆိုအံ့။။ ; tasmiṃpāṇe=ထိုသတ္တဝါဇီဝိတိန္ဒြေ၌။ ; pāṇasaññino=သတ္တဝါဟု အမှတ်ရှိသော ပုဂ္ဂိုလ်၏။ ; jīvitindriyupacchedakaupakkamasamuṭṭhāpitā=ဇီဝိတိန္ဒြေကို ဖြတ်ကြောင်းလုံ့လကို ဖြစ်စေတတ်သော။ ; kāyavacīdvārānaṃ=တို့တါင်။ ; aññatradvārappavattā=တပါးပါးသော ဒွါရ၌ဖြစ်သော။ ; vadhakacetanā=သတ်ကြောင်းဖြစ်သော စေတနာသည်။ ; pāṇātipāto=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4005 | Chunk: 67

So guṇavirahitesu tiracchānagatādīsu pāṇesu khuddake pāṇe appasāvajjo, mahāsarīre mahāsāvajjo.

AI Translation based on Nissaya

With regard to beings devoid of good qualities, such as animals, that act is of little fault in the case of a small being, and of great fault in the case of a large-bodied one.

Vietnamese AI Translation

Đối với các chúng sanh không có phẩm chất tốt, chẳng hạn như động vật, hành động đó ít tội trong trường hợp một chúng sanh nhỏ, và nặng tội trong trường hợp một chúng sanh có thân hình lớn.

AI Translation Nissaya

so pāṇātipoto=That act of killing. ; guṇavirahitesu=devoid of virtue and kindness. ; tiracchānagatādīsu=such as animals. ; pāṇesu=among beings. ; khuddake=small. ; pāṇe=in a being. ; appasāvajjo=has little fault. ; mahāsarīre=with a large body. ; pāṇe=in a being. ; mahāsāvajjo=has great fault. ;

Myanmar Nissaya

so pāṇātipoto=သည်။ ; guṇavirahitesu=ဂုဏ်ကျေးဇူးမှ တင်းကုန်သော။ ; tiracchānagatādīsu=တိရစ္ဆာန် အစရှိသော ။ ; pāṇesu=တို့တွင်။ ; khuddake=ငယ်သော။ ; pāṇe=သတ္တဝါ၌။ ; appasāvajjo=နည်းသော အပြစ်ရှိ၏။ ; mahāsarīre=ကြီးသော ကိုယ်ရှိသော။ ; pāṇe=၌။ ; mahāsāvajjo=အပြစ်ရှိ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4006 | Chunk: 67

Kasmā ?

AI Translation based on Nissaya

Why?

Vietnamese AI Translation

Tại sao?

AI Translation Nissaya

kasmā=Why?. ;

Myanmar Nissaya

kasmā=ကား။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4007 | Chunk: 67

Payogamahantatāya.

AI Translation based on Nissaya

Because of the greatness of the effort.

Vietnamese AI Translation

Do sự nỗ lực lớn.

AI Translation Nissaya

payogamahantatāya=Because of the greatness of the effort. ;

Myanmar Nissaya

payogamahantatāya=လုံ့လများသည်၏ အဖြစ်ကြောင့်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4008 | Chunk: 67

Payogasamattepi vatthumahantatāya.

AI Translation based on Nissaya

Even when the effort is the same, it is because of the greatness of the object.

Vietnamese AI Translation

Ngay cả khi nỗ lực là như nhau, đó là do sự to lớn của đối tượng.

AI Translation Nissaya

payogasamattepi=Even if the effort is the same. ; vatthumahantatāya=because of the greatness of the object. ;

Myanmar Nissaya

mayogasamattepi=မယောဂတူမျှသော်လည်း။ ; vatthumahantatāya=ဝတ္ထုဒြပ်ကြီးမားသည်၏ အဖြစ်ကြောင့်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4009 | Chunk: 67

Guṇavantesu manussādīsu appaguṇe pāṇe appasāvajjo, mahāguṇe mahāsāvajjo.

AI Translation based on Nissaya

With regard to beings endowed with good qualities, such as humans, the act is of little fault in the case of a being with few good qualities, and of great fault in the case of one with many good qualities.

Vietnamese AI Translation

Đối với các chúng sanh có phẩm chất tốt, chẳng hạn như con người, hành động đó ít tội trong trường hợp một chúng sanh có ít phẩm chất tốt, và nặng tội trong trường hợp một người có nhiều phẩm chất tốt.

AI Translation Nissaya

guṇavantesu=endowed with qualities. ; manussādīsu=such as humans. ; appaguṇe=with few qualities. ; pāṇe=in a being. ; appasāvajjo=it has little fault. ; mahāguṇe=with many qualities. ; pāṇe=in a being. ; mahāsavajjo=it has great fault. ;

Myanmar Nissaya

guṇavantesu=ဂုဏ်ရှိကုန်သော။ ; manussādīsu=လူအစရှိသည်တို့တွင်။ ; appaguṇe=နည်းသော ဂုဏ်ရှိသော။ ; pāṇe=သတ္တဝါ၌။ ; appasāvajjo=နည်းသော အပြစ်ရှိ၏။ ; mahāguṇe=များသော ဂုဏ်ရှိကုန်သော။ ; pāṇe=၌။ ; mahāsavajjo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4010 | Chunk: 67

Sarīraguṇānaṃ [M1.204] pana samabhāve sati kilesānaṃ upakkamānañca mudutāya appasāvajjo, tibbatāya mahāsāvajjoti veditabbo.

AI Translation based on Nissaya

It should be known that when the physical size and qualities [M1.204] are equal, the act is of little fault when the defilements and effort are weak, and of great fault when they are intense.

Vietnamese AI Translation

Nên biết rằng khi kích thước thể chất và phẩm chất [M1.204] là ngang nhau, hành động đó ít tội khi các phiền não và nỗ lực yếu, và nặng tội khi chúng mãnh liệt.

AI Translation Nissaya

pana=To state a special point. ; sarīraguṇānaṃ=of the body and qualities. ; samabhāve=in the case of being equal. ; sati=when it is. ; kilesānaṃ=of the defilements. ; upakkamānañca=and of the efforts. ; mudutāya=in the case of being weak. ; appasāvajjo=it is of little fault. ; tibbatāya=in the case of being intense. ; mahāsāvajjo=it is of great fault. ; iti=Thus. ; veditabbo=it should be known. ;

Myanmar Nissaya

pana=ဆိုဖွယ်အထူးကို ဆိုအံ့။ ; sarīraguṇānaṃ=ကိုယ် ဂုဏ်တို့၏။ ; samabhāve=တူမျှသည်၏ အဖြစ်သည်။ ; sati=သော်။ ; kilesānaṃ=ကိသေလာတို့၏ လည်းကောင်း။ ; upakkamānañca=လုံ့လတို့၏ လည်းကောင်း။ ; mudutāya=နုံ့သည်၏ အဖြစ်၌။ ; appasāvajjo=၏။ ; tibbatāya=ထွက်သည်၏ အဖြစ်၌။ ; mahāsāvajjo=၏။ ; iti=သို့။ ; veditabbo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4011 | Chunk: 67

Tassa pañca sambhārā – pāṇo, pāṇasaññitā, vadhakacittaṃ, upakkamo, tena maraṇanti.

AI Translation based on Nissaya

It has five constituent factors: a living being, the perception of a living being, the thought to kill, the effort, and the resulting death.

Vietnamese AI Translation

Nó có năm yếu tố cấu thành: một chúng sanh, nhận thức về một chúng sanh, ý nghĩ muốn giết, sự nỗ lực, và cái chết do đó gây ra.

AI Translation Nissaya

tassa pāṇātipātassa=Of that killing of a living being. ; sambhārā=the components. ; vā=or factors. ; pāṇo=a living being. ; pāṇasaññitā=the perception of it as a living being. ; vadhakacittaṃ=the thought to kill. ; upakkamo=the effort made. ; tena=by that effort. ; maraṇaṃ=the death. ; iti=thus, these five. ; honti=are. ;

Myanmar Nissaya

tassa pāṇātipātassa=၏။ ; sambhārā=အဆောက်အဦတို့သည်။ ; vā=အင်္ဂါတို့သည်။ ; pāṇo=သတ္တတါလည်းကောင်း။ ; pāṇasaññitā=သတ္တဝါ ဟုအမှတ်ရှိသည်၏ အဖြစ်လည်းကောင်း။ ; vadhakacittaṃ=သတ်လိုသော စိတ်လည်းကောင်း။ ; upakkamo=လုံ့လပြုခြင်း လည်းကောင်း။ ; tena=ထိုလုံ့လဖြင့်။ ; maraṇaṃ=သေခြင်းလည်းကောင်း။ ; iti=သို့။ ; pañca=ငါးပါးတို့သည်။ ; honti=ကုန်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4012 | Chunk: 67

Adinnassa [V1.187] ādānaṃ adinnādānaṃ , parasaṃharaṇaṃ, theyyaṃ, corikāti vuttaṃ hoti.

AI Translation based on Nissaya

The taking of what is not given [V1.187] is taking what is not given; it is said to be carrying away another's property, theft, the act of a thief.

Vietnamese AI Translation

Việc lấy của không cho [V1.187] là lấy của không cho; nó được nói là mang đi tài sản của người khác, trộm cắp, hành động của một tên trộm.

AI Translation Nissaya

adinnassa=of what is not given by the owner. ; ādānaṃ=is the taking. ; adinnādānaṃ=taking what is not given. ; parasaṃharaṇaṃ=carrying away another's property. ; theyyaṃ=theft. ; corikā=the act of a thief. ; iti=thus. ; vuttaṃ vutto=is said. ; hoti=to be. ;

Myanmar Nissaya

adinnassa=အရှင်မပေးသော ဥစ္စာကို။ ; ādānaṃ=ယူခြင်းတည်း။ ; adinnādānaṃ=ခြင်း။ ; parasaṃharaṇaṃ=သူတစ်ပါးဥစ္စာကို ဆောင်ခြင်း။ ; theyyaṃ=ခိုးခြင်း။ ; corikā=ခိုးသူတို့၏ အမှု။ ; iti=သို့။ ; vuttaṃ vutto=သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4013 | Chunk: 67

Tattha adinnan ti parapariggahitaṃ, yattha paro yathākāmakāritaṃ āpajjanto adaṇḍāraho anupavajjo ca hoti, tasmiṃ parapariggahite parapariggahitasaññino tadādāyakaupakkamasamuṭṭhāpikā kāyavacīdvārānaṃ aññataradvārappavattā theyyacetanā adinnādānaṃ.

AI Translation based on Nissaya

Therein, what is not given means what is possessed by another, with regard to which the other person, being able to do as he wishes, is not liable to punishment and is not blameworthy. Taking what is not given is the volition to steal for one who perceives that object as possessed by another, arising through either the body-door or the speech-door, and instigating the effort to take it.

Vietnamese AI Translation

Trong đó, của không cho có nghĩa là tài sản thuộc sở hữu của người khác, đối với tài sản đó, người khác có thể làm theo ý muốn, không bị trừng phạt và không đáng bị khiển trách. Lấy của không cho là tư tâm muốn trộm cắp đối với người nhận thức đối tượng đó là của người khác, khởi lên qua thân môn hoặc khẩu môn, và kích động nỗ lực lấy nó.

AI Translation Nissaya

tattha=Therein, in 'taking what is not given'. ; adinnanti='not given'. ; parapariggahitaṃ=is property taken possession of by another. ; yattha=in which property. ; paro=another person, called the owner. ; yathākāmakāritaṃ=to the state of being able to do as one wishes. ; āpajjanto=when reaching. ; adaṇḍārahoca=is not liable to punishment. ; hoti=is. ; anupavajjoca=and is not blameworthy. ; hoti=is. ; taṃ=That property. ; parapariggahitaṃ=is called 'possessed by another'. ; parapariggahite=possessed by another person, called the owner. ; tasmiṃ=in that property. ; parapariggahitasaññino=of a person who perceives it as possessed by another. ; tadādāyaka upakkamasamuṭṭhāpikā=which produces the effort that causes the taking of another's property. ; kāyavacidvārānaṃ=of the body and speech doors. ; aññataradvārappavattā=occurring through one or the other door. ; theyyacetanā=the volition which is the cause of stealing. ; adinnādānaṃ=is called taking what is not given. ;

Myanmar Nissaya

tattha=ထိုအဒိန္နာဒါန၌။ ; adinnanti=ကား။ ; parapariggahitaṃ=သူတစ်ပါးသိမ်းဆည်းအပ်သော ဥစ္စာတည်း။ ; yattha=အကြင် ဥစ္စာ၌။ ; paro=ဥစ္စာရှင်ဟု ဆိုအပ်သော တစ်ပါးသော သူသည်။ ; yathākāmakāritaṃ=အလိုရှိတိုင်း ပြုအပ်သည်၏ အဖြစ်သို့။ ; āpajjanto=ရောက်သည်ရှိသော်။ ; adaṇḍārahoca=ဒဏ်ထားခြင်းငှါ မထိုက်သည်လည်း။ ; hoti=၏။ ; anupavajjoca=မစွပ်စွဲအပ်သည်လည်း။ ; hoti=၏။ ; taṃ=ထိုဥစ္စာသည်။ ; parapariggahitaṃ=မည်၏။ ; parapariggahite=ဥစ္စာရှင်ဟု ဆိုအပ်သော တပါးသော သူသည် သိမ်းဆည်းအပ်သော။ ; tasmiṃ=ထိုဥစ္စာ၌။ ; parapariggahitasaññino=သူတစ်ပါး သိမ်းဆည်းအပ်၏ ဟု အမှတ်ရှိသော ပုဂ္ဂိုလ်၏။ ; tadādāyaka upakkamasamuṭṭhāpikā=သူတစ်ပါးတို့၏ ဥစ္စာကို ယူကြောင့်လုံ့ကို ဖြစ်စေတတ်သော။ ; kāyavacidvārānaṃ=တို့တွင်။ ; aññataradvārappavattā=တစ်ပါးပါးသော ဒွါရ၌ဖြစ်သော ; theyyacetanā=ခိုးကြောင်းဖြစ်သော စေတနာသည်။ ; adinnādānaṃ=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4014 | Chunk: 67

Taṃ hīne parasantake appasāvajjaṃ, paṇīte mahāsāvajjaṃ.

AI Translation based on Nissaya

That act is of little fault with regard to another's inferior property, and of great fault with regard to excellent property.

Vietnamese AI Translation

Hành động đó ít tội đối với tài sản kém giá trị của người khác, và nặng tội đối với tài sản quý giá.

AI Translation Nissaya

taṃ=That act of taking what is not given. ; hīna=inferior. ; parasantake=in another's property. ; appasāvajjaṃ=is of little fault. ; paṇīte=excellent. ; parasantake=in another's property. ; mahāsāvajjaṃ=is of great fault. ;

Myanmar Nissaya

taṃ=ထိုအဒိန္နာဒါနသည်။ ; hīna=ယုတ်ညံ့သော။ ; parasantake=သူတစ်ပါး ဥစ္စာ၌။ ; appasāvajjaṃ=၏။ ; paṇīte=မြတ်သော။ ; parasantake=၌။ ; mahāsāvajjaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4015 | Chunk: 67

Kasmā ?

AI Translation based on Nissaya

Why?

Vietnamese AI Translation

Tại sao?

AI Translation Nissaya

kasmā=Why?. ;

Myanmar Nissaya

kasmā=ကား။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4016 | Chunk: 67

Vatthupaṇītatāya.

AI Translation based on Nissaya

Because of the excellence of the object.

Vietnamese AI Translation

Do sự quý giá của đối tượng.

AI Translation Nissaya

vatthupaṇītatāya=Because of the excellence of the object. ;

Myanmar Nissaya

vatthupaṇītatāya=ဝတ္ထုဒြပ်မြတ်သည်၏ အဖြစ်ကြောင့်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4017 | Chunk: 67

Vatthusamatte sati guṇādhikānaṃ santake vatthusmiṃ mahāsāvajjaṃ, taṃ taṃ guṇādhikaṃ upādāya tato tato hīnaguṇassa santake vatthusmiṃ appasāvajjaṃ.

AI Translation based on Nissaya

When the value of the object is the same, it is of great fault in the case of an object belonging to those of superior virtue; it is of little fault in the case of an object belonging to a person of inferior virtue as compared with the former.

Vietnamese AI Translation

Khi giá trị của đối tượng là như nhau, nó nặng tội trong trường hợp một đối tượng thuộc về những người có giới đức cao hơn; nó ít tội trong trường hợp một đối tượng thuộc về một người có giới đức thấp hơn so với người trước.

AI Translation Nissaya

vatthusamatte=when the object is the same. ; sati=it being so. ; guṇādikānaṃ=of those with superior qualities. ; santake=in the possession. ; vatthusmiṃ=in the case of an object. ; mahāsāvajjaṃ=it is of great fault. ; taṃtaṃ guṇādikaṃ=those various superior qualities. ; upādāya=considering. ; tatotato=than that person with superior qualities. ; hīnaguṇassa=of a person with inferior qualities. ; santake=in the possession. ; vatthusmiṃ=in the case of an object. ; appasāvajjaṃ=it is of little fault. ;

Myanmar Nissaya

vatthusamatte=ဝတ္ထုတူမျှသည်၏ အဖြစ်သည်။ ; sati=သော်။ ; guṇādikānaṃ=ဂုဏ်လွန်သော သူတို့၏။ ; santake=သော။ ; vatthusmiṃ=၌။ ; mahāsāvajjaṃ=၏။ ; taṃtaṃ guṇādikaṃ=ထိုထိုဂုဏ်လွန်သည်ကို။ ; upādāya=ထောက်၍။ ; tatotato=ထိုထိုဂုဏ်လွန်သော သူအောက်။ ; hīnaguṇassa=ယုတ်သော ဂုဏ်ရှိသောသူ၏။ ; santake=သော။ ; vatthusmiṃ=၌။ ; appasāvajjaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4018 | Chunk: 67

Tassa pañca sambhārā – parapariggahitaṃ, parapariggahitasaññitā theyyacittaṃ, upakkamo, tena haraṇanti.

AI Translation based on Nissaya

It has five constituent factors: property possessed by another, the perception of it as such, the thought to steal, the effort, and the taking of it thereby.

Vietnamese AI Translation

Nó có năm yếu tố cấu thành: tài sản thuộc sở hữu của người khác, nhận thức về nó như vậy, ý nghĩ muốn trộm cắp, sự nỗ lực, và việc lấy nó do đó.

AI Translation Nissaya

tassa adinnādānassa=Of that taking what is not given. ; sambhārā=the components. ; pañca=five. ; honti=are. ; parapariggahitaṃ=property possessed by another. ; theyyacittaṃ=the thought to steal. ; upakkamo=the effort. ; tena=by that effort. ; haraṇaṃ=the theft. ; itiime=these are. ;

Myanmar Nissaya

tassa adinnādānassa=၏။ ; sambhārā=တို့သည်။ ; pañca=တို့သည်။ ; honti=ကုန်၏။ ; parapariggahitaṃ=သူတစ်ပါးသိမ်းဆည်းသော ဥစ္စာလည်းကောင်း။ ; theyyacittaṃ=ခိုးလိုသော စိတ်လည်းကောင်း။ ; upakkamo=လုံ့လပြုခြင်းလည်းကောင်း။ ; upakkamo=လုံ့လပြခြင်းလည်းကောင်း။ ; tena=ထိုလုံ့လဖြင့်။ ; haraṇaṃ=ခိုးခြင်းလည်းကောင်း။ ; itiime=ဤသည်တို့တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4019 | Chunk: 67

Kāmesūti methunasamācāresu.

AI Translation based on Nissaya

In sensual pleasures means in the practice of sexual intercourse.

Vietnamese AI Translation

Trong các dục có nghĩa là trong việc thực hành giao hợp.

AI Translation Nissaya

kāmesūti='In sensual pleasures' means. ; methuna samācāresu=in the practice of sexual intercourse. ;

Myanmar Nissaya

kāmesūti=ကား။ ; methuna samācāresu=မေထုန်အကျင့်တို့၌။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4020 | Chunk: 67

Micchācāroti ekantanindito lāmakācāro.

AI Translation based on Nissaya

Wrong conduct means absolutely reprehensible, base conduct.

Vietnamese AI Translation

Hành vi sai trái có nghĩa là hành vi hoàn toàn đáng bị khiển trách, hèn hạ.

AI Translation Nissaya

micchācāroti='Wrong conduct' means. ; ekantanindito=absolutely reprehensible. ; lāmakācāro=base conduct. ;

Myanmar Nissaya

micchācāroti=ကား။ ; ekantanindito=စင်စစ်ကဲ့ရဲ့အပ်သော။ ; lāmakācāro=ယုတ်သော အကျင့်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4021 | Chunk: 67

Lakkhaṇato pana asaddhammādhippāyena kāyadvārappavattā agamanīyaṭṭhānavītikkamacetanā kāmesu micchācāro.

AI Translation based on Nissaya

But by way of characteristic, wrong conduct in sensual pleasures is the volition, occurring through the body-door with a wrongful intention, to transgress with a forbidden partner.

Vietnamese AI Translation

Nhưng theo đặc tính, tà dâm trong các dục là tư tâm, xảy ra qua thân môn với ý định sai trái, vi phạm với một đối tượng bị cấm.

AI Translation Nissaya

pana=Now, to speak of the characteristic. ; lakkhaṇato=by way of characteristic. ; asaddhammādhippāyena=with the intention for what is not the true Dhamma. ; kāyadvārappavattā=arisen through the body-door. ; agamanīyaṭṭhānavītikkamacetanā=the volition that is the cause of transgressing in a place one should not go. ; kāmesumicchācāro=is called wrong conduct in sensual pleasures. ;

Myanmar Nissaya

pana=လက္ခဏာကို ဆိုအံ့။ ; lakkhaṇato=ဖြင့်။ ; asaddhammādhippāyena=မသူတော်တို့၏ တရားကို အလိုရှိသဖြင့်။ ; kāyadvārappavattā=သော။ ; agamanīyaṭṭhānavītikkamacetanā=မသွားလာအပ်သော မာတုရက္ခိတ အစရှိသော ဌာန၌ လွန်ကျူးကြောင်းစေတနာသည်။ ; kāmesumicchācāro=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4022 | Chunk: 67

Tattha agamanīyaṭṭhānaṃ nāma purisānaṃ tāva māturakkhitā, piturakkhitā, mātāpiturakkhitā, bhāturakkhitā, bhaginirakkhitā, ñātirakkhitā, gottarakkhitā, dhammarakkhitā, sārakkhā, saparidaṇḍāti māturakkhitādayo dasa, dhanakkītā, chandavāsinī, bhogavāsinī, paṭavāsinī, odapattakinī, obhatacumbaṭā, dāsī ca, bhariyā ca, kammakārī ca bhariyā ca, dhajāhaṭā muhuttikāti dhanakkītādayo dasāti [P1.221] vīsati itthiyo.

AI Translation based on Nissaya

Therein, for men, a forbidden partner is understood to be of twenty kinds of women [P1.221]: firstly, ten who are protected—a woman protected by her mother, by her father, by her parents, by her brother, by her sister, by her relatives, by her clan, by her spiritual companions, one who is betrothed, and one for whom there is a penalty; and secondly, ten kinds of wives—one bought with wealth, one living willingly, one living for wealth, one living for clothing, one 'water-vessel' wife, one who has put down her head-pad, a slave who is also a wife, a servant who is also a wife, a captive, and a temporary wife.

Vietnamese AI Translation

Trong đó, đối với nam giới, một đối tượng bị cấm được hiểu là hai mươi loại phụ nữ [P1.221]: thứ nhất, mười người được bảo vệ—một phụ nữ được mẹ bảo vệ, được cha bảo vệ, được cha mẹ bảo vệ, được anh trai bảo vệ, được chị gái bảo vệ, được họ hàng bảo vệ, được gia tộc bảo vệ, được các bạn đồng tu bảo vệ, người đã được hứa gả, và người có hình phạt đi kèm; và thứ hai, mười loại vợ—người được mua bằng tài sản, người sống chung tự nguyện, người sống chung vì tài sản, người sống chung vì quần áo, người vợ 'bình nước', người đã bỏ khăn đội đầu xuống, người nô lệ cũng là vợ, người hầu cũng là vợ, người bị bắt làm tù binh, và vợ tạm thời.

AI Translation Nissaya

tattha=Therein, in the term 'agamanīyaṭṭhānavītikkamacetanā'. ; agamanīyaṭṭhānaṃnāma=what is called a 'forbidden partner'. ; purisānaṃ=of men. ; kāmesumicchācāro=wrong conduct in sensual pleasures. ; (implied). ; tāva=firstly. ; evaṃ=thus. ; veditabbo=should be understood. ; purisānaṃ=for men. ; māturakkhitā=a woman protected by her mother. ; piturakkhitā=a woman protected by her father. ; mātāpiturakkhitā=a woman protected by both parents. ; bhāturakkhitā=a woman protected by her brother. ; bhaginirakkhitā=a woman protected by her sister. ; ñātirakkhitā=a woman protected by her relatives. ; gottarakkhitā=a woman protected by her clan. ; dhammarakkhitā=a woman protected by her spiritual companions. ; sārakkhā=a woman under protection from the king, etc.. ; saparidaṇḍā=a woman under penalty. ; iti=thus. ; māturakkhitādayo=beginning with a woman protected by her mother. ; dasa=ten kinds of women. ; dhanakkītā=a wife bought with wealth. ; chandavāsinī=a wife living by mutual consent. ; bhogavāsinī=a wife living by receiving wealth. ; paṭavāsinī=a wife living by receiving garments. ; odapattakinī=a wife through the dipping of hands in a water bowl. ; obhatacumbaṭā=a wife who takes down the head-coil. ; dāsīca bhariyāca=a woman who is both a slave and a wife. ; kammakārīca bhariyāca=a woman who is both a worker and a wife. ; dhajāhatā=a captive wife. ; muhittikā=a temporary wife. ; iti=thus. ; dhanakkītādayo=beginning with a wife bought with wealth. ; dasa=ten kinds of women. ; iti=thus. ; vīsatiitthiyo=twenty kinds of women. ; honti=are. ;

Myanmar Nissaya

tattha=ထိုအဂမနီယဋ္ဌာန ဝီတိက္ကမစေတနာဟူသော ပုဒ်၌။ ; agamanīyaṭṭhānaṃnāma=သည်ကား။ ; purisānaṃ=တို့၏။ ; kāmesumicchācāro=ကို။ ; (ထည့်)။ ; tāva=လက်မွန်။ ; evaṃ=ဤသို့။ ; veditabbo=၏။ ; purisānaṃ=တို့အား။ ; māturakkhitā=အမိစောင့်သော မိန်းမလည်းကောင်း။ ; piturakkhitā=အဖစောင့်သော မိန်းမလည်းကောင်း။ ; mātāpiturakkhitā=မိဘနှစ်ပါးစုံ စောင့်သော မိန်းမလည်းကောင်း။ ; bhāturakkhitā=မောင်စောင့်သော မိန်းမလည်းကောင်း။ ; bhaginirakkhitā=အစ်မညီမစောင့်သော မိန်းမလည်းကောင်း။ ; ñātirakkhitā=ဆွေမျိုးစောင့်သော မိန်းမလည်းကောင်း။ ; gottarakkhitā=အနွယ်တူသော သူတို့စောင့်အပ်သော မိန်းမလည်းကောင်း။ ; dhammarakkhitā=တရားကျင့်ဖော် ဖြစ်သော သူတို့သည် စောင့်အပ်သော မိန်းမလည်းကောင်း။ ; sārakkhā=မင်းအစရှိသည်တို့မှ အစောင့်အရှောက်ရှိသော မိန်းမလည်းကောင်း။ ; saparidaṇḍā=ဒဏ်ထားခြင်းရှိသောမိန်းမလည်းကောင်း။ ; iti=သို့။ ; māturakkhitādayo=မာတုရက္ခိတအစရှိကုန်သော။ ; dasa=တစ်ကျိပ်သော မိန်းမတို့သည်လည်းကောင်း။ ; dhanakkītā=ဥစ္စာဖြင့် ဝယ်၍နေသော မယာလည်းကောင်း။ ; chandavāsinī=အလိုတူ၍နေသော မယားလည်းကောင်း။ ; bhogāvāsinī=စည်းစိမ်ပေး၍ နေသော မယားလည်းကောင်း။ ; paṭavāsinī=အဝတ်ပုဆိုးပေး၍နေသော မယားလည်းကောင်း။ ; odapattakinī=ရေခွက်၌ လက်ပြိုင်ချ၍ နေသော မယာလည်းကောင်း။ ; obhatacumbaṭā=ခေါင်းခုချ၍နေသော မယားလည်းကောင်း။ ; dāsīca bhariyāca=ကျွန်လည်းဖြစ် မယားလည်းဖြစ်သော မိန်းမလည်းကောင်း။ ; kammakārīca bhariyāca=အမှုလုပ်သည်လည်းဖြစ် မယားလည်းဖြစ်သော မိန်းမလည်းကောင်း။ ; dhajāhatā=သုံ့ရ မယားလည်းကောင်း။ ; muhittikā=တခဏနေသော မယားလည်းကောင်း။ ; iti=သို့။ ; dhanakkītādayo=ဓနက္ကီတ အစရှိကုန်သော။ ; dasa=တစ်ကျိပ်သော မိန်းမလည်းကောင်း။ ; iti=သို့။ ; vīsatiitthiyo=နှစ်ကျိပ်သော မိန်းမတို့သည်။ ; honti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4023 | Chunk: 67

Itthīsu pana dvinnaṃ sārakkhasaparidaṇḍānaṃ dasannañca dhanakkītādīnanti dvādasannaṃ itthīnaṃ aññe purisā, idaṃ agamanīyaṭṭhānaṃ nāma.

AI Translation based on Nissaya

But for women—that is, for the two who are betrothed or for whom there is a penalty, and for the ten kinds beginning with a wife bought with wealth, making twelve kinds of women—other men are a forbidden partner. This is what is called a forbidden partner.

Vietnamese AI Translation

Nhưng đối với phụ nữ—nghĩa là, đối với hai người đã được hứa gả hoặc có hình phạt đi kèm, và đối với mười loại bắt đầu bằng vợ được mua bằng tài sản, tổng cộng là mười hai loại phụ nữ—những người đàn ông khác là đối tượng bị cấm. Đây là cái được gọi là đối tượng bị cấm.

AI Translation Nissaya

pana=Now, to speak of the forbidden partner for women, apart from the forbidden partner for men. ; itthīsu=among the twenty kinds of women. ; dvinnaṃ=for the two kinds. ; sārakkhasaparidaṇḍānaṃ=the one who is betrothed and the one for whom there is a penalty. ; dasannaṃ=for the ten kinds. ; dhanakkītādīnañca=and for those beginning with a wife bought with wealth. ; iti=thus. ; dvādasannaṃ=for the twelve kinds. ; itthīnaṃ=of women. ; aññe=other. ; purisā=men. ; honti=are. ; idaṃ=This group of women and men just described. ; agamanīyaṭṭhānaṃnāma=is called a forbidden partner. ;

Myanmar Nissaya

pana=ပုရိသတို့၏ အာဂမနီယဌာနမှ တစ်ပါး ဣတ္ထိတို့၏ အဂမနီယဋ္ဌာကို ဆိုအံ့။ ; itthīsu=နှစ်ကျိန်သော မိန်းမတို့တွင်။ ; dvinnaṃ=ကုန်သော။ ; sārakkhasaparidaṇḍānaṃ=တို့အားလည်းကောင်း။ ; dasannaṃ=ကုန်သော။ ; dhanakkītādīnañca=ဓနက္ကီတအစရှိသော မိန်းမတို့အား လည်းကောင်း။ ; iti=သို့။ ; dvādasannaṃ=ကုန်သော။ ; itthīnaṃ=တို့အား။ ; aññe=တစ်ပါးကုန်သော။ ; purisā=ယောင်္ကျားတို့သည်။ ; honti=ကုန်၏။ ; idaṃ=ဤဆိုအပ်ပြီးသော ဣတ္ထိပုရိသအပေါင်းသည်။ ; agamanīyaṭṭhānaṃnāma=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4024 | Chunk: 67

So panesa micchācāro sīlādiguṇarahite agamanīyaṭṭhāne appasāvajjo, sīlādiguṇasampanne mahāsāvajjo.

AI Translation based on Nissaya

That wrong conduct is of little fault in the case of a forbidden partner who is devoid of qualities such as virtue, and of great fault in the case of one endowed with qualities such as virtue.

Vietnamese AI Translation

Hành vi sai trái đó ít tội trong trường hợp một đối tượng bị cấm không có các phẩm chất như giới đức, và nặng tội trong trường hợp một người có các phẩm chất như giới đức.

AI Translation Nissaya

pana=Now, to speak of the fault. ; so esa esso micchācāro=That base conduct. ; sīlādiguṇarahite=devoid of qualities such as virtue. ; agamanīyaṭṭhāne=in a forbidden partner. ; appasāvajjo=is of little fault. ; tassa=Of that wrong conduct in sensual pleasures. ; sambhārā=the components. ; cattāro=four. ; honti=are. ;

Myanmar Nissaya

pana=အပြစ်ကို ဆိုအံံ။ ; so esa esso micchācāro=ထိုယုတ်မာသော အကျင့်သည်။ ; sīlādiguṇarahite=သီလအစရှိသော ဂုဏ်မှကင်းသော။ ; agamanīyaṭṭhāne=မသွားလာအပ်သောဌာတို့၌။ ; appasāvajjo=၌။ ; tassa=ထိုကာမေသုမိစ္ဆာစာရ၏။ ; sambhārā=အင်္ဂါတို့သည်။ ; cattāro=တို့သည်။ ; honti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4025 | Chunk: 67

Tassa cattāro sambhārā – agamanīyavatthu, tasmiṃ sevanacittaṃ, sevanapayogo, maggenamaggapaṭipattiadhivāsananti.

AI Translation based on Nissaya

It has four constituent factors: a forbidden partner, the thought to have intercourse with that partner, the effort made to do so, and the consenting to the act of intercourse.

Vietnamese AI Translation

Nó có bốn yếu tố cấu thành: một đối tượng bị cấm, ý nghĩ muốn giao hợp với đối tượng đó, nỗ lực thực hiện, và sự đồng thuận với hành vi giao hợp.

AI Translation Nissaya

cattāro=The four. ; katame=what are they?. ; agamanīyavatthu=A forbidden object (partner). ; tasmiṃ=in that forbidden object. ; sevanacittaṃ=the thought to engage with. ; sevanapayogo=the effort made to engage. ; maggenamaggapaṭipattiadhivāsanaṃ=the consent to the act of intercourse. ; itiime=these are. ;

Myanmar Nissaya

cattāro=တို့ဟူသည်။ ; katame=အတီတို့နည်း။ ; agamanīyavatthu=မသွားလာအပ်သော ဝတ္ထုလည်းကောင်း။ ; tasmiṃ=ထိုမသွားလာအပ်သော ဝတ္ထု၌။ ; sevanacittaṃ=မှီဝဲလိုသော စိတ်လည်းကောင်း။ ; sevanapayogo=မှီဝဲခြင်းငှါ လုံ့လပြုခြင်းလည်းကောင်း။ ; maggenamaggapaṭipattiadhivāsanaṃ=မဂ်အချင်းချင်း ကျင့်ခြင်းကို သာယာခြင်းလည်းကောင်း။ ; itiime=တို့တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4026 | Chunk: 67

Musāti [M1.205] visaṃvādanapurekkhārassa atthabhañjako vacīpayogo, kāyapayogo vā.

AI Translation based on Nissaya

Falsehood [M1.205] is the verbal or physical effort of one who intends to deceive that destroys the other's benefit.

Vietnamese AI Translation

Nói dối [M1.205] là sự nỗ lực bằng lời nói hoặc thân thể của người có ý định lừa dối, phá hủy lợi ích của người khác.

AI Translation Nissaya

musāti='Falsehood' is. ; visaṃvādanapurekkhārassa=of a person who has the intention to deceive. ; atthabhañcako=that which destroys benefit. ; vacīpayogovā=either a verbal effort. ; kāyapayogovā=or a physical effort. ; musā=is called falsehood. ; pana=Now, to speak of false speech apart from falsehood. ;

Myanmar Nissaya

musāti=ကား။ ; visaṃvādanapurekkhārassa=ချွတ်ယွင်းခြင်းကို ရှေ့ရှုသော ပုဂ္ဂိုလ်၏။ ; atthabhañcako=အကျိုးစီးပွားကို ဖျက်ဆီးတတ်သော။ ; pacīpayogovā=လည်းကောင်း။ ; kāyapayogovā=သည်လည်းကောင်း။ ; musā=မည်၏။ ; pana=မုသာမှ တစ်ပါး မုသာဝါဒကို ဆိုအံ့။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4027 | Chunk: 67

Visaṃvādanādhippāyena panassa paravisaṃvādakakāyavacīpayogasamuṭṭhāpikā cetanā musāvādo.

AI Translation based on Nissaya

But false speech is the volition of one with the intention to deceive, which produces the physical or verbal effort that deceives another.

Vietnamese AI Translation

Nhưng nói dối là tư tâm của người có ý định lừa dối, tạo ra sự nỗ lực bằng thân thể hoặc lời nói để lừa dối người khác.

AI Translation Nissaya

visaṃvā danādhippāyenu=with the intention to deceive. ; assa=of that person who intends to speak falsely. ; paravisaṃvādakakāyavacīpayogasamuṭṭhāpikā=which produces the physical or verbal effort that deceives another. ; cetanā=the volition. ; musāvādo=is called false speech. ;

Myanmar Nissaya

visaṃvā danādhippāyenu=ချွတ်ယွင်းခြင်းကို အလိုရှိသဖြင့်။ ; assa=ထိုမုသာဝါဒကို ဆိုလိုသော ပုဂ္ဂိုလ်၏။ ; paravisaṃvādakakāyavacīpayogasamuṭṭhāpikā=သူတစ်ပါးကို ချွတ်ယွင်းစေတတ်သော ကာယပကယောဂ ဝစီပယောဂကို ဖြစ်စေတတ်သော။ ; cetanā=သည်။ ; musāvādo=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4028 | Chunk: 67

Aparo nayo – musāti abhūtaṃ atacchaṃ vatthu.

AI Translation based on Nissaya

Another method: 'Falsehood' is a matter that is unreal and untrue.

Vietnamese AI Translation

Một phương pháp khác: 'Nói dối' là một vấn đề không có thật và không đúng sự thật.

AI Translation Nissaya

aparo=Another. ; nayo=method. ; vuccate=will be said. ; musāti=As for 'musā' (falsehood). ; abhūtaṃ=that is not real. ; vā=or that is not manifest. ; atacchaṃ=that is not true. ; vatthu=it is the matter. ;

Myanmar Nissaya

aparo=သော။ ; nayo=ကို။ ; vuccate=အံ့။ ; musāti=ကား။ ; abhūtaṃ=မဟုတ်သော။ ; vā=ထင်ရှားမရှိသော။ ; atacchaṃ=မမှန်သော။ ; vatthu=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4029 | Chunk: 68

Vādoti tassa bhūtato tacchato viññāpanaṃ.

AI Translation based on Nissaya

'Speech' is making that unreal matter known as if it were real and true.

Vietnamese AI Translation

'Lời nói' là làm cho vấn đề không có thật đó được biết đến như thể nó là thật và đúng sự thật.

AI Translation Nissaya

vādoti=As for 'vāda' (speech). ; tassavatthussa=of that unreal and untrue matter. ; bhūtato=as being real. ; vā=or as being manifest. ; tacchato=as being true. ; viññāpanaṃ=is the act of making it known. ;

Myanmar Nissaya

vādoti=ကား။ ; tassavatthussa=ထိုမဟုတ်မမှန်သော ဝတ္ထုကို။ ; bhūtato=ဟုတ်သော အားဖြင့်။ ; vā=ထင်ရှားရှိသော အားဖြင့်။ ; tacchato=မှန်သောအားဖြင့်။ ; viññāpanaṃ=သိစေခြင်းတည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4030 | Chunk: 68

Lakkhaṇato pana atathaṃ vatthuṃ tathato paraṃ viññāpetukāmassa tathāviññattisamuṭṭhāpikā cetanā musāvādo.

AI Translation based on Nissaya

However, from the point of view of its characteristic, false speech is the volition of one who desires to make an untrue matter known to another as if it were true, a volition that gives rise to bodily or verbal intimation to that effect.

Vietnamese AI Translation

Tuy nhiên, từ quan điểm đặc tính của nó, nói dối là tư tâm của người muốn làm cho một vấn đề không đúng sự thật được người khác biết đến như thể nó là sự thật, một tư tâm làm phát sinh sự biểu lộ bằng thân hoặc lời nói về tác động đó.

AI Translation Nissaya

pana=Now, as for the characteristic. ; lakkhaṇato=By way of characteristic. ; atathaṃ=an untrue. ; vatthuṃ=matter. ; bhūtato=as real. ; tathato=as true. ; paraṃ=to another. ; viññāpetukāmassa=of one who desires to make known. ; tathāviññattisamuṭṭhāpikā=which produces bodily or verbal intimation in that way. ; cetanā=The volition. ; musāvādo=is called false speech. ;

Myanmar Nissaya

pana=လက္ခဏာကို ဆိုအံ့။ ; lakkhaṇato=ဖြင့်။ ; atathaṃ=မဟုတ်မမှန်သော။ ; vatthuṃ=ကို။ ; bhūtato=ဟုတ်သောအားဖြင့်။ ; tathato=မှန်သောအားဖြင့်။ ; paraṃ=သူတစ်ပါးကို။ ; viññāpetukāmassa=သိစေခြင်းငှါ အလိုရှီအပ်သော သူ၏။ ; tathāviññattisamuṭṭhāpikā=ထိုအခြင်းအရာအားဖြင့် ကာယဝိညတ် ဝစီဝိညတ်ကို ဖြစ်စေတတ်သော။ ; cetanā=သည်။ ; musāvādo=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4031 | Chunk: 68

So yamatthaṃ bhañjati, tassa appatāya appasāvajjo, mahantatāya mahāsāvajjo.

AI Translation based on Nissaya

It is of little blame if the benefit it destroys is small, and of great blame if it is great.

Vietnamese AI Translation

Nó ít bị khiển trách nếu lợi ích mà nó phá hủy là nhỏ, và bị khiển trách nặng nếu lợi ích đó lớn.

AI Translation Nissaya

so=That false speech. ; yaṃatthaṃ=whatever benefit. ; bhañjati=it destroys. ; tassa=of that benefit. ; appatāya=due to its being small. ; appasāvajjo=is of little blame. ; mahantatāya=due to its being great. ; mahāsāvajjo=is of great blame. ;

Myanmar Nissaya

so=ထိုမုသာဝါဒသည်။ ; yaṃatthaṃ=အကြင်အကျိုးစီးပွားကို။ ; bhañjati=ဖျက်ဆီး၏။ ; tassa=ထိုအကျိုးစီးပွား၏။ ; appatāya=နည်းသည်၏ အဖြစ်ကြောင့်။ ; appasāvajjo=၏။ ; mahantatāya=များသည်၏ အဖြစ်ကြောင့်. ; mahāsāvajjo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4032 | Chunk: 68

Apica gahaṭṭhānaṃ attano santakaṃ adātukāmatāya natthītiādinayappavatto appasāvajjo, sakkhinā [V1.188] hutvā atthabhañjanatthaṃ vutto mahāsāvajjo.

AI Translation based on Nissaya

Furthermore, for householders, false speech that occurs due to not wanting to give one's own possession, such as saying, 'There is none,' is of little blame. But false speech spoken while acting as a witness [V1.188] in order to destroy a benefit is of great blame.

Vietnamese AI Translation

Hơn nữa, đối với người tại gia, nói dối do không muốn cho đi tài sản của mình, chẳng hạn như nói: 'Không có,' thì ít bị khiển trách. Nhưng nói dối khi làm nhân chứng [V1.188] để phá hủy một lợi ích thì bị khiển trách nặng.

AI Translation Nissaya

apica=Furthermore. ; gahaṭṭhānaṃ=for householders. ; attano=one's own. ; santakaṃ=possession. ; adātukāmatāya=due to the desire not to give. ; natthi=there is none. ; iti ādinayappavatto=false speech that occurs in a way such as this. ; appasāvajjo=is of little blame. ; sakkhinā=as a witness. ; hutvā=having become. ; atthabhañjanatthaṃ=for the purpose of destroying a benefit. ; vutto=spoken false speech. ; mahāsāvajjo=is of great blame. ;

Myanmar Nissaya

apica=တနည်းလည်း။ ; gahaṭṭhānaṃ=လူတို့၏။ ; attano=မိမိ၏။ ; santakaṃ=ဥစ္စာကို။ ; adātukāmatāya=မပေးလိုသည်၏ အဖြစ်ကြောင့်။ ; natthi=မရှိပါ။ ; iti ādinayappavatto=ဤသို့ အစရှိသော နည်းဖြင့် ဖြစ်သော မုသာဝါဒသည်။ ; appasāvajjo=၏။ ; sakkhinā=သက်သေသည်။ ; hutvā=ဖြစ်၍။ ; atthabhañjanatthaṃ=အကျိုးစီးပွားကို ဖျက်ဆီးခြင်းငှါ။ ; vutto=ဆိုအပ်သော မုသာဝွဒသည်။ ; mahāsāvajjo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4033 | Chunk: 68

Pabbajitānaṃ appakampi telaṃ vā sappiṃ vā labhitvā hasādhippāyena ‘‘ajja gāme telaṃ nadī maññe sandatī’’ ti pūraṇakathānayena pavatto appasāvajjo, adiṭṭhaṃyeva pana diṭṭhantiādinā nayena vadantānaṃ mahāsāvajjo.

AI Translation based on Nissaya

For renunciants, having received even a little oil or ghee, to speak with the intention of joking by way of exaggeration, saying, 'Today in the village, I think a river of oil is flowing,' is of little blame. But for those who speak by the method of saying 'I have seen' what they have not seen, it is of great blame.

Vietnamese AI Translation

Đối với người xuất gia, sau khi nhận được dù chỉ một ít dầu hoặc bơ sữa, nói với ý định đùa cợt bằng cách phóng đại, nói rằng: 'Hôm nay trong làng, tôi nghĩ một dòng sông dầu đang chảy,' thì ít bị khiển trách. Nhưng đối với những người nói theo cách nói 'tôi đã thấy' những gì họ không thấy, thì bị khiển trách nặng.

AI Translation Nissaya

pabbajjitānaṃ=For renunciants. ; appakampi=even a small amount. ; telaṃ vā=of oil or. ; sappiṃvā=of ghee. ; labhitvā=having received from a village. ; hasādippāyena=with the intention to joke. ; ajja=today. ; gāme=in the village. ; telaṃ=oil. ; nadīmaññe=like a river, I think. ; sandati=flows. ; iti=thus. ; pūraṇakathānayena=by the method of exaggerating speech. ; pavatto=false speech that has arisen. ; appasāvajjo=is of little blame. ; pana=Now, as for great blame. ; adiṭṭhaṃyeva=what has not been seen at all. ; diṭṭhaṃ=has been seen. ; iviādinā=such as. ; nayena=by the method. ; vadantānaṃ=of those who speak. ; musāvādo=the false speech. ; (thañña့) mahāsāvajjo=is of great blame. ;

Myanmar Nissaya

pabbajjitānaṃ=ရဟန်းတို့၏။ ; appakampi=အနည်းငယ်လည်းဖြစ်သော။ ; telaṃ vā=ကိုလည်းကောင်း။ ; sappiṃvā=ကိုလည်းကောင်း။ ; labhitvā=ရွာမှ ရခဲ့၍။ ; hasādippāyena=ရယ်မြူးလိုသဖြင့်။ ; ajja=ယနေ့။ ; gāme=ရွာထဲ၌။ ; telaṃ=သည်။ ; nadīmaññe=မြစ်ကဲ့သို့ပင်။ ; sandati=စီး၏။ ; iti=သို့။ ; pūraṇakathānayena=မပြည့်သည်ကို ပြည့်သည်ဟု ဆိုကြောင်းဖြစ်သော နည်းဖြင့်။ ; pavatto=ဖြစ်သော မုသာဝါဒသည်။ ; appasāvajjo=၏။ ; pana=မဟာသာဝဇ္ဇကို ဆိုအံ့။ ; adiṭṭhaṃyeva=မမြင်အပ်သော အာရုံကိုပင်လျှင်။ ; diṭṭhaṃ=မြင်အပ်၏။ ; iviādinā=သော။ ; nayena=ဖြင့်။ ; vadantānaṃ=ပြောဆိုကုန်သော သူတို့၏။ ; musāvādo=သည်။ ; (thañña့) mahāsāvajjo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4034 | Chunk: 68

Tassa cattāro sambhārā – atathaṃ vatthu, visaṃvādanacittaṃ, tajjo vāyāmo, parassa tadatthavijānananti.

AI Translation based on Nissaya

It has four components: an untrue matter, the mind intending to deceive, the corresponding effort, and the other person's understanding of its meaning.

Vietnamese AI Translation

Nó có bốn thành phần: một vấn đề không đúng sự thật, tâm có ý định lừa dối, nỗ lực tương ứng, và sự hiểu biết của người khác về ý nghĩa của nó.

AI Translation Nissaya

tassa=Of that false speech. ; sambhārā=the components. ; atathaṃ vatthu=an untrue matter, and. ; visaṃvādanacittaṃ=the mind intending to deceive, and. ; tajjo=corresponding to that deception. ; vāyomo=the effort, and. ; parassa=of the other person. ; tadatthavijānanaṃ=the understanding of the meaning of that bodily or verbal exertion. ; iti=thus. ; cattāro=are four. ; honti=they are. ;

Myanmar Nissaya

tassa=ထိုမုသာဝါဒ၏။ ; sambhārā=အဆောက်အအုံတို့သည်။ ; atathaṃ vatthu=မဟုတ်မမှန်သော ဝတ္ထုလည်းကောင်း။ ; visaṃvādanacittaṃ=ချွတ်ယွင်းစေလိုသော စိတ်လည်းကောင်း။ ; tajjo=ထိုချွတ်ယွင်းစေခြင်း အားလျော်သော။ ; vāyomo=လုံ့လပြုခြင်းလည်းကောင်း။ ; parassa=သူတစ်ပါး၏။ ; tadatthavijānanaṃ=ထိုကာယပယောဂ ဝစီပယောဂ၏ အနက်ကို သိခြင်းလည်းကောင်း။ ; iti=သို့။ ; cattāro=တို့သည်။ ; honti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4035 | Chunk: 68

Yāya vācāya yassa taṃ vācaṃ bhāsati, tassa hadaye attano piyabhāvaṃ, parassa ca suññabhāvaṃ karoti, sā pisuṇā vācā.

AI Translation based on Nissaya

That speech by which one speaks to a person, creating in that person's heart fondness for oneself and disaffection for another, is slanderous speech.

Vietnamese AI Translation

Lời nói mà qua đó người ta nói với một người, tạo ra trong lòng người đó sự yêu mến đối với mình và sự bất mãn đối với người khác, là lời nói đâm thọc.

AI Translation Nissaya

yāyavācāya=By which speech. ; yassa=to which person. ; taṃ vācaṃ=that speech. ; bhāsati=one speaks. ; tassa=of that person spoken to. ; hadaye=in the heart. ; attano=for oneself. ; viyabhāvañca=the state of being dear, and. ; parassa=for another. ; suññabhāvañca=the state of being void of affection, and. ; karoti=it creates. ; sāvācā=that speech. ; pisuṇavācā=is called slanderous speech. ;

Myanmar Nissaya

yāyavācāya=ဖြင့်။ ; yassa=အကြင်ပုဂ္ဂိုလ်အား။ ; taṃ vācaṃ=ထိုစကားကို။ ; bhāsati=ပြောဆို၏။ ; tassa=ထိုပြောဆိုအပ်သော သူ၏။ ; hadaye=စိတ်၌။ ; attano=မိမိအား။ ; viyabhāvañca=ချစ်အပ်သည်၏ အဖြစ်ကို လည်းကောင်း။ ; parassa=သူတစ်ပါးအား။ ; suññabhāvañca=ချစ်ခြင်းမှ ဆိတ်သည်၏ အဖြစ်ကိုလည်းကောင်း။ ; karoti=၏။ ; sāvācā=သည်။ ; pisuṇavācā=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4036 | Chunk: 68

Yāya pana attānampi parampi pharusaṃ karoti, yā vācā sayampi pharusā neva kaṇṇasukhā na hadayasukhā vā, ayaṃ pharusā vācā.

AI Translation based on Nissaya

And that speech which makes both oneself and another harsh, the speech that is itself harsh and is pleasant neither to the ear nor to the heart, this is harsh speech.

Vietnamese AI Translation

Và lời nói đó làm cho cả bản thân và người khác trở nên thô lỗ, lời nói bản thân nó thô lỗ và không dễ chịu cho tai cũng như cho lòng, đây là lời nói thô ác.

AI Translation Nissaya

pana=Now, as for harsh speech. ; yāya vācāya=by which speech. ; attānampi=oneself and. ; parampi=another. ; pharusaṃ=harsh. ; karoti=it makes. ; yā vācā=which speech. ; sayampi=itself. ; pharusaṃ=is harsh. ; kaṇṇasukhā=pleasant to the ear. ; vācā=speech. ; nevahoti=is not. ; ayaṃ vācā=this speech. ; pharusavācā=is called harsh speech. ;

Myanmar Nissaya

pana=ဖရုသဝါစာကိုဆိုအံ့။ ; yāya vācāya=ဖြင့်။ ; attānampi=ကိုလည်းကောင်း။ ; parampi=ကိုလည်းကောင်း။ ; pharusaṃ=ကြမ်းတမ်းသည်ကို။ ; karoti=၏။ ; yā vācā=သည်။ ; sayampi=မိမိသည်လည်း။ ; pharusaṃ=ကြမ်းတမ်း၏။ ; kaṇṇasukhā=နားချမ်းသာသော။ ; vācā=စကားသည်။ ; nevahoti=မဖြစ်။ ; ayaṃ vācā=သည်။ ; pharusavācā=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4037 | Chunk: 68

Yena samphaṃ palapati niratthakaṃ, so samphappalāpo.

AI Translation based on Nissaya

That by which one utters useless talk is idle chatter.

Vietnamese AI Translation

Điều mà qua đó người ta nói những lời vô ích là lời nói phù phiếm.

AI Translation Nissaya

yena vacībhedena=By which kind of speech. ; samphaṃ niratthakaṃ=useless talk. ; palapati=one utters. ; so vacībhedo=that kind of speech. ; samphappalāpo=is called idle chatter. ;

Myanmar Nissaya

yena vacībhedena=ဖြင့်။ ; samphaṃ niratthakaṃ=အကျိုးမရှိသော စကားကို။ ; palapati=ပြောဆိုတတ်၏။ ; so vacībhedo=သည်။ ; samphappalāpo=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4038 | Chunk: 68

Tesaṃ mūlabhūtā cetanāpi pisuṇāvācādināmameva labhati.

AI Translation based on Nissaya

The underlying volition of slanderous speech, harsh speech, and idle chatter also receives the same name.

Vietnamese AI Translation

Tư tâm tiềm ẩn của lời nói đâm thọc, lời nói thô ác và lời nói phù phiếm cũng nhận cùng tên gọi.

AI Translation Nissaya

tesaṃ=Of that slanderous speech, harsh speech, and idle chatter. ; mūlabhūtā=which is the root cause. ; cetanāpi=the volition also. ; pisuṇavācādināmameva=only the name 'slanderous speech', etc.. ; labhati=receives. ;

Myanmar Nissaya

tesaṃ=ထိုပိသုဏဝါစာ ဖရုသဝါစာ သမ္ဖပ္ပလာပတို့၏။ ; mūlabhūtā=အကြောင်းအရင်းဖြစ်၍ ဖြစ်သော။ ; cetanāpi=သည်လည်း။ ; pisuṇavācādināmameva=ပိသုဏ ဝါစာအစရှိသော အမည်ကိုသာလျှင်။ ; labhati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4039 | Chunk: 68

Sā eva ca idha adhippetāti.

AI Translation based on Nissaya

And it is that very volition that is intended here.

Vietnamese AI Translation

Và chính tư tâm đó là điều được nói đến ở đây.

AI Translation Nissaya

ca=And. ; sā eva=that very volition. ; idha=here. ; adhippetā=is intended. ; iti=thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

ca=ဆက်။ ; sā eva=ထိုစေတနာကိုသာလျှင်။ ; idha=ဤအရာ၌။ ; adhippetā=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4040 | Chunk: 68

Tattha saṃkiliṭṭhacittassa paresaṃ vā bhedāya attano piyakamyatāya vā kāyavacīpayogasamuṭṭhāpikā cetanā pisuṇā vācā.

AI Translation based on Nissaya

Therein, slanderous speech is the volition of one with a defiled mind that gives rise to bodily or verbal exertion either for the sake of dividing others or out of a desire to be liked oneself.

Vietnamese AI Translation

Trong đó, lời nói đâm thọc là tư tâm của người có tâm ô nhiễm, làm phát sinh sự nỗ lực bằng thân hoặc lời nói hoặc vì mục đích chia rẽ người khác hoặc vì mong muốn được người khác yêu mến.

AI Translation Nissaya

tattha=Therein (among harsh speech and idle chatter). ; saṃkiliṭṭhacittassa=of a person with a defiled mind. ; paresaṃ=of others. ; bhedāyavā=with the wish for division, or. ; attano=for oneself. ; vā=or. ; piyakamyatāyavā=with the desire to be loved. ; kāyavacīpayogasamuṭṭhāpikā=which produces bodily or verbal exertion. ; cetanā=the volition. ; pisuṇavācā=is called slanderous speech. ;

Myanmar Nissaya

tattha=ထိုဖရုသဝါစာ သမ္ဖပ္ပလာပတို့တွင်။ ; saṃkiliṭṭhacittassa=ညစ်နွမ်းသော စိတ်ရှိသော ပုဂ္ဂိုလ်၏။ ; paresaṃ=တို့၏။ ; bhedāyavā=ကွဲပြားခြင်းကို အလိုရှိသဖြင့် လည်းကောင်း။ ; attano=မိမိအား။ ; vā=ကို။ ; piyakamyatāyavā=ချစ်ခြင်းကို အလိုရှိသည်၏ အဖြစ်ဖြင့်လည်းကောင်း။ ; kāyavacīpayogasamuṭṭhāpikā=ဖြစ်သော။ ; cetanā=သည်။ ; pisuṇavācā=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4041 | Chunk: 68

Sā yassa bhedaṃ karoti, tassa appaguṇatāya appasāvajjā, mahāguṇatāya mahāsāvajjā.

AI Translation based on Nissaya

It is of little blame when the person it divides has few virtues, and of great blame when they have great virtues.

Vietnamese AI Translation

Nó ít bị khiển trách khi người mà nó chia rẽ có ít đức hạnh, và bị khiển trách nặng khi họ có nhiều đức hạnh.

AI Translation Nissaya

sā=That slanderous speech. ; yassa puggalassa=which person. ; bhedaṃ=division. ; karoti=it causes. ; tassa puggalassa=of that person. ; appaguṇatāya=due to having few virtues. ; appasāvajjo=is of little blame. ; mahāguṇatāya=due to having great virtues. ; mahāsāvajjo=is of great blame. ;

Myanmar Nissaya

sā=ထိုပိသုဏဝါစာသည်။ ; yassa puggalassa=အား။ ; bhedaṃ=ကို။ ; karoti=၏။ ; tassa puggalassa=၏။ ; appaguṇatāya=နည်းသော ဂုဏ်ရှိသည်၏ အဖြစ်ကြောင့်။ ; appasāvajjo=၏။ ; mahāguṇatāya=ကြိးသော ဂုဏ်ရှိသည်၏ အဖြစ်ကြောင့်။ ; mahāsāvajjo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4042 | Chunk: 68

Tassā cattāro sambhārā [P1.222] – bhinditabbo paro, ‘‘iti ime nānā bhavissantī’’ ti bhedapurekkhāratā vā ‘‘iti ahaṃ piyo bhavissāmi vissāsiko’’ ti piyakamyatā vā, tajjo vāyāmo, tassa tadatthavijānananti.

AI Translation based on Nissaya

It has four components [P1.222]: another person who is to be divided; having division as one's aim, thinking, 'Thus they will become separate,' or the desire to be liked, thinking, 'Thus I will become dear, a confidant'; the corresponding effort; and that person's understanding of the meaning.

Vietnamese AI Translation

Nó có bốn thành phần [P1.222]: một người khác sẽ bị chia rẽ; có mục đích là chia rẽ, nghĩ rằng: 'Như vậy họ sẽ trở nên xa cách,' hoặc mong muốn được yêu mến, nghĩ rằng: 'Như vậy mình sẽ trở nên thân thiết, một người tâm phúc'; nỗ lực tương ứng; và sự hiểu biết của người đó về ý nghĩa.

AI Translation Nissaya

tassā=Of that slanderous speech. ; sambhāro=the components. ; bhinditabbo=who is to be divided. ; paro=another person. ; nānā=separate. ; bhavissanti=they will become. ; iti=thus. ; bhedapurekkhāratā=the state of having division as one's aim, or. ; iti=thus. ; ahaṃ=I. ; vā=or. ; piyo=dear. ; bhavissāmi=I will become. ; vissāsiko=a confidant. ; bhavissāmi=I will become. ; iti=thus. ; piyakamyatāvā=the desire to be liked, or. ; tajjo=the corresponding. ; vāyāmo=effort, and. ; tassa=of that other person. ; tadatthajānanaṃ=the understanding of the meaning of that speech, and. ; iti=thus. ; cattāro=are four. ; honti=they are. ;

Myanmar Nissaya

tassā=ထိုပိသုဏဝါစာ၏။ ; sambhāro=တို့သ်ည။ ; bhinditabbo=ကွဲပြားစေအပ်သော။ ; paro=တစ်ပါးသော သူသည်။ ; nānā=အသီးသီ။ ; bhavissanti=ကုန်လတ္တံ့။ ; iti=သို့။ ; bhedapurekkhāratāvā=ကွဲပြားခြင်းကို ရှေ့ရှုသည်၏ အဖြစ်လည်းကောင်း။ ; iti=ဤသို့ ငါဆိုသည်ရှိသော။ ; ahaṃ=ငါ့ကို။ ; vā=ငါသည်။ ; piyo=ချစ်အပ်သူသည်။ ; bhavissāmi=ဖြစ်အံ့။ ; vissāsiko=သူသည်။ ; bhavissāmi=အံ့။ ; iti=သို့။ ; piyakamyatāvā=ချစ်ခြင်းကို အလိုရှိသည်၏ အဖြစ်လည်းကောင်း။ ; tajjo=ထိုကွဲပြားခြင်း အားလျော်သော။ ; vāyāmo=လုံ့လပြုခြင်းလည်းကောင်း။ ; tassa=ထိုတစ်ပါးသော သူ၏။ ; tadatthajānanaṃ=ထိုစကား၏ အနက်ကို သိခြင်းလည်းကောင်း။ ; iti=သို့။ ; cattāro=တို့သည်။ ; honti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4043 | Chunk: 68

Pare pana abhinne kammapathabhedo natthi, bhinneyeva hoti.

AI Translation based on Nissaya

Specifically, if the other people are not divided, there is no breaking of the course of kamma; it only occurs when they are divided.

Vietnamese AI Translation

Cụ thể, nếu những người khác không bị chia rẽ, thì không có sự phá vỡ dòng chảy của kamma; nó chỉ xảy ra khi họ bị chia rẽ.

AI Translation Nissaya

pana=To state a specific point. ; pare=when the other people. ; abhinne=are not divided. ; kammapathabhedo=a breaking of the course of kamma. ; natthi=does not occur. ; pare=the people. ; bhinneyeva=only when divided. ; kammapathabhedo=the breaking of the course of kamma. ; hoti=occurs. ;

Myanmar Nissaya

pana=အထူးကို ဆိုအံ့။ ; pare=တစ်ပါးသော သူတို့သည်။ ; abhinne=မကွဲပြားကုန်သည်ရှိသော်။ ; kammapathabhedo=ကမ္မပထအထူးသည်။ ; natthi=မရှိ။ ; pare=တို့သည်။ ; bhinneyeva=ကွဲပြားမှ သာလျှင်။ ; kammapathabhedo=သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4044 | Chunk: 68

Parassa mammacchedakakāyavacīpayogasamuṭṭhāpikā ekantapharusacetanā pharusā vācā.

AI Translation based on Nissaya

Harsh speech is the exclusively harsh volition that gives rise to bodily or verbal exertion that cuts another to the quick.

Vietnamese AI Translation

Lời nói thô ác là tư tâm hoàn toàn thô lỗ làm phát sinh sự nỗ lực bằng thân hoặc lời nói làm tổn thương sâu sắc người khác.

AI Translation Nissaya

parassa=Of another. ; mammacchedakakāyavicīpayogasamuṭṭhāpikā=which is provoked by anger and produces bodily or verbal exertion that cuts to the quick. ; ekantapharusacetanā=the volition that is exclusively harsh. ; pharusavācā=is called harsh speech. ;

Myanmar Nissaya

parassa=သူတစ်ပါး၏။ ; mammacchedakakāyavicīpayogasamuṭṭhāpikā=ဒေါသသည်ထိုးကျင့်အပ်သည်ဖြစ်၍ ချစ်မြတ်နိုးခြင်းကို ဖြတ်တတ်သော ကာယပယောဂ ဝစီပယောဂကို ဖြစ်တတ်သော။ ; ekantapharusacetanā=စင်စစ်ကြမ်းတမ်းသော စေတနာသည်။ ; pharusavācā=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4045 | Chunk: 68

Mammacchedakopi pana payogo cittasaṇhatāya pharusā vācā na hoti.

AI Translation based on Nissaya

However, even verbal exertion that cuts to the quick is not harsh speech if the mind is gentle.

Vietnamese AI Translation

Tuy nhiên, ngay cả sự nỗ lực bằng lời nói làm tổn thương sâu sắc cũng không phải là lời nói thô ác nếu tâm hiền hòa.

AI Translation Nissaya

pana=However. ; mammacchedakakāyavicīpayogasamuṭṭhāpikā=exertion that cuts to the quick. ; payogopi=even the verbal exertion. ; cittasaṇhatāya=due to the gentleness of the mind. ; pharusavācā=harsh speech. ; nahoti=it does not become. ;

Myanmar Nissaya

pana=မမစ္ဆေဒကော= ဒေါသသည် ထိုးကျင့်အပ်သည်ဖြစ်၍ ချစ်မြတ်နိုးခြင်းကို ဖြတ်စေတတ်သော။ ; payogopi=ဝစီပယောဂသည်လည်း။ ; cittasaṇhatāya=စိတ်သိမ်မွေ့သည်၏ အဖြစ်၌။ ; pharusavācā=သည်။ ; nahoti=မဖြစ်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4046 | Chunk: 68

Mātāpitaro hi kadāci puttake evampi vadanti ‘‘corā vo khaṇḍākhaṇḍikaṃ karontū’’ ti.

AI Translation based on Nissaya

Indeed, sometimes parents say this to their young children: 'May thieves cut you to pieces!'

Vietnamese AI Translation

Thật vậy, đôi khi cha mẹ nói điều này với con nhỏ của họ: 'Mong cho bọn trộm cắt con ra từng mảnh!'

AI Translation Nissaya

hisaccaṃ=Indeed. ; mātāpitaro=mothers and fathers. ; kadāci=sometimes. ; puttake=their young children. ; evampi=even thus. ; vadanti=they say. ; kiṃ vadanti=what do they say?. ; vo=You. ; corā=thieves. ; khaṇḍākhaṇḍikaṃ=to pieces. ; karontu=may they make. ; iti=thus. ; vadanti=they say. ;

Myanmar Nissaya

hisaccaṃ=၏။ ; mātāpitaro=မိခင် ဖခင်တို့ သည်။ ; kadāci=ရံခါ။ ; puttake=သားငယ်တို့ကို။ ; evampi=ဤသို့လည်း။ ; vadanti=ဆိုကုန်၏။ ; kiṃ vadanti=ကား။ ; vo=သင်တို့အား။ ; corā=ခိုးသူတို့သည်။ ; khaṇḍākhaṇḍikaṃ=အပိုင်းပိုင်း။ ; karontu=ပြုစေကုန်သတည်း။ ; iti=သို့။ ; vadanti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4047 | Chunk: 68

Uppalapattampi ca nesaṃ upari patantaṃ [M1.206] na icchanti.

AI Translation based on Nissaya

And yet [M1.206] they would not wish even for a lotus petal to fall on them.

Vietnamese AI Translation

Và tuy nhiên [M1.206] họ thậm chí không muốn một cánh hoa sen rơi vào chúng.

AI Translation Nissaya

ca tathāpi=And yet, although they say so. ; nesaṃ=of those young children. ; upari=upon them. ; uppalamattampi=even so much as a lotus petal. ; patantaṃ=falling. ; naicchanti=they do not wish for. ;

Myanmar Nissaya

ca tathāpi=ထိုသို့ဆိုသော်လည်း။ ; nesaṃ=ထိုသားငယ်တို့၏။ ; upari=အထက်၌။ ; uppalamattampi=ကြာရွက်မျှလည်း။ ; patantaṃ=ကျသည်ကို။ ; naicchanti=အလိုမရှိကုန်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4048 | Chunk: 68

Ācariyupajjhāyā ca kadāci nissitake evaṃ vadanti ‘‘kiṃ ime ahirikā anottappino, niddhamatha ne’’ ti.

AI Translation based on Nissaya

And sometimes, teachers and preceptors say this to their dependents: 'Why are these ones so shameless and without fear of wrongdoing? Expel them!'

Vietnamese AI Translation

Và đôi khi, các vị thầy và yết-ma sư nói điều này với những người phụ thuộc vào họ: 'Tại sao những người này lại vô liêm và không biết sợ tội lỗi như vậy? Hãy đuổi họ đi!'

AI Translation Nissaya

ācariyupajjhāyāca=And teachers and preceptors. ; kadāci=sometimes. ; nissitake=to their young dependents. ; evaṃ=thus. ; vadanti=they say. ; ime=these ones. ; kiṃ=why. ; ahirikā=are they so shameless?. ; anottappino=are they so without fear of wrongdoing?. ; ne=those pupils. ; niddhamatha=expel them!. ; iti=thus. ; vadanti=they say. ;

Myanmar Nissaya

ācariyupajjhāyāca=ဆရာဥပဇ္ဈာယ်တို့သည်လည်း။ ; kadāci=ရံခါ။ ; nissitake=တပည့်ငယ်တို့ကို။ ; evaṃ=ကို။ ; vadanti=ဆိုကုန်၏။ ; ime=ဤသူတို့သည်။ ; kiṃ=အတီသို့ မူ၍။ ; ahirikā=အရှက်မရှိကုန်လေဘိသနည်း။ ; anottappino=ကြောက်လန့်ခြင်း မရှိလေကုန်ဘိသနည်း။ ; ne=ထို တပည့်တို့ကို။ ; niddhamatha=နှင့်ထုတ်ကြကုန်လော့။ ; iti=သို့။ ; vadanti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4049 | Chunk: 68

Atha ca nesaṃ āgamādhigamasampattiṃ icchanti.

AI Translation based on Nissaya

And yet, they wish for their accomplishment in scriptural learning and realization.

Vietnamese AI Translation

Và tuy nhiên, họ mong muốn sự thành tựu của những người đó trong việc học kinh điển và chứng đắc.

AI Translation Nissaya

athaca=And yet, even though they say so. ; nesaṃ=of those pupils. ; āgamādhisamasampattiṃ=accomplishment in scripture and realization. ; icchanti=they wish for. ;

Myanmar Nissaya

athaca=ထိုသို့ပင် ဆိုစေကာမူ။ ; nesaṃ=ထိုတပည့်တို့၏။ ; āgamādhisamasampattiṃ=အာဂုံပါဠိ အဘိညာဉ်၌ ပြည့်စုံခြင်းကို။ ; icchanti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4050 | Chunk: 68

Yathā ca cittasaṇhatāya pharusā vācā na hoti, evaṃ vacanasaṇhatāya apharusā vācāpi na hoti.

AI Translation based on Nissaya

And just as it is not harsh speech when the mind is gentle, so too, it is not non-harsh speech just because the words are gentle.

Vietnamese AI Translation

Và cũng như nó không phải là lời nói thô ác khi tâm hiền hòa, thì nó cũng không phải là lời nói không thô ác chỉ vì lời nói hiền hòa.

AI Translation Nissaya

ca=And further. ; cittasaṇhātaya=due to the gentleness of the mind. ; pharusavācā=harsh speech. ; nahotiyathā=just as it does not become. ; evaṃ=so. ; tathā=similarly. ; vacanasaṇhatāya=due to the gentleness of the words. ; apharusavācāpi=not-harsh speech also. ; nahoti=does not become. ;

Myanmar Nissaya

ca=ဆက်၍ ဆိုဦးအံ့။ ; cittasaṇhātaya=စိတ်သိမ် မွေ့သည်၏ အဖြစ်၌။ ; pharusavācā=သည်။ ; nahotiyathā=ကဲ့သို့။ ; evaṃ=သို့။ ; tathā=တူ။ ; vacanasaṇhatāya=စကားသိမ်းမွေ့သည်၏ အဖြစ်၌။ ; apharusavācāpi=ဖရုသဝါစာမဟုတ်သည် လည်း။ ; nahoti=မဖြစ်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4051 | Chunk: 68

Na hi mārāpetukāmassa ‘‘imaṃ sukhaṃ sayāpethā’’ ti vacanaṃ apharusā vācā hoti, cittapharusatāya panesā pharusā vācāva.

AI Translation based on Nissaya

Indeed, for someone who wants to have another person killed, the words, 'Let this person sleep comfortably,' are not non-harsh speech; due to the harshness of the mind, this is harsh speech indeed.

Vietnamese AI Translation

Thật vậy, đối với một người muốn giết một người khác, những lời nói: 'Hãy để người này ngủ thoải mái,' không phải là lời nói không thô ác; do sự thô ác của tâm, đây thực sự là lời nói thô ác.

AI Translation Nissaya

hi saccaṃ=Indeed. ; mārāpetukāmassa=Of one who wishes to have someone killed. ; imaṃ=this person. ; sukhaṃ=comfortably. ; sayāpetha=let them sleep. ; iti=thus. ; vacanaṃ=the saying. ; apharusavācā=not harsh speech. ; nahoti=is not. ; pana=In fact. ; cittapharusatāya=due to the harshness of the mind. ; esā=this harsh speech. ; pharusāvācāya=is harsh speech indeed. ; hoti=it is. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; mārāpetukāmassa=သတ်ခြင်းငှါ အလိုရှိသော သူ၏။ ; imaṃ=ဤသူကို။ ; sukhaṃ=ချမ်းသာစွာ။ ; sayāpetha=အိပ်စေကုန်လော့။ ; iti=သို့။ ; vacanaṃ=ဆိုခြင်းသည်။ ; apharusavācā=ဖရုသဝါစာမဟုတ်သည်။ ; nahoti=မဖြစ်။ ; pana=စင်စစ်သော်ကား။ ; cittapharusatāya=စိတ်ကြမ်းတမ်းသည်၏ ဖြစ်၌။ ; esā=ထိုဖရုသဝါစာသည်။ ; pharusāvācāya=ဖရုသဝါစာသည်သာလျှင်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4052 | Chunk: 68

Sā yaṃ sandhāya pavattitā, tassa appaguṇatāya appasāvajjā, mahāguṇatāya mahāsāvajjā.

AI Translation based on Nissaya

With reference to the person it is directed at, it is of little blame if that person has few virtues, and of great blame if they have great virtues.

Vietnamese AI Translation

Liên quan đến người mà nó hướng đến, nó ít bị khiển trách nếu người đó có ít đức hạnh, và bị khiển trách nặng nếu họ có nhiều đức hạnh.

AI Translation Nissaya

sāvācā=That harsh speech. ; vā=or. ; yaṃ puggalaṃ=which person. ; sandhāya=with reference to. ; pavattitā=occurs. ; vā=or is made to occur. ; tassa puggalassa=of that person. ; appaguṇatāya=due to having few virtues. ; appasāvajjo=is of little blame. ; mahāguṇatāya=due to having great virtues. ; mahāsāvajjo=is of great blame. ;

Myanmar Nissaya

sāvācā=ထိုဖရုသဝါစာသည်။ ; vā=ကို။ ; yaṃ puggalaṃ=ကို။ ; sandhāya=ကို။ ; pavattitā=ဖြစ်၏။ ; vā=ဖြစ်စေအပ်၏။ ; tassa puggalassa=၏။ ; appaguṇatāya=၌။ ; appasāvajjo=၏။ ; mahāguṇatāya=၌။ ; mahāsāvajjo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4053 | Chunk: 68

Tassā tayo sambhārā – akkositabbo paro, kupitacittaṃ, akkosanāti.

AI Translation based on Nissaya

It has three components: another person who is reviled, an angry mind, and the act of reviling.

Vietnamese AI Translation

Nó có ba thành phần: một người khác bị lăng mạ, một tâm sân giận, và hành động lăng mạ.

AI Translation Nissaya

tassā pharusavācāya=Of that harsh speech. ; tayo sambharo=the components are three. ; honti=they are. ; akkositabbo=who is to be reviled. ; paro=another person, and. ; kupitacittaṃ=an angry mind, and. ; akko sanā=the reviling. ; iti ime=these are they. ;

Myanmar Nissaya

tassā pharusavācāya=ဩ။ ; tayo sambharo=တို့သည်။ ; honti=ကုန်၏။ ; akkositabbo=ဆဲရေးအပ်သော။ ; paro=သူတစ်ပါးလည်းကောင်း။ ; kupitacittaṃ=အမျက်ထွက်သော စိတ်လည်းကောင်း။ ; akko sanā=ဆဲရေးခြင်းလည်းကောင်း။ ; iti ime=ဤသည်တို့တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4054 | Chunk: 68

Anatthaviññāpikā [V1.189] kāyavacīpayogasamuṭṭhāpikā akusalacetanā samphappalāpo.

AI Translation based on Nissaya

Idle chatter is the unwholesome volition that gives rise to bodily or verbal exertion that makes known what is unbeneficial [V1.189].

Vietnamese AI Translation

Lời nói phù phiếm là tư tâm bất thiện làm phát sinh sự nỗ lực bằng thân hoặc lời nói để làm cho người khác biết đến những điều vô ích [V1.189].

AI Translation Nissaya

anatthaviññāpikā=which makes known what is unbeneficial. ; kāyavacīpayogasamuṭṭhāpikā=which produces bodily or verbal exertion. ; akusalacetanā=The unwholesome volition. ; samphappalāpo=is called idle chatter. ;

Myanmar Nissaya

anatthaviññāpikā=အကျိုးမရှိသည်ကို သိစေတတ်သော။ ; kāyavacīpayogasamuṭṭhāpikā=သော။ ; akusalacetanā=သည်။ ; samphappalāpo=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4055 | Chunk: 68

So āsevanamandatāya appasāvajjo, āsevanamahantatāya mahāsāvajjo.

AI Translation based on Nissaya

That idle chatter is of little blame when practiced infrequently, and of great blame when practiced frequently.

Vietnamese AI Translation

Lời nói phù phiếm đó ít bị khiển trách khi thực hành không thường xuyên, và bị khiển trách nặng khi thực hành thường xuyên.

AI Translation Nissaya

so samphappalāpo=That idle chatter. ; āsevanamandatāya=due to being practiced little. ; appasāvajjo=is of little blame. ; āsevanamahantatāya=due to being practiced much. ; mahāsāvajjo=is of great blame. ;

Myanmar Nissaya

so samphappalāpo=သည်။ ; āsevanamandatāya=လေ့လာခြင်း နည်းသည်၏ အဖြစ်၌။ ; appasāvajjo=၏။ ; āsevanamahantatāya=လေ့လာခြင်း များသည်အဖြစ်၌။ ; mahāsāvajjo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4056 | Chunk: 68

Tassa dve sambhārā – bhāratayuddhasītāharaṇādiniratthakakathāpurekkhāratā, tathārūpikathākathanañcāti.

AI Translation based on Nissaya

It has two components: having as one's aim useless talk such as stories of the Bhārata war and the abduction of Sītā, and the telling of such stories.

Vietnamese AI Translation

Nó có hai thành phần: có mục đích là những câu chuyện vô ích như chuyện chiến tranh Bhārata và vụ bắt cóc Sītā, và việc kể những câu chuyện như vậy.

AI Translation Nissaya

tassa=Of that idle chatter. ; sambhārā=the components. ; dve=are two. ; dve=two. ; katame=what are they?. ; bhāratayuddhasītāharaṇādini ratthakakathāpurekkhāratā=having as one's aim useless talk such as stories of the Bhārata war and the abduction of Sītā, and. ; tathārūpi kathākathanañca=the telling of such stories. ; iti ime=these are they. ;

Myanmar Nissaya

tassa=ထိုသမ္ဖပ္ပလာပ၏။ ; sambhārā=တို့သည်။ ; dve=တည်း။ ; dve=ဟူသည်။ ; katame=နည်း။ ; bhāratayuddhasītāharaṇādini ratthakakathāpurekkhāratā=ဘာရတမင်းတို့၏ စစ်ထိုးသော ဝတ္ထု, သီတာမိဖုရားကို ဆောင်သော ဝတ္ထု အစရှိသော အကျိုးမရှိသော စကားကို ရှေ့ရှုသည်၏ အဖြစ်လည်းကောင်း။ ; tathārūpi kathākathanañca=ထိုသို့ သဘောရှိသော စကားကို ဆိုခြင်း လည်းကောင်း။ ; iti ime=ဤသည်တို့ တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4057 | Chunk: 68

Pare pana taṃ kathaṃ agaṇhante kammapathabhedo natthi, parena samphappalāpe gahiteyeva hoti.

AI Translation based on Nissaya

Specifically, if the listeners do not grasp the story, there is no breaking of the course of kamma; it only occurs when the idle chatter is grasped by the listener.

Vietnamese AI Translation

Cụ thể, nếu người nghe không nắm bắt được câu chuyện, thì không có sự phá vỡ dòng chảy của kamma; nó chỉ xảy ra khi lời nói phù phiếm được người nghe nắm bắt.

AI Translation Nissaya

pana=To state a specific point. ; pare=When the listeners. ; taṃ kathaṃ=that talk or story. ; agaṇhante=do not grasp it. ; kammapathabhedo=the breaking of the course of kamma. ; natthi=does not occur. ; parena=by the listener. ; samphappalāpe=the idle chatter. ; gahiteyeva=only when it is grasped. ; kammapathabhedo=the breaking of the course of kamma. ; hoti=occurs. ;

Myanmar Nissaya

pana=အထူးကို ဆိုဦးအံ့။ ; pare=တစ်ပါးသော နားထောင်စေအပ်သော သူတို့သည်။ ; taṃ kathaṃ=ထိုပြောဆိုသော ဝတ္ထုစကားကို။ ; agaṇhante=မနာယူသည်ရှိသော်။ ; kammapathabhedo=ကမ္မပထ အထူးသည်။ ; natthi=မရှီ။ ; parena=တစ်ပါးသော နားထောင်စေအပ်သော သူသည်။ ; samphappalāpe=သမ္ဖပ္ပလာပစကားကို။ ; gahiteyeva=ယူမှသာလျှင်။ ; kammapathabhedo=ကမ္မပထအထူးသည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4058 | Chunk: 68

Abhijjhāyatīti abhijjhā , parabhaṇḍābhimukhī hutvā tanninnatāya pavattatīti attho.

AI Translation based on Nissaya

It covets, therefore it is covetousness. The meaning is that it proceeds by facing another's property and inclining towards it.

Vietnamese AI Translation

Nó tham lam, do đó nó là tham lam. Ý nghĩa là nó diễn ra bằng cách đối diện với tài sản của người khác và hướng về nó.

AI Translation Nissaya

abhijjhāyati=It covets. ; iti tasmā=therefore. ; abhijjhā=it is called covetousness. ; parabhaṇḍābhimūkhī=facing another's property. ; hutvā=having become. ; tanninnatāya=with an inclination towards it. ; pavattati=it proceeds. ; itiayaṃ=this. ; attho=is the meaning. ;

Myanmar Nissaya

abhijjhāyati=သူတစ်ပါး စည်းစိမ်ကို ရှေ့ရှုအောက်မေ့တတ်၏။ ; iti tasmā=ကြောင့်။ ; abhijjhā=မည်၏။ ; parabhaṇḍābhimūkhī=သူတစ်ပါးဥစ္စာကို ရှေ့ရှုသည်။ ; hutvā=၍။ ; tanninnatāya=ထိုသူတစ်ပါး စည်းစိမ်သို့ ညွတ်သည်၏ အဖြစ်ဖြင့်။ ; pavattati=၏။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4059 | Chunk: 68

Sā ‘‘aho vata idaṃ mamassā’’ ti evaṃ parabhaṇḍābhijjhāyanalakkhaṇā, adinnādānaṃ viya appasāvajjā mahāsāvajjā ca.

AI Translation based on Nissaya

It has the characteristic of coveting another's property, thinking, 'Ah, if only this were mine!' Like taking what is not given, it should be understood as being of little or great blame.

Vietnamese AI Translation

Nó có đặc tính tham lam tài sản của người khác, nghĩ rằng: 'Ôi, giá như cái này là của mình!' Giống như lấy của không cho, nó nên được hiểu là ít hay nhiều tội.

AI Translation Nissaya

sā abhijjhā=That covetousness. ; idaṃ=this property. ; mama=mine. ; assa=may it be. ; ahovata=Ah, if only!. ; iti evaṃ=thus. ; parabhaṇḍā bhijjhāyanalakkhaṇā=has the characteristic of coveting another's property. ; adinnādānāviya=Like taking what is not given. ; appasāvajjā=of little blame and. ; mahāsāvajjāca=of great blame. ; veditabbā=it should be understood. ;

Myanmar Nissaya

sā abhijjhā=သည်။ ; idaṃ=ဤဥစ္စာသည်။ ; mama=အား။ ; assa=ဖြစ်ပါမူကား။ ; ahovata=ဪ ကောင်းလေစွ တကား။ ; iti evaṃ=သို့။ ; parabhaṇḍā bhijjhāyanalakkhaṇā=သူတစ်ပါး၏ စည်းစိမ်ကို ရှေ့ရှုကြံအောက်မေ့ခြင်း လက္ခဏာရှိ၏။ ; adinnādānāviya=ကဲ့သို့။ ; appasāvajjā=ကိုလည်းကောင်း။ ; mahāsāvajjāca=ကိုလည်းကောင်း။ ; veditabbā=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4060 | Chunk: 68

Tassa dve sambhārā – parabhaṇḍaṃ, attano pariṇāmanañcāti.

AI Translation based on Nissaya

It has two components: another's property, and directing it towards oneself.

Vietnamese AI Translation

Nó có hai thành phần: tài sản của người khác, và việc hướng nó về phía mình.

AI Translation Nissaya

tassā abhijjāya=Of that covetousness. ; sambhārā=the components. ; dve=are two. ; parabhaṇḍaṃ=another's property, and. ; attano=towards oneself. ; pariṇāmanañca=the act of directing it. ; iti ime=these are they. ; hi vitthāremi=I shall elaborate. ;

Myanmar Nissaya

tassā abhijjāya=၏။ ; sambhārā=တို့သည်။ ; dve=တို့တည်း။ ; parabhaṇḍaṃ=သူတစ်ပါး ဥစ္စာလည်းကောင်း။ ; attano=မိမိသို့။ ; pariṇāmanañca=ညွတ်စေခြင်း လည်းကောင်း။ ; iti ime=တည်း။ ; hi vitthāremi=အံ့။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4061 | Chunk: 68

Parabhaṇḍavatthuke hi lobhe uppannepi na tāva kammapathabhedo hoti, yāva ‘‘aho vata idaṃ mamassā’’ ti attano na pariṇāmeti.

AI Translation based on Nissaya

For even when greed has arisen with another's property as its object, the course of kamma is not yet broken as long as one does not direct it towards oneself, thinking, 'Ah, if only this were mine!'

Vietnamese AI Translation

Vì ngay cả khi lòng tham đã khởi lên với tài sản của người khác làm đối tượng, dòng chảy của kamma vẫn chưa bị phá vỡ miễn là người ta không hướng nó về phía mình, nghĩ rằng: 'Ôi, giá như cái này là của mình!'

AI Translation Nissaya

parabhaṇḍavatthuke=having another's property as its object. ; vā=or based on another's property. ; lobhe=greed. ; uppannepi=even when it has arisen. ; yāva=as long as. ; idaṃ=this desire. ; mama=mine. ; assa=would be. ; ahovata=ah, if only!. ; itiicintetvā=having thought thus. ; attano=towards oneself. ; napariṇaūmeti=one does not yet direct it. ; tāva=for that long. ; kammapathabhedo=the breaking of the course of kamma. ; na hoti=does not occur. ;

Myanmar Nissaya

parabhaṇḍavatthuke=သူတစ်ပါး၏ ဥစ္စာတည်းဟူသော ဝတ္ထုလျှင် အာရုံရှိသော။ ; vā=သူတစ်ပါးဘဏ္ဍာလျှင် တည်ရာရှိသော။ ; lobhe=လောဘသည်။ ; uppannepi=ဖြစ်လာလျှင်မူလည်း။ ; yāva=အကြင်ရွေ့လောက်။ ; idaṃ=ဤတဏှာသည်။ ; mama=ငါ့အား။ ; assa=ဖြစ်ပါဘိမူကား။ ; ahovata=ဪ ကောင်းလေစွ။ ; itiicintetvā=ဤသို့ ကြံအောက်မေ့၍။ ; attano=သို့။ ; napariṇaūmeti=မညွတ်စေသေး။ ; tāva=ထိုရွေ့လောက်။ ; kammapathabhedo=သည်။ ; na hoti=မဖြစ်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4062 | Chunk: 68

Hitasukhaṃ byāpādayatīti byāpādo.

AI Translation based on Nissaya

It destroys welfare and happiness, therefore it is ill will.

Vietnamese AI Translation

Nó phá hủy phúc lợi và hạnh phúc, do đó nó là sân.

AI Translation Nissaya

hi tasukhaṃ=welfare and happiness. ; byāpādayati=it destroys. ; iti tasmā=therefore. ; byāpādo=it is called ill will. ;

Myanmar Nissaya

hi tasukhaṃ=စီးပွားချမ်းသာကိုူ။ ; byāpādayati=ဖျက်ဆီးတတ်၏။ ; iti tasmā=ကြောင့်။ ; byāpādo=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4063 | Chunk: 68

So paravināsāya manopadosalakkhaṇo, pharusā vācā viya appasāvajjo mahāsāvajjo ca.

AI Translation based on Nissaya

It has the characteristic of mental corruption for the purpose of destroying another. Like harsh speech, it should be understood as being of little or great blame.

Vietnamese AI Translation

Nó có đặc tính ô nhiễm tinh thần nhằm mục đích phá hủy người khác. Giống như lời nói thô ác, nó nên được hiểu là ít hay nhiều tội.

AI Translation Nissaya

so byāpādo=That ill will. ; paravināsāya=for the destruction of another. ; mano padosakalakkhaṇo=has the characteristic of corruption of the mind. ; pharusavācāviya=Like harsh speech. ; appasāvajjo=of little blame and. ; mahāsāvajjoca=of great blame. ; veditabbo=it should be understood. ;

Myanmar Nissaya

so byāpādo=သည်။ ; paravināsāya=သူတစ်ပါးကို ဖျက်ဆီးခြင်းငှါ။ ; mano padosakalakkhaṇo=စိတ်၏ ပြစ်မှားခြင်း လက္ခဏာရှိ၏။ ; pharusavācāviya=ကဲ့သို့။ ; appasāvajjo=ကိုလည်းကောင်း။ ; mahāsāvajjoca=ကိုလည်းကောင်း။ ; veditabbo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4064 | Chunk: 68

Tassa dve sambhārā – parasatto ca, tassa ca vināsacintāti.

AI Translation based on Nissaya

It has two components: another being, and the thought of that being's destruction.

Vietnamese AI Translation

Nó có hai thành phần: một chúng sanh khác, và ý nghĩ về sự hủy diệt của chúng sanh đó.

AI Translation Nissaya

tassa byāpādassa=Of that ill will. ; sambharā=the components. ; dve=are two. ; parasattoca=another being, and. ; sattassa=of that other being. ; vināsacintāca=the thought of their destruction. ; iti ime=these are they. ;

Myanmar Nissaya

tassa byāpādassa=၏။ ; sambharā=တို့သည်။ ; dve=တို့တည်း။ ; parasattoca=တစ်ပါးသော သတ္တဝါလည်းကောင်း။ ; sattassa=ထိုတစ်ပါးသော သတ္တဝါ၏။ ; vināsacintāca=ပျက်စီးခြင်းကို ကြံခြင်းလည်းကောင်း။ ; iti ime=ဤသည်တို့တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4065 | Chunk: 68

Parasattavatthuke hi kodhe uppannepi na tāva [P1.223] kammapathabhedo hoti, yāva ‘‘aho vatāyaṃ ucchijjeyya vinasseyyā’’ ti tassa vināsaṃ na cinteti.

AI Translation based on Nissaya

Indeed, even when anger has arisen with another being as its object, the course of kamma [P1.223] is not yet broken as long as one does not think of that being's destruction, thinking, 'Ah, if only this being were annihilated and perished!'

Vietnamese AI Translation

Thật vậy, ngay cả khi sự tức giận đã khởi lên với một chúng sanh khác làm đối tượng, dòng chảy của kamma [P1.223] vẫn chưa bị phá vỡ miễn là người ta không nghĩ đến sự hủy diệt của chúng sanh đó, nghĩ rằng: 'Ôi, giá như chúng sanh này bị tiêu diệt và diệt vong!'

AI Translation Nissaya

hi saccaṃ=Indeed. ; parasattavatthuke=having another being as its object. ; kodhe=anger. ; uppannepi=even when it has arisen. ; yāva=as long as. ; ayaṃ=this being. ; ucchijjeyya=would be annihilated. ; vinasseyya=would perish. ; ahovata=ah, if only!. ; iti=thus. ; sattassa=of that other being. ; vināsaṃ=destruction. ; na cinteti=one does not yet think of. ; tāva=for that long. ; kammapathabhedo=the breaking of the course of kamma. ; nahoti=does not occur. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; parasattavatthuke=တစ်ပါးသော သတ္တဝါတည်းဟူသော ဝတ္ထုလျှင် အာရုံရှိသော။ ; kodhe=ဒေါသသည်။ ; uppannepi=ဖြစ်လျှင်မူလည်း။ ; yāva=လောက်။ ; ayaṃ=ဤသူသည်။ ; ucchijjeyya=ပြတ်မူကား။ ; vinasseyya=ပျက်မူကား။ ; ahovata=ဪကောင်းလေစွာ။ ; iti=သို့။ ; sattassa=ထိုတစ်ပါးသော သတ္တဝါ၏။ ; vināsaṃ=ပျက်စီးခြင်းကို။ ; na cinteti=မကြံသေး။ ; tāva=ထိုရွေ့လောက်။ ; kammapathabhedo=သည်။ ; nahoti=မဖြစ်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4066 | Chunk: 68

Yathābhuccagahaṇābhāvena [M1.207] micchā passatīti micchādiṭṭhi.

AI Translation based on Nissaya

It sees wrongly [M1.207] due to not grasping things as they really are, therefore it is wrong view.

Vietnamese AI Translation

Nó thấy sai [M1.207] do không nắm bắt được sự vật như chúng thực sự là, do đó nó là tà kiến.

AI Translation Nissaya

yathābhuccagahaṇābhāvena=Due to the absence of grasping things as they really are. ; micchā=wrongly. ; passati=it sees. ; iti tasmā=therefore. ; micchādiṭṭhi=it is called wrong view. ;

Myanmar Nissaya

yathābhuccagahaṇābhāvena=ဟုတ်မှန်တိုင်းသော သဘောကိုရှုခြင်း မရှိသည်၏ အဖြစ်ဖြင့်။ ; micchā=ဖောက်ပြန်သော အားဖြင့်။ ; passati=မြင်တတ်၏။ ; iti tasmā=ကြောင့်။ ; micchādiṭṭhi=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4067 | Chunk: 68

Sā ‘‘natthi dinnan’’ tiādinā nayena viparītadassanalakkhaṇā, samphappalāpo viya appasāvajjā, mahāsāvajjā ca.

AI Translation based on Nissaya

It has the characteristic of perverse seeing, such as the view, 'There is no result of giving.' Like idle chatter, it should be understood as being of little or great blame.

Vietnamese AI Translation

Nó có đặc tính thấy biết sai lệch, chẳng hạn như quan điểm: 'Không có kết quả của việc bố thí.' Giống như lời nói phù phiếm, nó nên được hiểu là ít hay nhiều tội.

AI Translation Nissaya

sāmicchādiṭṭhi=That wrong view. ; dinnaṃ=of giving. ; natthi=there is no (result). ; itiādīni=such as. ; nayena=by the method. ; viparītadassanalakkhaṇā=has the characteristic of seeing pervertedly. ; samphappalāpoviya=Like idle chatter. ; appasāvajjā=of little blame and. ; mahāsāvajjāca=of great blame. ; veditabbā=it should be understood. ;

Myanmar Nissaya

sāmicchādiṭṭhi=သည်။ ; dinnaṃ=အလှူ၏ အကျိုးသည်။ ; natthi=မရှိ။ ; itiādīni=သော။ ; nayena=ဖြင့်။ ; viparītadassanalakkhaṇā=ဖောက်ပြန်သော အားဖြင့် မြင်ခြင်းလက္ခဏာ ရှိ၏။ ; samphappalāpoviya=ကဲဲ့သို့။ ; appasāvajjā=ကိုလည်းကောင်း။ ; mahāsāvajjāca=ကိုလည်းကောင်း။ ; veditabbā=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4068 | Chunk: 68

Apica aniyatā appasāvajjā, niyatā mahāsāvajjā.

AI Translation based on Nissaya

Furthermore, unfixed wrong view is of little blame; fixed wrong view is of great blame.

Vietnamese AI Translation

Hơn nữa, tà kiến không cố định thì ít tội; tà kiến cố định thì nhiều tội.

AI Translation Nissaya

apica=Furthermore. ; aniyatā=unfixed wrong view. ; appasāvajjā=is of little blame. ; niyatā=fixed wrong view. ; mahāsāvajjā=is of great blame. ;

Myanmar Nissaya

apica=တနည်းလည်း။ ; aniyatā=အနိယတမိစ္ဆာဒိဋ္ဌိသည်။ ; appasāvajjā=၏။ ; niyatā=နိယတမိစ္ဆာဒိဋ္ဌိသည်။ ; mahāsāvajjā=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4069 | Chunk: 68

Tassā dve sambhārā – vatthuno ca gahitākāraviparītatā, yathā ca taṃ gaṇhāti, tathābhāvena tassūpaṭṭhānanti.

AI Translation based on Nissaya

It has two components: the perversion of the mode in which the object is grasped, and the appearance of that object in that very way it is grasped.

Vietnamese AI Translation

Nó có hai thành phần: sự sai lệch của phương thức mà đối tượng được nắm bắt, và sự xuất hiện của đối tượng đó theo chính cách nó được nắm bắt.

AI Translation Nissaya

tassā=Of that wrong view. ; sambhārā=the components. ; dve=are two. ; dve=two. ; katame=what are they?. ; vatthuno=of the object grasped. ; gahitākāraviparītatāca=the perversion of the mode in which it is grasped, and. ; yathā=as. ; taṃ=that object. ; gaṇhāti=one grasps. ; tathābhāvena=in that very mode of grasping. ; tassa=of that mode. ; upaṭṭhānañca=the appearance, and. ; iti ime=these are they. ;

Myanmar Nissaya

tassā=ထိုမိစ္ဆာဒိဋ္ဌိ၏။ ; sambhārā=အဆောက်အဦးတို့သည်။ ; dve=တို့တည်း။ ; dve=ဟူသည်။ ; katame=နည်း။ ; vatthuno=ယူအပ်သော ဝတ္ထု၏။ ; gahitākāraviparītatāca=ယူအပ်သော အခြင်းအရာ၏ ဖောက်ပြန်သည်၏ အဖြစ်လည်းကောင်း။ ; yathā=ဖြင့်။ ; taṃ=ထိုဝတ္ထုကို။ ; gaṇhāti=၏။ ; tathābhāvena=ထိုယူသော အခြင်းအရာအားဖြင့် သာလျှင်။ ; (ဧဝ ကျေ)။ ; tassa=ထိုအခြင်းအရား၏။ ; upaṭṭhānañca=ထင်ခြင်းလည်းကောင်း။ ; iti ime=ဣသည်တို့တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4070 | Chunk: 68

Tattha natthikāhetukaakiriyadiṭṭhīhi eva kammapathabhedo hoti, na aññadiṭṭhīhi.

AI Translation based on Nissaya

Among these, the breaking of the course of kamma occurs only through nihilistic view, rootless view, and inefficacy-of-action view, not through other views.

Vietnamese AI Translation

Trong số này, sự phá vỡ dòng chảy của kamma chỉ xảy ra thông qua đoạn kiến, vô nhân kiến và vô tác kiến, không phải thông qua các quan điểm khác.

AI Translation Nissaya

tattha=Among these views. ; nattikāhethuka akiriyadiṭṭhīhieva=only by nihilistic view, rootless view, and inefficacy-of-action view. ; kammapathabhedo=the breaking of the course of kamma. ; hoti=occurs. ; aññadiṭṭhīhi=by views other than these three. ; kammapathabhedo=the breaking of the course of kamma. ; nahoti=does not occur. ;

Myanmar Nissaya

tattha=ထိုဒိဋ္ဌိအပေါင်းတို့တွင်။ ; nattikāhethuka akiriyadiṭṭhīhieva=နတ္ထိကဒိဋ္ဌီ အဟေတုကဒိဋ္ဌိ အကိရိယဒိဋ္ဌိတို့ဖြင့်သာလျှင်။ ; kammapathabhedo=သည်။ ; hoti=၏။ ; aññadiṭṭhīhi=သုံးပါးသော ဒိဋ္ဌိတို့မှ တစ်ပါးသော ဒိဋ္ဌိတို့ဖြင့်။ ; kammapathabhedo=သည်။ ; nahoti=မဖြစ်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4071 | Chunk: 68

Imesaṃ pana dasannaṃ akusalakammapathānaṃ dhammato, koṭṭhāsato, ārammaṇato, vedanāto, mūlatoti pañcahākārehi vinicchayo veditabbo.

AI Translation based on Nissaya

Now, the analysis of these ten unwholesome courses of kamma should be understood in five ways: by way of their intrinsic nature, their components, their object, their feeling, and their root.

Vietnamese AI Translation

Bây giờ, sự phân tích về mười nghiệp đạo bất thiện này nên được hiểu theo năm cách: theo phương diện bản chất, thành phần, đối tượng, cảm thọ và gốc rễ của chúng.

AI Translation Nissaya

pana=Now, regarding the whole rather than the parts. ; dasannaṃ=of the ten. ; imesaṃ akusalakammapathānaṃ=of these unwholesome courses of kamma. ; dhammato=by way of their intrinsic nature, and. ; koṭṭhāsato=by way of their components, and. ; ārammaṇato=by way of their object, and. ; vedanāto=by way of their feeling, and. ; mūlato=by way of their root. ; iti=thus. ; pañcati=five. ; ākārehi=by modes. ; vinicchayo=the analysis. ; veditabbo=should be understood. ;

Myanmar Nissaya

pana=အစိတ်မှ တစ်ပါး အပေါင်းကို ဆိုအံ့။ ; dasannaṃ=ကုန်သော။ ; imesaṃ akusalakammapathānaṃ=တို့၏။ ; dhammato=တရားကိုယ်အားဖြင့်လည်းကောင်း။ ; koṭṭhāsato=အဖို့အစုအားဖြင့် လည်းကောင်း။ ; ārammaṇato=လည်းကောင်း။ ; vedanāto=လည်းကောင်း။ ; mūlato=လည်းကောင်း။ ; iti=သို့။ ; pañcati=ကုန်သော။ ; ākārehi=တို့ဖြင့်။ ; vinicchayo=ကို။ ; veditabbo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4072 | Chunk: 68

Tattha dhammatoti etesu hi satta paṭipāṭiyā cetanādhammāva honti, abhijjhādayo tayo cetanāsampayuttā.

AI Translation based on Nissaya

Therein, as for **'by way of their intrinsic nature'**: among these, the first seven are simply the mental factor of volition. The three beginning with covetousness are states associated with volition.

Vietnamese AI Translation

Trong đó, về 'theo phương diện bản chất': trong số này, bảy nghiệp đạo đầu tiên chỉ đơn thuần là tâm sở tư. Ba nghiệp đạo bắt đầu bằng tham lam là các trạng thái tương ưng với tư.

AI Translation Nissaya

tattha=Among these five. ; dhammatoti=as for 'by way of their intrinsic nature'. ; hi vitthāremi=to elaborate. ; etesu=among these unwholesome courses of kamma. ; paṭipāṭiyā=in sequence. ; satta=the seven unwholesome courses of kamma. ; cetanādhammāva=are simply the mental factor of volition. ; honti=they are. ; abhijjhādayo=covetousness and so on. ; tayo=the three. ; cetanāsampayuttā=are states associated with volition. ; honti=they are. ;

Myanmar Nissaya

tattha=ထိုငါးပါးတို့တွင်။ ; dhammatoti=ကား။ ; hi vitthāremi=အံ့။ ; etesu=ဤ အကုသလဓမ္မပထတို့တွင်။ ; paṭipāṭiyā=ဖြင့်။ ; satta=ခုနစ်ပါးသော အကုသလကမ္မပထတရားတို့တည်း။ ; cetanādhammāva=တို့သည်သာလျှင်။ ; honti=ကုန်၏။ ; abhijjhādayo=ကုန်သော။ ; tayo=ကုန်‌သော။ ; cetanāsampayuttā=စေတနာနှင့်ယှဉ်သော တရားတို့သည်။ ; honti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4073 | Chunk: 68

Koṭṭhāsatoti paṭipāṭiyā satta, micchādiṭṭhi cāti ime aṭṭha kammapathā eva honti, no [V1.190] mūlāni.

AI Translation based on Nissaya

As for **'by way of their components'**: the first seven in sequence and wrong view—these eight are only courses of kamma; they are not [V1.190] roots.

Vietnamese AI Translation

Về 'theo phương diện thành phần': bảy nghiệp đạo đầu tiên theo thứ tự và tà kiến—tám nghiệp đạo này chỉ là các nghiệp đạo; chúng không phải là [V1.190] các gốc rễ.

AI Translation Nissaya

koṭṭhāsatoti=As for 'by way of their components'. ; paṭipāṭiyā=in sequence. ; satta=the seven unwholesome courses of kamma, and. ; micchādiṭṭhica=wrong view. ; iti=thus. ; imeaṭṭha=these eight. ; kammapathāeva=are only courses of kamma. ; honti=they are. ; mūlāni=unwholesome roots. ; nohonti=they are not. ;

Myanmar Nissaya

koṭṭhāsatoti=ကား။ ; paṭipāṭiyā=ဖြင့်။ ; satta=ခုနစ်ပါးကုန်သော အကုသလကမ္မပတရားတို့သည်လည်းကောင်း။ ; micchādiṭṭhica=လည်းကောင်း။ ; iti=သို့။ ; imeaṭṭha=တို့သည်။ ; kammapathāeva=လျှင်။ ; honti=ကုန်၏။ ; mūlāni=အကုသလမူလ မည်ကုန်သည်။ ; nohonti=မဖြစ်ကုန်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4074 | Chunk: 68

Abhijjhābyāpādā kammapathā ceva mūlāni ca.

AI Translation based on Nissaya

Covetousness and ill will are both courses of kamma and also roots.

Vietnamese AI Translation

Tham lam và sân hận vừa là nghiệp đạo vừa là gốc rễ.

AI Translation Nissaya

abhijjhābyāpādā=Covetousness and ill will. ; kammapathāceva=are both courses of kamma. ; mūlānica=and also roots of greed and hatred. ;

Myanmar Nissaya

abhijjhābyāpādā=တို့သည်။ ; kammapathāceva=ကမ္မပထလည်းမည်ကုန်၏။ ; mūlānica=ဘောဘမူလဒေါသမူလလည်း မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4075 | Chunk: 68

Abhijjhā hi mūlaṃ patvā lobho akusalamūlaṃ hoti, byāpādo doso akusalamūlaṃ.

AI Translation based on Nissaya

To elaborate: covetousness, when it reaches the level of a root, becomes the unwholesome root of greed; ill will becomes the unwholesome root of hatred.

Vietnamese AI Translation

Để làm rõ hơn: tham lam, khi nó đạt đến mức độ của một gốc rễ, trở thành gốc rễ bất thiện của tham; sân hận trở thành gốc rễ bất thiện của sân.

AI Translation Nissaya

hi vitthāremi=To elaborate. ; abhijjhā=Covetousness. ; mūlaṃ=the level of a root. ; patvā=having reached. ; lobho=which is called greed. ; akusalamūlaṃ=the unwholesome root. ; hoti=becomes. ; byāpādo=Ill will. ; doso=which is called hatred. ; akusalamūlaṃ=the unwholesome root. ; hoti=becomes. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; abhijjhā=သည်။ ; mūlaṃ=မူလအရာသို့။ ; patvā=ရောက်၍။ ; lobho=လောဘဟု ဆိုအပ်သော။ ; akusalamūlaṃ=အကုသိုလ်မူလသည်။ ; hoti=၏။ ; byāpādo=သည်။ ; doso=ဒေါသဟု ဆိုအပ်သော။ ; akusalamūlaṃ=သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4076 | Chunk: 68

Ārammaṇatoti pāṇātipāto jīvitindriyārammaṇato saṅkhārārammaṇo.

AI Translation based on Nissaya

As for **'by way of their object'**: destroying life has a formation as its object, in that it has the life faculty as its object.

Vietnamese AI Translation

Về 'theo phương diện đối tượng': sát sanh có một hành làm đối tượng, ở chỗ nó có mạng căn làm đối tượng.

AI Translation Nissaya

ārammaṇatoti=As for 'by way of their object'. ; pāṇātipāto=The course of kamma of destroying life. ; jīvitindriyā rammacato=by having the life faculty as its object. ; saṅkhārārammaṇo=has a formation as its object. ; hoti=it has. ;

Myanmar Nissaya

ārammaṇatoti=ကား။ ; pāṇātipāto=ပါဏတိပါတကမ္မပထသည်။ ; jīvitindriyā rammacato=ဇီဝိတိန္ဒြိလျှင်အာရုံရှိသောအားဖြင့်။ ; saṅkhārārammaṇo=သင်္ခါရလျှင် အာရုံရှိသည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4077 | Chunk: 68

Adinnādānaṃ sattārammaṇaṃ vā saṅkhārārammaṇaṃ vā.

AI Translation based on Nissaya

Taking what is not given has either a being or a formation as its object.

Vietnamese AI Translation

Lấy của không cho có hoặc một chúng sanh hoặc một hành làm đối tượng.

AI Translation Nissaya

adinnādānaṃ=Taking what is not given. ; sattārammaṇaṃvā=has a being as its object, or. ; hoti=it has. ; saṅkhārārammaṇaṃvā=has a formation as its object. ; hoti=it has. ;

Myanmar Nissaya

adinnādānaṃ=သည်။ ; sattārammaṇaṃvā=သတ္တဝါကို အာရုံပြုသည်လည်း။ ; hoti=၏။ ; saṅkhārārammaṇaṃvā=သည်လည်း။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4078 | Chunk: 68

Micchācāro phoṭṭhabbavasena saṅkhārārammaṇo, sattārammaṇotipi eke.

AI Translation based on Nissaya

Sexual misconduct has a formation as its object, by way of the tangible object. Some say it also has a being as its object.

Vietnamese AI Translation

Tà dâm có một hành làm đối tượng, theo phương diện đối tượng xúc chạm. Một số người nói nó cũng có một chúng sanh làm đối tượng.

AI Translation Nissaya

micchācāro=Sexual misconduct. ; phoṭṭhabbavasena=by way of the tangible object. ; saṅkhārārammaṇo=has a formation as its object. ; sattārammaṇo=has a being as its object. ; iti pi=thus also. ; eke=some teachers. ; vadanti=say. ;

Myanmar Nissaya

micchācāro=သည်။ ; phoṭṭhabbavasena=ဖောဋ္ဌဗ္ဗာ ရုံ၏ အစွမ်းဖြင့်။ ; saṅkhārārammaṇo=သင်္ခါရလျှင် အာရုံရှိ၏။ ; sattārammaṇo=ရှိ၏။ ; iti pi=သို့လည်း။ ; eke=အချို့သော ဆရာတို့သည်။ ; vadanti=ဆိုကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4079 | Chunk: 68

Musāvādo sattārammaṇo vā saṅkhārārammaṇo vā.

AI Translation based on Nissaya

False speech has either a being or a formation as its object.

Vietnamese AI Translation

Nói dối có hoặc một chúng sanh hoặc một hành làm đối tượng.

AI Translation Nissaya

musāvādo=False speech. ; sattārammaṇovā=has a being as its object, or. ; hoti=it has. ; saṅkhārārammaṇovā=has a formation as its object. ; hoti=it has. ;

Myanmar Nissaya

musāvādo=သည်။ ; sattārammaṇovā=သည်လည်း။ ; hoti=၏။ ; saṅkhārārammaṇovā=သည်လည်း။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4080 | Chunk: 68

Tathā pisuṇā vācā.

AI Translation based on Nissaya

Similarly, slanderous speech has either a being or a formation as its object.

Vietnamese AI Translation

Tương tự, nói đâm thọc có hoặc một chúng sanh hoặc một hành làm đối tượng.

AI Translation Nissaya

tathā=Similarly. ; pisuṇāvācā=slanderous speech. ; sattārammaṇovā=has a being as its object, or. ; hoti=it has. ; saṅkhārā rammaṇovā=has a formation as its object. ; hoti=it has. ;

Myanmar Nissaya

tathā=ထို့အတူ။ ; pisuṇāvācā=သည်။ ; sattārammaṇovā=သည်လည်း။ ; hoti=၏။ ; saṅkhārā rammaṇovā=သည်လည်း။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4081 | Chunk: 68

Pharusā vācā sattārammaṇāva samphappalāpo diṭṭhasutamutaviññātavasena sattārammaṇo vā saṅkhārārammaṇo vā.

AI Translation based on Nissaya

Harsh speech only has a being as its object. Idle chatter, by way of what is seen, heard, sensed, and cognized, has either a being or a formation as its object.

Vietnamese AI Translation

Lời nói thô ác chỉ có một chúng sanh làm đối tượng. Lời nói phù phiếm, theo phương diện những gì được thấy, nghe, cảm nhận và nhận biết, có hoặc một chúng sanh hoặc một hành làm đối tượng.

AI Translation Nissaya

pharusāvācā=Harsh speech. ; sattārammaṇāva=only has a being as its object. ; samphappalāpo=Idle chatter. ; diṭṭhasutamutaviññātavasena=by way of what is seen, heard, sensed, and cognized. ; sattārammaṇovā=has a being as its object, or. ; hoti=it has. ; saṅkhārārammaṇovā=has a formation as its object. ; hoti=it has. ;

Myanmar Nissaya

pharusāvācā=သည်။ ; sattārammaṇāva=ရှိသည်သာတည်း။ ; samphappalāpo=သည်။ ; diṭṭhasutamutaviññātavasena=မြင်ဖူး ကြားဖူး တွေ့ဖူး သိဖူး သည်၏ အစွမ်းအားဖြင့်။ ; sattārammaṇovā=သည်လည်း။ ; hoti=၏။ ; saṅkhārārammaṇovā=သည်လည်း။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4082 | Chunk: 68

Tathā abhijjhā.

AI Translation based on Nissaya

Covetousness should be understood similarly.

Vietnamese AI Translation

Tham lam nên được hiểu tương tự.

AI Translation Nissaya

tathā=Similarly. ; abhijjhā=covetousness. ; daṭṭhabbā=should be seen. ;

Myanmar Nissaya

tathā=ထို့အတူ။ ; abhijjhā=ကို။ ; daṭṭhabbā=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4083 | Chunk: 68

Byāpādo sattārammaṇova.

AI Translation based on Nissaya

Ill will only has a being as its object.

Vietnamese AI Translation

Sân hận chỉ có một chúng sanh làm đối tượng.

AI Translation Nissaya

byāpādo=Ill will. ; sattārammaṇova=only has a being as its object. ;

Myanmar Nissaya

byāpādo=သည်။ ; sattārammaṇova=သတ္တဝါကိုသာ အာရုံပြု၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4084 | Chunk: 68

Micchādiṭṭhi tebhūmakadhammavasena saṅkhārārammaṇāva.

AI Translation based on Nissaya

Wrong view, by way of phenomena of the three planes, only has a formation as its object.

Vietnamese AI Translation

Tà kiến, theo phương diện các pháp của ba cõi, chỉ có một hành làm đối tượng.

AI Translation Nissaya

micchādiṭṭhi=Wrong view. ; tebhūmakadhammavasena=by way of phenomena of the three planes. ; saṅkhārārammaṇāva=only has a formation as its object. ;

Myanmar Nissaya

micchādiṭṭhi=သည်။ ; tebhūmakadhammavasena=တေဘူမက တရား၏ အစွမ်ဖြင့်။ ; saṅkhārārammaṇāva=ရှိ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4085 | Chunk: 68

Vedanātoti pāṇātipāto dukkhavedano hoti.

AI Translation based on Nissaya

As for **'by way of feeling'**: destroying life is accompanied by painful feeling.

Vietnamese AI Translation

Về 'theo phương diện cảm thọ': sát sanh đi kèm với khổ thọ.

AI Translation Nissaya

vedanātoti=As for 'by way of feeling'. ; pāṇātipāto=Destroying life. ; dukkhavedano=is accompanied by painful feeling. ; hoti=it is. ;

Myanmar Nissaya

vedanātoti=ကား။ ; pāṇātipāto=သည်။ ; dukkhavedano=ဒုက္ခဝေဒနာရှိသည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4086 | Chunk: 68

Kiñcāpi hi rājāno coraṃ disvā hasamānāpi ‘‘gacchatha bhaṇe, māretha nan’’ ti vadanti, sanniṭṭhāpakacetanā pana nesaṃ dukkhasampayuttāva hoti.

AI Translation based on Nissaya

Indeed, although kings may see a thief and say, even while laughing, 'Sirs, go and kill him,' their decisive volition is invariably associated with painful feeling.

Vietnamese AI Translation

Thật vậy, mặc dù các vị vua có thể thấy một tên trộm và nói, ngay cả khi đang cười, 'Thưa các ngài, hãy đi giết hắn,' tư tâm quyết định của họ luôn luôn đi kèm với khổ thọ.

AI Translation Nissaya

hi saccaṃ=Indeed. ; rājāno=kings. ; coraṃ=a thief. ; disvā=having seen. ; hasamānāpi=even while laughing. ; bhaṇe=sirs. ; gacchatha=go. ; naṃcoraṃ=that thief. ; māretha=kill him. ; iti=thus. ; kiñcāpivadanti=although they say. ; panatathāpi=nevertheless. ; nesaṃ=of those kings. ; sanniṭṭhāpakacetanā=the decisive volition. ; dukkhasampayuttāva=is only associated with pain. ; hoti=it is. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; rājāno=တို့သည်။ ; coraṃ=ကို။ ; disvā=၍။ ; hasamānāpi=ရယ်ရွှင် ကုန်လျက်လည်း။ ; bhaṇe=အချင်းတို့။ ; gacchatha=သွားကြလေကုန်။ ; naṃcoraṃ=ကို။ ; māretha=သတ်ကြချေကုန်။ ; iti=သို့။ ; kiñcāpivadanti=ရှင့်။ ; panatathāpi=ယင်းသို့ တကယ်ဆိုလင့်စကား။ ; nesaṃ=ထိုမင်းတို့၏။ ; sanniṭṭhāpakacetanā=ဆုံးဖြတ်ကြောင်းဖြစ်သော စေတနာသည်။ ; dukkhasampayuttāva=လျှင်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4087 | Chunk: 68

Adinnādānaṃ tivedanaṃ.

AI Translation based on Nissaya

Taking what is not given is accompanied by three kinds of feeling.

Vietnamese AI Translation

Lấy của không cho đi kèm với ba loại cảm thọ.

AI Translation Nissaya

adinnādānaṃ=Taking what is not given. ; tivedanaṃ=is accompanied by three kinds of feeling. ;

Myanmar Nissaya

adinnādānaṃ=သည်။ ; tivedanaṃ=ရှိ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4088 | Chunk: 68

Tañhi parabhaṇḍaṃ disvā haṭṭhatuṭṭhassa gaṇhato sukhavedanaṃ hoti, bhītatasitassa gaṇhato dukkhavedanaṃ, tathā vipākanissandaphalāni paccavekkhantassa.

AI Translation based on Nissaya

Indeed, for one who, upon seeing another's property, takes it while feeling happy and delighted, it is accompanied by pleasant feeling. For one who takes it while afraid and agitated, it is accompanied by painful feeling. Similarly, for one who reflects on its results and outcome-fruits, it is accompanied by painful feeling.

Vietnamese AI Translation

Thật vậy, đối với người, khi thấy tài sản của người khác, lấy nó trong khi cảm thấy vui vẻ và thích thú, nó đi kèm với lạc thọ. Đối với người lấy nó trong khi sợ hãi và lo lắng, nó đi kèm với khổ thọ. Tương tự, đối với người suy ngẫm về kết quả và quả dị thục của nó, nó đi kèm với khổ thọ.

AI Translation Nissaya

hi saccaṃ=Indeed. ; taṃ=that taking what is not given. ; parabhaṇḍaṃ=another's property. ; disvā=having seen. ; haṭṭhatuṭṭhassa=for one who is happy and delighted. ; vā=or. ; gaṇhato=for one who takes it. ; sukhavedanaṃ=is accompanied by pleasant feeling. ; hoti=it is. ; bhītatasitassa=for one who is afraid and agitated. ; gaṇhato=while taking. ; dukkhavedanaṃ=is accompanied by painful feeling. ; hoti=it is. ; tathā=Similarly. ; vipāka nissandaphalāni=the result and outcome-fruits of taking what is not given, such as hell and ugliness in the human realm. ; paccavekkhassa=for a person who reflects on. ; dukkhavedanaṃ=is accompanied by painful feeling. ; hoti=it is. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; taṃ=ထိုအဒိန္နဒါန်သည်။ ; parabhaṇḍaṃ=သူတစ်ပါးဥစ္စာကို။ ; disvā=တွေ့မြင်၍။ ; haṭṭhatuṭṭhassa=ရွှင်းလန်းနှစ်သက်သော စိတ်ရှိသော။ ; vā=စိတ်ရှိလျက်။ ; gaṇhato=ယူသော ပုဂ္ဂိုလ်အား။ ; sukhavedanaṃ=သည်။ ; hoti=၏။ ; bhītatasitassa=ကြောက်လန့်လျက်။ ; gaṇhato=အား။ ; dukkhavedanaṃ=သည်။ ; hoti=၏။ ; tathā=ထိုအတူ။ ; vipāka nissandaphalāni=အဒိန္နဒါန်၏ ငရဲစသော အကျိုး လူပြည့်၌ မတင့်တယ်ခြင်း အစရှိသော အကျိုးဆက် အကျိုးရင်းတို့ကို။ ; paccavekkhassa=ဆင်ခြင်သော ပုဂ္ဂိုလ်အား။ ; dukkhavedanaṃ=သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4089 | Chunk: 68

Gahaṇakāle majjhattabhāve ṭhitassa [P1.224] pana gaṇhato adukkhamasukhavedanaṃ hoti.

AI Translation based on Nissaya

Furthermore, for one who takes it [P1.224] while in a state of neutrality at the time of taking, it is accompanied by neither-painful-nor-pleasant feeling.

Vietnamese AI Translation

Hơn nữa, đối với người lấy nó [P1.224] trong khi ở trạng thái xả tại thời điểm lấy, nó đi kèm với cảm thọ bất khổ bất lạc.

AI Translation Nissaya

pana=Furthermore. ; gahaṇakāle=at the time of taking. ; majjhattabhāve=in a state of neutrality. ; ṭhitassa=for one who stands. ; vā=or. ; gaṇhato=for one who takes. ; adukkhamasukhavedanaṃ=is accompanied by neither-painful-nor-pleasant feeling. ; hoti=it is. ;

Myanmar Nissaya

pana=ထိုမှ တစ်ပါး။ ; gahaṇakāle=၌။ ; majjhattabhāve=၌။ ; ṭhitassa=သော။ ; vā=တည်လျက်။ ; gaṇhato=အား။ ; adukkhamasukhavedanaṃ=သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4090 | Chunk: 68

Micchācāro sukhamajjhattavasena dvivedano, sanniṭṭhāpakacitte [M1.208] pana majjhattavedano na hoti.

AI Translation based on Nissaya

Sexual misconduct is accompanied by two kinds of feeling, by way of pleasure and neutrality. However, in the decisive mind [M1.208], it is not accompanied by neutral feeling.

Vietnamese AI Translation

Tà dâm đi kèm với hai loại cảm thọ, theo phương diện lạc và xả. Tuy nhiên, trong tâm quyết định [M1.208], nó không đi kèm với xả thọ.

AI Translation Nissaya

micchācāro=Sexual misconduct. ; sukhamajjhattavasena=by way of pleasure and neutrality. ; dvivedano=is accompanied by two kinds of feeling. ; pana tathāpi=However, even though it has two feelings. ; sanniṭṭhāpakacitte=in the decisive mind. ; vā=or in the mind that reaches completion. ; majjhattavedano=accompanied by neutral feeling. ; na hoti=it is not. ;

Myanmar Nissaya

micchācāro=ကာမေသုမိစ္ဆာစာရသည်။ ; sukhamajjhattavasena=သုခဝေဒနာ ဥပေက္ခာ၏ အစွမ်းအားဖြင့်။ ; dvivedano=ရှိ၏။ ; pana tathāpi=ထိုသို့ နှစ်ပါးသော ဝေဒနာရှိလျှင် မူလည်း။ ; sanniṭṭhāpakacitte=ဆုံးဖြတ်သော စိတ်၌။ ; vā=အပြီးအဆုံးသို့ ရောက်သော စိတ်၌။ ; majjhattavedano=ဥပေက္ခာ ဝေဒနာရှိသည်။ ; na hoti=မဖြစ်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4091 | Chunk: 68

Musāvādo adinnādāne vuttanayeneva tivedano, tathā pisuṇā vācā.

AI Translation based on Nissaya

False speech is accompanied by three kinds of feeling, by the same method described for taking what is not given. Slanderous speech is similar.

Vietnamese AI Translation

Nói dối đi kèm với ba loại cảm thọ, theo cùng một phương pháp được mô tả cho việc lấy của không cho. Nói đâm thọc cũng tương tự.

AI Translation Nissaya

musāvādo=False speech. ; adinnādāne=in the case of taking what is not given. ; vuttanayeneva=by the method just stated. ; tivedano=is accompanied by three kinds of feeling. ; tathā=similarly. ; pisuṇavācā=is slanderous speech. ;

Myanmar Nissaya

musāvādo=သည်။ ; adinnādāne=၌။ ; vuttanayeneva=ဖြင့်သာလျှင်။ ; tivedano=ရှိ၏။ ; tathā=တူ။ ; pisuṇavācā=သည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4092 | Chunk: 68

Pharusā vācā dukkhavedanā.

AI Translation based on Nissaya

Harsh speech is accompanied by painful feeling.

Vietnamese AI Translation

Lời nói thô ác đi kèm với khổ thọ.

AI Translation Nissaya

pharusāvācā=Harsh speech. ; dukkhavedanā=is accompanied by painful feeling. ;

Myanmar Nissaya

pharusāvācā=သည်။ ; dukkhavedanā=ရှိ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4093 | Chunk: 68

Samphappalāpo tivedano.

AI Translation based on Nissaya

Idle chatter is accompanied by three kinds of feeling.

Vietnamese AI Translation

Lời nói phù phiếm đi kèm với ba loại cảm thọ.

AI Translation Nissaya

samphappalāpo=Idle chatter. ; tivedano=is accompanied by three kinds of feeling. ;

Myanmar Nissaya

samphappalāpo=သည်။ ; tivedano=ရှိ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4094 | Chunk: 68

Paresu hi sādhukāraṃ dentesu celādīni ukkhipantesu haṭṭhatuṭṭhassa sītāharaṇabhāratayuddhādīni kathanakāle so sukhavedano hoti, paṭhamaṃ dinnavetanena ekena pacchā āgantvā ‘‘ādito paṭṭhāya kathehī’’ ti vutte ‘‘niravasesaṃ yathānusandhikaṃ pakiṇṇakakathaṃ kathessāmi nu kho, no’’ ti domanassitassa kathanakāle dukkhavedano hoti, majjhattassa kathayato adukkhamasukhavedano hoti.

AI Translation based on Nissaya

For when others give cries of approval and throw up their garments and so on, and one joyfully recounts stories of the abduction of Sītā, the Bhārata war, and the like, that idle chatter is accompanied by pleasant feeling. When, after one has been rewarded, someone comes later and says, 'Tell it from the beginning!' and one becomes distressed, thinking, 'Should I recite this whole miscellaneous tale in sequence again, or not?', the telling is accompanied by painful feeling. When one tells it with an indifferent mind, it is accompanied by neither-painful-nor-pleasant feeling.

Vietnamese AI Translation

Vì khi những người khác tung hô và ném áo lên, và người ta vui vẻ kể lại những câu chuyện về vụ bắt cóc Sītā, chiến tranh Bhārata, và những chuyện tương tự, lời nói phù phiếm đó đi kèm với lạc thọ. Khi, sau khi đã được thưởng, có người đến sau và nói: 'Hãy kể lại từ đầu!', và người ta trở nên đau khổ, nghĩ rằng: 'Mình có nên kể lại toàn bộ câu chuyện hỗn tạp này theo thứ tự một lần nữa không?', việc kể chuyện đi kèm với khổ thọ. Khi người ta kể nó với một tâm thờ ơ, nó đi kèm với cảm thọ bất khổ bất lạc.

AI Translation Nissaya

hi vitthāremi=To elaborate. ; paresu=when other listeners. ; sādhukāraṃ=acclaim. ; dentesu=are giving, or. ; celādīni=head-wraps, etc.. ; ukkhipantesu=are throwing up. ; haṭṭhatuṭṭhassa=for a person who is happy and delighted. ; vā=or. ; sītāharaṇabhāratayuddhādīni=the abduction of Sītā, the Bhārata war, etc.. ; kathanakāle=at the time of telling. ; so=that idle chatter. ; sukhavedano=is accompanied by pleasant feeling. ; hoti=it is. ; paṭhamaṃ=at first. ; dinnavetanena=with a given reward. ; ekena=by one person. ; pacchā=afterwards. ; āgantvā=having come. ; ādito=from the beginning. ; paṭṭhāya=starting. ; kathehi=please tell it again. ; iti=thus. ; vutte=when it is said. ; nilāvasesaṃ=without remainder. ; vā=or. ; yathānusaddhikaṃ=according to the connection. ; vā=or. ; pakiṇṇakatayaṃ=the miscellaneous talk. ; kathessāminukho=should I recite it?. ; nokathessāmimukho=or should I not recite it?. ; iti=thus. ; domanassitassa=for one who is afflicted with displeasure. ; vā=or. ; kathanakāle=at the time of telling. ; sosamphappalāpo=that idle chatter. ; dukkhavedanā=is accompanied by painful feeling. ; hoti=it is. ; majjhatattatā=for one who is neutral. ; vā=or. ; katayato=while telling. ; vā=or. ; katanakāle=at the time. ; sosamphappalāpo=that idle chatter. ; adukkhamasukhāvedanā=is accompanied by neither-painful-nor-pleasant feeling. ; hoti=it is. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; paresu=တပါးသော နားထောင်သော သူတို့သည်။ ; sādhukāraṃ=ကောင်းချီးုကို။ ; dentesu=ပေးကနု်သော်လည်းကောင်း။ ; celādīni=ဦးရစ်အစရှိသည်တို့ကို။ ; ukkhipantesu=ပစ်မြှောက်ကုန်သော်လည်းကောင်း။ ; haṭṭhatuṭṭhassa=ရွှင်လန်းနှစ်သက်သော စိတ်ရှိသော ပုဂ္ဂိုလ်၏။ ; vā=အား။ ; sītāharaṇabhāratayuddhādīni=တို့ကို။ ; kathanakāle=ပြော ဆိုသောအခါ၌။ ; so=ထိုသမ္ဖပ္ပလာပသည်။ ; sukhavedano=ရှိ၏။ ; hoti=၏။ ; paṭhamaṃ=လက်ဦးက။ ; dinnavetanena=ပေးအပ်သော ဆုလာဘ်အားဖြင့်။ ; ekena=တယောက်သော သူသည်။ ; pacchā=နောက်မှ။ ; āgantvā=လာလှည့်၍။ ; ādito=သီတာ စသော ဝတ္ထု၏ အစမှ။ ; paṭṭhāya=စ၍။ ; kathehi=ပြန်၍ ရွတ်ဆိုဦးလော့။ ; iti=သို့။ ; vutte=ဆိုလှာပြန်သည်ရှိသော်။ ; nilāvasesaṃ=အကြွင်းမဲ့။ ; vā=ဥဿုံ။ ; yathānusaddhikaṃ=အနုသန္ဓေအားလျော်စွာ။ ; vā=အနုသန္ဓေ အတိုင်း။ ; pakiṇṇakatayaṃ=ပကိဏ္ဏကစကားကို။ ; kathessāminukho=ရွတ်ဆိုရဦးလော့။ ; nokathessāmimukho=မရွတ်ဆိုဘဲနေရဦးလော။ ; iti=သို့။ ; domanassitassa=နှလုံးမသာယာခြင်းသို့ ရောက်သော ပုဂ္ဂိုလ်၏။ ; vā=အား။ ; kathanakāle=ရွတ်ဆိုအပ်သော အခါ၌။ ; sosamphappalāpo=သည်။ ; dukkhavedanā=ရှိသည်။ ; hoti=၏။ ; majjhatattatā=လျစ်လျူရှုသည်။ ; vā=လျစ်လျူရှုလျက်။ ; katayato=ရွတ်ဆိုသော ပုဂ္ဂိုလ်၏။ ; vā=အား။ ; katanakāle=၌။ ; sosamphappalāpo=သည်။ ; adukkhamasukhāvedanā=ရှိသည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4095 | Chunk: 68

Abhijjhā sukhamajjhattavasena dvivedanā, tathā micchādiṭṭhi.

AI Translation based on Nissaya

Covetousness is associated with two feelings, by way of pleasant and neutral feeling; the same is true for wrong view.

Vietnamese AI Translation

Tham lam đi kèm với hai cảm thọ, theo phương diện lạc thọ và xả thọ; điều tương tự cũng đúng đối với tà kiến.

AI Translation Nissaya

abhijjhā=Covetousness. ; sukhamajjhattavasena=by the power of pleasant feeling and neutral feeling. ; dvivedanā=is associated with two feelings. ; tathā=Similarly. ; micchādiṭṭhi=wrong view. ; sukhamajjhattavasena=by means of (pleasant and neutral feeling). ; dvivedanā=is associated with two feelings. ;

Myanmar Nissaya

abhijjhā=သည်။ ; sukhamajjhattavasena=သုခဝေဒနာ ဥပေက္ခာဝေဒနာ၏ အစွမ်းအားဖြင့်။ ; dvivedanā=ရှိ၏။ ; tathā=တူ။ ; micchādiṭṭhi=သည်။ ; sukhamajjhattavasena=ဖြင့်။ ; dvivedanā=ရှိ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4096 | Chunk: 69

Byāpādo dukkhavedano.

AI Translation based on Nissaya

Ill will is associated with painful feeling.

Vietnamese AI Translation

Sân hận đi kèm với khổ thọ.

AI Translation Nissaya

byāpādo=Ill will. ; dukkhavedano=is associated with painful feeling. ;

Myanmar Nissaya

byāpādo=သည်။ ; dukkhavedano=ရှိ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4097 | Chunk: 69

Mūlatoti pāṇātipāto dosamohavasena dvimūlako hoti, adinnādānaṃ dosamohavasena vā lobhamohavasena vā, micchācāro lobhamohavasena, musāvādo dosamohavasena vā lobhamohavasena vā.

AI Translation based on Nissaya

From the root: The killing of living beings is two-rooted, by way of hatred and delusion. Taking what is not given is two-rooted, either by way of hatred and delusion or by way of greed and delusion. Sexual misconduct is two-rooted by way of greed and delusion. False speech is two-rooted either by way of hatred and delusion or by way of greed and delusion.

Vietnamese AI Translation

Từ gốc rễ: Sát sanh có hai gốc, theo phương diện sân và si. Lấy của không cho có hai gốc, hoặc theo phương diện sân và si, hoặc theo phương diện tham và si. Tà dâm có hai gốc theo phương diện tham và si. Nói dối có hai gốc hoặc theo phương diện sân và si, hoặc theo phương diện tham và si.

AI Translation Nissaya

mūlatoti=As for 'from the root'. ; pāṇātipāto=The killing of living beings. ; dosamohavasena=by the power of the roots of hatred and delusion. ; dvimūlako=has two roots. ; hoti=is. ; adinnādānaṃ=Taking what is not given. ; dosamoha vasenavā=either by way of hatred and delusion. ; lobhamohavasenavā=or by way of greed and delusion. ; dvimūlakaṃ=has two roots. ; hoti=is. ; micchācāro=Sexual misconduct. ; lobhamohavasena=by way of greed and delusion. ; dvimūlako=has two roots. ; hoti=is. ; musāvādo=False speech. ; dosamohavasenavā=either by way of hatred and delusion. ; lobhamohavasenavā=or by way of greed and delusion. ;

Myanmar Nissaya

mūlatoti=ကား။ ; pāṇātipāto=သည်။ ; dosamohavasena=ဒေါသမူမောဟမူ၏ အစွမ်းဖြင့်။ ; dvimūlako=ရှိသည်။ ; hoti=၏။ ; adinnādānaṃ=သည်။ ; dosamoha vasenavā=လည်းကောင်း။ ; lobhamohavasenavā=လည်းကောင်း။ ; dvimūlakaṃ=သည်။ ; hoti=၏။ ; micchācāro=သည်။ ; lobhamohavasena=ဖြင့်။ ; dvimūlako=သည်။ ; hoti=၏။ ; musāvādo=သည်။ ; dosamohavasenavā=ဖြင့်လည်းကောင်း။ ; lobhamohavasenavā=ဖြင့်လည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4098 | Chunk: 69

Tathā pisuṇā vācā samphappalāpo ca.

AI Translation based on Nissaya

The same is true for slanderous speech and idle chatter.

Vietnamese AI Translation

Điều tương tự cũng đúng đối với nói đâm thọc và nói phù phiếm.

AI Translation Nissaya

samphappalāpoca=And idle chatter also. ; dosamohavasenavā=either by way of hatred and delusion. ; lobhamohavasenavā=or by way of greed and delusion. ; dvimūlako=are two-rooted. ; hoti=are. ;

Myanmar Nissaya

samphappalāpoca=သည်လည်း။ ; dosamohavasenavā=ဖြင့်လည်းကောင်း။ ; lobhamohavasenavā=ဖြင့်လည်းကောင်း။ ; dvimūlako=သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4099 | Chunk: 69

Pharusā vācā dosamohavasena, abhijjhā mohavasena ekamūlā, tathā byāpādo.

AI Translation based on Nissaya

Harsh speech is by way of hatred and delusion; covetousness is one-rooted by way of delusion, and ill will is likewise one-rooted.

Vietnamese AI Translation

Nói lời thô ác là do sân và si; tham lam là một gốc do si, và sân hận cũng vậy là một gốc.

AI Translation Nissaya

pharusavācā=Harsh speech. ; dosamohavasena=is by way of hatred and delusion. ; ekamūlā=is one-rooted. ; tathā=Similarly. ; byāpādo=ill will. ; ekamūlo=is one-rooted. ;

Myanmar Nissaya

pharusavācā=သည်။ ; dosamohavasena=ဖြင့်။ ; ekamūlā=တစ်ပါးသော မူလရှိ၏။ ; tathā=တူ။ ; byāpādo=သည်။ ; ekamūlo=တစ်ပါးသော မူလရှိ၏။။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4100 | Chunk: 69

Micchādiṭṭhi lobhamohavasena dvimūlāti.

AI Translation based on Nissaya

Wrong view is two-rooted by way of greed and delusion; thus it should be understood.

Vietnamese AI Translation

Tà kiến có hai gốc theo phương diện tham và si; do đó nó nên được hiểu như vậy.

AI Translation Nissaya

micchādiṭṭhi=Wrong view. ; lobhamohavasena=by way of greed and delusion. ; dvimūlā=has two roots. ; iti=Thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

micchādiṭṭhi=သည်။ ; lobhamohavasena=ဖြင့်။ ; dvimūlā=နှစ်ပါးသော မူလရှိ၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4101 | Chunk: 69

Akusalakammapathakathā niṭṭhitā.

AI Translation based on Nissaya

The discourse on the paths of unwholesome action is finished.

Vietnamese AI Translation

Phần luận về các nghiệp đạo bất thiện đã kết thúc.

AI Translation Nissaya

akusalakammapathakathā=The discourse on the paths of unwholesome action. ; niṭṭhitā=is finished. ;

Myanmar Nissaya

akusalakammapathakathā=သည်။ ; niṭṭhitā=ပြီ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4102 | Chunk: 69

Pāṇātipātādīhi [V1.191] pana viratiyo, anabhijjhāabyāpādasammādiṭṭhiyo cāti ime dasa kusalakammapathā nāma.

AI Translation based on Nissaya

Now [V1.191], the abstinences from the killing of living beings and so on, and non-covetousness, non-ill will, and right view—these ten are called the wholesome paths of action.

Vietnamese AI Translation

Bây giờ [V1.191], sự kiêng cữ sát sanh v.v., và vô tham, vô sân, và chánh kiến—mười điều này được gọi là các nghiệp đạo thiện.

AI Translation Nissaya

pana=Now, apart from the unwholesome paths of action, I shall speak of the wholesome paths of Dhamma. ; pāṇātipātādīhi=from the seven beginning with the killing of living beings. ; viratiyo=the abstinences. ; anabhijjhāabyāpādasammādiṭṭhiyoca=and non-covetousness, non-ill will, and right view. ; iti ime=These dhammas. ; dasa=ten. ; kusalakammapathānāma=are called the wholesome paths of action. ;

Myanmar Nissaya

pana=အကုသလကမ္မပထမှတစ်ပါး ကုသလဓမ္မပထကို ဆိုဦးအံ့။ ; pāṇātipātādīhi=ပါဏာတိပါတ အစရှိသော ခုနစ်ပါးတို့မှ။ ; viratiyo=ကြဉ်ကြောင်းဖြစ်သော စကားတို့သည်။ ; anabhijjhāabyāpādasammādiṭṭhiyoca=အနဘိဇ္ဈာ အဗျာပါဒ သမ္မာဒိဋ္ဌိတို့လည်းကောင်း။ ; iti ime=ဤတရားတို့သည်။ ; dasa=ကုန်သော။ ; kusalakammapathānāma=မည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4103 | Chunk: 69

Pāṇātipātādīhi etāya viramanti, sayaṃ vā viramati, viramaṇamattameva vā etanti virati.

AI Translation based on Nissaya

One abstains from killing living beings and so on by means of it, or one abstains by oneself, or it is merely the act of abstaining; thus it is called abstinence (`virati`).

Vietnamese AI Translation

Người ta kiêng cữ sát sanh v.v. bằng phương tiện của nó, hoặc người ta tự mình kiêng cữ, hoặc nó chỉ đơn thuần là hành động kiêng cữ; do đó nó được gọi là sự kiêng cữ (`virati`).

AI Translation Nissaya

etāyadhammajātiyā=By this nature of Dhamma. ; pāṇātipātādīhi=from killing living beings and so on. ; vīramanti=they abstain. ; ivitasmā=Therefore. ; virati=it is called 'abstinence'. ;

Myanmar Nissaya

etāyadhammajātiyā=ဤတရားသဘောဖြင့်။ ; pāṇātipātādīhi=တို့မှ။ ; vīramanti=ကြဉ်တတ်ကုန်၏။ ; ivitasmā=ကြောင့်။ ; virati=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4104 | Chunk: 69

Yā pāṇātipātādīhi viramantassa kusalacittasampayuttā virati, sā pabhedato tividhā hoti sampattavirati samādānavirati samucchedaviratīti.

AI Translation based on Nissaya

The abstinence associated with a wholesome mind in one who refrains from killing living beings and so on, that abstinence is of three kinds by way of its division: abstinence on the occasion, abstinence by undertaking, and abstinence by eradication.

Vietnamese AI Translation

Sự kiêng cữ tương ưng với một tâm thiện ở người kiềm chế sát sanh v.v., sự kiêng cữ đó có ba loại theo cách phân chia của nó: kiêng cữ theo trường hợp, kiêng cữ do thọ trì, và kiêng cữ do đoạn trừ.

AI Translation Nissaya

pāṇātipātādīhi=from killing living beings and so on. ; viramantassa=of a person who abstains. ; kusalacittasampayuttā=associated with a wholesome mind. ; yā virati=whatever abstinence. ; atthi=there is. ; sāvirati=that abstinence. ; pabhedato=by way of division. ; sampattavirati=abstinence on the occasion. ; samādānavirati=abstinence by undertaking. ; samuccheda virati=abstinence by eradication. ; ivi=as. ; tividhā=is of three kinds. ; hoti=is. ;

Myanmar Nissaya

pāṇātipātādīhi=တို့မှ။ ; viramantassa=ကြဉ်သော ပုဂ္ဂိုလ်၏။ ; kusalacittasampayuttā=သော။ ; yā virati=သည်။ ; atthi=၏။ ; sāvirati=သည်။ ; pabhedato=ဖြင့်။ ; sampattavirati=လည်းကောင်း။ ; samādānavirati=လည်းကောင်း။ ; samuccheda virati=လည်းကောင်း။ ; ivi=သို့။ ; tividhā=သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4105 | Chunk: 69

Tattha asamādinnasikkhāpadānaṃ attano jātivayabāhusaccādīni paccavekkhitvā ‘‘ayuttaṃ amhākaṃ evarūpaṃ pāpaṃ kātun’’ ti sampattavatthuṃ avītikkamantānaṃ uppajjamānā virati sampattavirati nāma.

AI Translation based on Nissaya

Among these, for those who have not undertaken the training rules, the abstinence that arises when they do not transgress against an object that has presented itself, having reflected on their own birth, age, learning, and so on, thinking, 'It is unsuitable for us to do such an evil deed,' is called abstinence on the occasion.

Vietnamese AI Translation

Trong số này, đối với những người chưa thọ trì các học giới, sự kiêng cữ phát sinh khi họ không vi phạm đối với một đối tượng đã hiện ra, sau khi đã suy ngẫm về sự sanh, tuổi tác, học vấn của mình, v.v., nghĩ rằng, 'Chúng ta không nên làm một việc ác như vậy,' được gọi là kiêng cữ theo trường hợp.

AI Translation Nissaya

tattha=Among those three. ; attano=one's own. ; jātivayabāhusaccādīni=birth, age, learning, and so on. ; paccavekkhitvā=having reflected on. ; amhākaṃ=for us. ; evarūpaṃ=such. ; pāpaṃ=an evil deed. ; kātuṃ=to do. ; ayuttaṃ=is unsuitable. ; iti=thus. ; sampattavatthuṃ=an object that has presented itself. ; avītikkamantānaṃ=of those who do not transgress. ; asamādinnasikkhāpadānaṃ=of persons who have not undertaken the training rules. ; vā=or, of persons who have not undertaken the training rules. ; vā=their. ; uppajjamānā=the arising. ; virati=abstinence. ; sampatthaviratināma=is called 'abstinence on the occasion'. ;

Myanmar Nissaya

tattha=ထိုသုံးပါးတို့တွင်။ ; attano=မိမိ၏။ ; jātivayabāhusaccādīni=အမျိုးဇာတ်, အရွယ် အကြားအမြင် ရှိသည်တို့ကို။ ; paccavekkhitvā=ဆင်ခြင်၍။ ; amhākaṃ=ငါတိုအား။ ; evarūpaṃ=သော။ ; pāpaṃ=သောအမှုကို။ ; kātuṃ=ငှါ။ ; ayuttaṃ=ချေ။ ; iti=သို့။ ; sampattavatthuṃ=ရောက်သော ဝတ္ထုကို။ ; avītikkamantānaṃ=မလွန်ကျူးကုန်သော။ ; asamādinnasikkhāpadānaṃ=မဆောက်တည်အပ်သော သိက္ခာပုဒ်ရှိကုန်သော ပုဂ္ဂိုလ်တို့အား။ ; vā=သိက္ခာပုဒ်ကို မဆောက်တည်ခဲ့သော ပုဂ္ဂိုလ်တို့အား။ ; vā=တို့၏။ ; uppajjamānā=ဖြစ်လတ္တံ့သော။ ; virati=သည်။ ; sampatthaviratināma=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4106 | Chunk: 69

Samādinnasikkhāpadānaṃ pana sikkhāpadasamādāne ca tatuttari ca attano jīvitampi [P1.225] pariccajitvā vatthuṃ avītikkamantānaṃ uppajjamānā virati samādānavirati nāma.

AI Translation based on Nissaya

Now, for those who have undertaken the training rules, the abstinence that arises when they do not transgress against the object, giving up even their own life [P1.225], both at the time of undertaking the training rule and thereafter, is called abstinence by undertaking.

Vietnamese AI Translation

Bây giờ, đối với những người đã thọ trì các học giới, sự kiêng cữ phát sinh khi họ không vi phạm đối với đối tượng, từ bỏ cả mạng sống của mình [P1.225], cả tại thời điểm thọ trì học giới và sau đó, được gọi là kiêng cữ do thọ trì.

AI Translation Nissaya

pana=Now, I shall speak of abstinence by undertaking. ; sikkhāpadasamādāneca=both in the undertaking of the training rule. ; tatuttarica=and in what is beyond that undertaken training rule. ; attano=one's own. ; jīvitampi=even life. ; pariccajitvā=having given up. ; vatthuṃ=the object. ; avītikkamantānaṃ=of those who do not transgress. ; samādinnasikkhāpadānaṃ=of persons who have undertaken the training rules. ; vā=their. ; uppajjamānā=the arising. ; virati=abstinence. ; samādānavirati nāma=is called 'abstinence by undertaking'. ;

Myanmar Nissaya

pana=သမာဒါနဝိရတီကို ဆိုအံ့။ ; sikkhāpadasamādāneca=ခြင်း၌လည်းကောင်း။ ; tatuttarica=ထို ဆောက် တည်အပ်သော သိက္ခာပုဒ်ထက် လွန်သော သိက္ခာ ပုဒ်၌လည်းကောင်း။ ; attano=၏။ ; jīvitampi=ကိုလည်း။ ; pariccajitvā=၍။ ; vatthuṃ=ကို။ ; avītikkamantānaṃ=ကုန်သော။ ; samādinnasikkhāpadānaṃ=ကုန်သော ပုဂ္ဂိုလ်တို့အား။ ; vā=တို့၏။ ; uppajjamānā=သော။ ; virati=သည်။ ; samādānavirati nāma=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4107 | Chunk: 69

Ariyamaggasampayuttā pana virati samucchedavirati nāma, yassā uppattito pabhuti ariyapuggalānaṃ ‘‘pāṇaṃ ghātessāmā’’ tiādicittampi na uppajjatīti.

AI Translation based on Nissaya

Now, the abstinence associated with the noble path is called abstinence by eradication, from the arising of which onward, for noble individuals, not even a thought such as, 'I will kill a living being,' arises. Thus it should be understood.

Vietnamese AI Translation

Bây giờ, sự kiêng cữ tương ưng với thánh đạo được gọi là kiêng cữ do đoạn trừ, từ khi nó phát sinh trở đi, đối với các bậc thánh, thậm chí không một ý nghĩ nào như, 'Tôi sẽ giết một chúng sanh,' khởi lên. Do đó nó nên được hiểu như vậy.

AI Translation Nissaya

pana=Now, I shall speak of abstinence by eradication. ; ariyamaggasampayuttā=associated with the noble path. ; virati=The abstinence. ; samuccheda viratināma=is called 'abstinence by eradication'. ; yassā=of which abstinence by eradication. ; uppattito=from its arising. ; pabhuti=onward. ; ariya puggalānaṃ=for noble individuals. ; pāṇaṃ=a living being. ; ghātessāmi=I will kill. ; ivi ādicittampi=even the thought beginning with. ; na uppajjati=does not arise. ; iti=Thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

pana=သမုစ္ဆေဒဝိရတီကို ဆိုဦးအံ့။ ; ariyamaggasampayuttā=နှင့်ယှဉ်သော။ ; virati=သည်။ ; samuccheda viratināma=မည်၏။ ; yassā=အကြင်သမုစ္ဆေဒဝိရတီ၏။ ; uppattito=ဖြစ်သည်မှ။ ; pabhuti=၍။ ; ariya puggalānaṃ=တို့အား။ ; pāṇaṃ=ကို။ ; ghātessāmi=သတ်အံ့။ ; ivi ādicittampi=သည်လည်း။ ; na uppajjati=မဖြစ်။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4108 | Chunk: 69

Idāni [M1.209] akusalakammapathānaṃ viya imesaṃ kusalakammapathānaṃ dhammato, koṭṭhāsato, ārammaṇato, vedanāto, mūlatoti pañcahākārehi vinicchayo veditabbo.

AI Translation based on Nissaya

Now [M1.209], just as for the unwholesome paths of action, the analysis of these wholesome paths of action should be understood in five aspects: by way of their nature, components, object, feeling, and root.

Vietnamese AI Translation

Bây giờ [M1.209], cũng giống như đối với các nghiệp đạo bất thiện, sự phân tích về các nghiệp đạo thiện này nên được hiểu theo năm khía cạnh: theo phương diện bản chất, thành phần, đối tượng, cảm thọ và gốc rễ của chúng.

AI Translation Nissaya

idāni=Now. ; akusalakammapathānaṃ=of the unwholesome paths of action. ; vinicchayo=the analysis. ; veditabboviya=just as it should be understood. ; imesaṃ kusalakammapathānaṃ=of these wholesome paths of action. ; dhammato=by way of nature. ; koṭṭhāsato=by way of components. ; arammaṇato=by way of object. ; vedanato=by way of feeling. ; mūlato=by way of root. ; iti=thus. ; pañcahi=five. ; ākārehi=by aspects. ; vinicchayo=the analysis. ; veditabbo=should be understood. ;

Myanmar Nissaya

idāni=၌။ ; akusalakammapathānaṃ=တို့၏။ ; vinicchayo=ကို။ ; veditabboviya=ကဲ့သို့။ ; imesaṃ kusalakammapathānaṃ=တို့၏။ ; dhammato=အားဖြင့် လည်းကောင်း။ ; koṭṭhāsato=အားဖြင့်လည်းကောင်း။ ; arammaṇato=အားဖြင့်လည်းကောင်း။ ; vedanato=အားဖြင့်လည်းကောင်း။ ; mūlato=အားဖြင့် လည်းကောင်း။ ; iti=သို့။ ; pañcahi=ကုန်သော။ ; ākārehi=တို့ဖြင့်။ ; vinicchayo=ကို။ ; veditabbo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4109 | Chunk: 69

Tattha dhammatoti etesupi paṭipāṭiyā satta cetanāpi vaṭṭanti viratiyopi, ante tayo cetanāsampayuttāva.

AI Translation based on Nissaya

Therein, as for by way of nature, among these, the first seven in sequence are valid both as volitions and as abstinences; the last three are only states associated with volition.

Vietnamese AI Translation

Trong đó, về theo phương diện bản chất, trong số này, bảy nghiệp đạo đầu tiên theo thứ tự có giá trị cả như tư tâm và như sự kiêng cữ; ba nghiệp đạo cuối cùng chỉ là các trạng thái tương ưng với tư.

AI Translation Nissaya

tattha=Among those five. ; dhammatoti=As for 'by way of nature'. ; etesupi=among these ten wholesome paths of action also. ; paṭipāṭiyā=in sequence. ; satta=the seven wholesome paths of action. ; cetanāpi=(as) volitions also. ; vaṭṭanti=are valid. ; viratiyopi=(as) abstinences also. ; vaṭṭanti=are valid. ; ante=at the end. ; tayo=the three. ; cetanāsampayuttāva=are only states associated with volition. ; vaṭṭanti=are valid. ;

Myanmar Nissaya

tattha=ထိုငါးပါးတို့တွင်။ ; dhammatoti=ကား။ ; etesupi=ဤဆယ်ပါးသော ကုသလကမ္မပထတို့တွင်လည်း။ ; paṭipāṭiyā=ဖြင့်။ ; satta=ခုနစ်ပါးသော ကုသလကမ္မပထတို့သည်။ ; cetanāpi=တို့သည်လည်း။ ; vaṭṭanti=ကုန်၏။ ; viratiyopi=တို့သည်လည်း။ ; vaṭṭanti=ကုန်၏။ ; ante=အဆုံး၌။ ; tayo=ကုန်သော။ ; cetanāsampayuttāva=စေတနာနှင့်ယှဉ္သော တရားတို့သည်သာလျှင်။ ; vaṭṭanti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4110 | Chunk: 69

Koṭṭhāsatoti paṭipāṭiyā satta kammapathā eva, no mūlāni, ante tayo kammapathā ceva mūlāni ca.

AI Translation based on Nissaya

By way of components: the first seven in sequence are only paths of action, not roots; at the end, the three are both paths of action and roots.

Vietnamese AI Translation

Theo phương diện thành phần: bảy nghiệp đạo đầu tiên theo thứ tự chỉ là các nghiệp đạo, không phải là gốc rễ; ở cuối, ba nghiệp đạo vừa là nghiệp đạo vừa là gốc rễ.

AI Translation Nissaya

koṭṭhāsatoti=As for 'by way of components'. ; paṭipāṭiyā=in sequence. ; satta=the seven. ; kammapathāeva=are only paths of action. ; nomūlāni=they are not called roots. ; ante=at the end. ; tayo=the three—non-covetousness, non-ill will, and right view. ; kammapathāceva=are called both paths of action. ; mūlānica=and also roots. ;

Myanmar Nissaya

koṭṭhāsatoti=ကား။ ; paṭipāṭiyā=ဖြင့်။ ; satta=တို့သည်။ ; kammapathāeva=ကမ္မပထသာမည်ကုန်၏။ ; nomūlāni=မူလမမည်ကနု်။ ; ante=အဆုံး၌။ ; tayo=ကနု်သော အနဘိဇ္ဈာ အဗျာပါဒ သမ္မာဒိဋ္ဌိတို့သည်။ ; kammapathāceva=လည်းမည်ကုန်၏။ ; mūlānica=လည်းမည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4111 | Chunk: 69

Anabhijjhā hi mūlaṃ patvā alobho kusalamūlaṃ hoti, abyāpādo adoso kusalamūlaṃ, sammādiṭṭhi amoho kusalamūlaṃ.

AI Translation based on Nissaya

Indeed, non-covetousness, when it becomes a root, is the wholesome root of non-greed; non-ill will is the wholesome root of non-hatred; and right view is the wholesome root of non-delusion.

Vietnamese AI Translation

Thật vậy, vô tham, khi nó trở thành một gốc rễ, là gốc rễ thiện của vô tham; vô sân là gốc rễ thiện của vô sân; và chánh kiến là gốc rễ thiện của vô si.

AI Translation Nissaya

hi vitthāremi=Indeed, I shall elaborate. ; anabhijjhā=Non-covetousness. ; mūlaṃ=to the position of a root. ; patvā=having reached. ; alobho=called non-greed. ; kusalamūlaṃ=is a wholesome root. ; hoti=is. ; abyāpādo=Non-ill will. ; adoso=called non-hatred. ; kusalamūlaṃ=is a wholesome root. ; hoti=is. ; sammādiṭṭhi=Right view. ; amoto=called non-delusion. ; kusalamūlaṃ=is a wholesome root. ; hoti=is. ;

Myanmar Nissaya

hi vitthāremi=အံ့။ ; anabhijjhā=သည်။ ; mūlaṃ=မူလအရာသို့။ ; patvā=၍။ ; alobho=အလောဘဟု ဆိုအပ်သော။ ; kusalamūlaṃ=သည်။ ; hoti=၏။ ; abyāpādo=သည်။ ; adoso=ဟူသော။ ; kusalamūlaṃ=သည်။ ; hoti=၏။ ; sammādiṭṭhi=သည်။ ; amoto=ဟူသော။ ; kusalamūlaṃ=သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4112 | Chunk: 69

Ārammaṇatoti pāṇātipātādīnaṃ ārammaṇāneva etesaṃ ārammaṇāni.

AI Translation based on Nissaya

By way of object: the very objects of the unwholesome paths of action, beginning with the killing of living beings, are the objects of these wholesome paths.

Vietnamese AI Translation

Theo phương diện đối tượng: chính những đối tượng của các nghiệp đạo bất thiện, bắt đầu bằng việc sát sanh, là đối tượng của các nghiệp đạo thiện này.

AI Translation Nissaya

ārammaṇatoti=As for 'by way of object'. ; pāṇātipātādīnaṃ=of the unwholesome paths of action beginning with killing living beings. ; ārammaṇāneva=the very objects. ; etesaṃ=of these ten paths of action. ; ārammaṇāni=are the objects. ;

Myanmar Nissaya

ārammaṇatoti=ကား။ ; pāṇātipātādīnaṃ=အစရှိသော အကုသလကမ္မပထတို့၏။ ; ārammaṇāneva=အာရုံတို့သည်ပင်လျှင်။ ; etesaṃ=ထိုဆယ်ပါးသော ကမ္မပထတို့၏။ ; ārammaṇāni=အာရုံမည်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4113 | Chunk: 69

Vītikkamitabbatoyeva hi veramaṇī nāma hoti.

AI Translation based on Nissaya

For it is only from an object that can be transgressed against that there is what is called 'abstinence'.

Vietnamese AI Translation

Vì chỉ từ một đối tượng có thể bị vi phạm mới có cái gọi là 'sự kiêng cữ'.

AI Translation Nissaya

hi saccaṃ=Truly. ; vītikkamitabbatoyeva=only from an object that can be transgressed against. ; veramaṇīnāma=is what is called 'abstinence'. ; hoti=is. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; vītikkamitabbatoyeva=လွန်ကျူးအပ်သော ဝတ္ထုမှသာလျှင်။ ; veramaṇīnāma=ကြဉ်ခြင်းမည်သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4114 | Chunk: 69

Yathā pana nibbānārammaṇo ariyamaggo kilese pajahati, evaṃ jīvitindriyādiārammaṇāpete kammapathā pāṇātipātādīni dussīlyāni pajahantīti.

AI Translation based on Nissaya

Just as the noble path, which has Nibbāna as its object, abandons the defilements, so too these paths of action, which have the life faculty and so on as their object, abandon the states of unvirtuous conduct, such as the killing of living beings. Thus it should be understood.

Vietnamese AI Translation

Cũng như thánh đạo, có Nibbāna làm đối tượng, từ bỏ các phiền não, thì các nghiệp đạo này, có mạng căn v.v. làm đối tượng, cũng từ bỏ các trạng thái vô giới, như sát sanh. Do đó nó nên được hiểu như vậy.

AI Translation Nissaya

pana taṃ pākaṭaṃ karomi=Now I shall make that clear. ; nibbānā rammaṇo=which has Nibbāna as its object. ; ariyamaggo=The noble path. ; kilase=the defilements. ; pajahati yathā=abandons, just as. ; evaṃ tathā=similarly. ; jīvitindrediārammaṇāpi=these which also have the life faculty, etc., as their object. ; etekammapathā=these paths of action. ; pāṇātipātādīni=beginning with killing of living beings. ; dussīlyāni=the states of being unvirtuous. ; pajahanti=abandon. ; iti=Thus.‌ ; veditabbā=they should be understood. ;

Myanmar Nissaya

pana taṃ pākaṭaṃ karomi=အံ့။ ; nibbānā rammaṇo=ရှိသော။ ; ariyamaggo=သည်။ ; kilase=တို့ကို။ ; pajahati yathā=သို့။ ; evaṃ tathā=တူ။ ; jīvitindrediārammaṇāpi=သည်လျှင် အာရုံရှိသည်လည်းဖြစ်ကုန်သော။ ; etekammapathā=တို့သည်။ ; pāṇātipātādīni=ကုန်သော။ ; dussīlyāni=သီလမရှိသော ပုဂ္ဂိုလ်၏ အဖြစ်တို့ကို။ ; pajahanti=ကုန်၏။ ; iti=သို့။‌ ; veditabbā=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4115 | Chunk: 69

Vedanātoti sabbe sukhavedanā vā honti majjhattavedanā vā.

AI Translation based on Nissaya

By way of feeling: all the wholesome paths of action are associated either with pleasant feeling or with neutral feeling.

Vietnamese AI Translation

Theo phương diện cảm thọ: tất cả các nghiệp đạo thiện đều đi kèm với lạc thọ hoặc xả thọ.

AI Translation Nissaya

vedanātoti=As for 'by way of feeling'. ; sabbe=all the wholesome paths of action. ; sukhavedanāvā=either have pleasant feeling. ; honti=are. ; majjhattavedanāvā=or have neutral feeling. ; honti=are. ;

Myanmar Nissaya

vedanātoti=ကား။ ; sabbe=ဥဿုံကုန်သော ကုသလကမ္မပထတရားတို့သည်။ ; sukhavedanāvā=ရှိကုန်သည်လည်း။ ; honti=ကုန်၏။ ; majjhattavedanāvā=ဥပေက္ခာဝေဒနာ ရှိကုန်သည်လည်း။ ; honti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4116 | Chunk: 69

Kusalaṃ patvā hi dukkhā vedanā nāma natthi.

AI Translation based on Nissaya

For, in the domain of the wholesome, what is called painful feeling does not exist.

Vietnamese AI Translation

Vì, trong lĩnh vực của thiện, cái gọi là khổ thọ không tồn tại.

AI Translation Nissaya

hi saccaṃ=Truly. ; kusalaṃ=to the domain of the wholesome. ; patvā=having reached. ; dukkhāvedanānāma=what is called painful feeling does not exist. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; kusalaṃ=၏ အရာသို့။ ; patvā=၍။ ; dukkhāvedanānāma=တို့သည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4117 | Chunk: 69

Mūlatoti paṭipāṭiyā satta ñāṇasampayuttacittena viramantassa alobhaadosaamohavasena timūlā [V1.192] honti.

AI Translation based on Nissaya

By way of root: For a person who abstains with a mind associated with knowledge, the seven in sequence are three-rooted [V1.192] by way of non-greed, non-hatred, and non-delusion.

Vietnamese AI Translation

Theo phương diện gốc rễ: Đối với một người kiêng cữ với tâm tương ưng với trí, bảy nghiệp đạo theo thứ tự có ba gốc [V1.192] theo phương diện vô tham, vô sân và vô si.

AI Translation Nissaya

ñāṇasampayuttacittena=with a mind associated with knowledge. ; viramantassa=for a person who abstains. ; alobhaadosa amohavasena=by way of non-greed, non-hatred, and non-delusion. ; timūlā=they have three roots. ; honti=they are. ;

Myanmar Nissaya

ñāṇasampayuttacittena=ဖြင့်။ ; viramantassa=ကြဉ်သော ပုဂ္ဂိုလ်အား။ ; alobhaadosa amohavasena=တို့၏ အစွမ်းအားဖြင့်။ ; timūlā=ရှိကုန်သည်။ ; honti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4118 | Chunk: 69

Ñāṇavippayuttacittena viramantassa alobhādosavasena dvimūlā.

AI Translation based on Nissaya

For one who abstains with a mind dissociated from knowledge, they are two-rooted by way of non-greed and non-hatred.

Vietnamese AI Translation

Đối với người kiêng cữ với tâm không tương ưng với trí, chúng có hai gốc theo phương diện vô tham và vô sân.

AI Translation Nissaya

ñāṇavippayuttacittena=with a mind dissociated from knowledge. ; viramantassa=for a person who abstains. ; alobhādosavasena=by way of non-greed and non-hatred. ; dvimūlā=they have two roots. ; honti=they are. ;

Myanmar Nissaya

ñāṇavippayuttacittena=ဖြင့်။ ; viramantassa=အား။ ; alobhādosavasena=ဖြင့်။ ; dvimūlā=ကုန်သည်။ ; honti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4119 | Chunk: 69

Anabhijjhā ñāṇasampayuttacittena viramantassa adosaamohavasena dvimūlā.

AI Translation based on Nissaya

For one who abstains from non-covetousness with a mind associated with knowledge, it is two-rooted by way of non-hatred and non-delusion.

Vietnamese AI Translation

Đối với người kiêng cữ vô tham với tâm tương ưng với trí, nó có hai gốc theo phương diện vô sân và vô si.

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4120 | Chunk: 69

Ñāṇavippayuttacittena viramantassa adosavasena ekamūlā.

AI Translation based on Nissaya

For one who abstains with a mind dissociated from knowledge, it is one-rooted by way of non-hatred.

Vietnamese AI Translation

Đối với người kiêng cữ với tâm không tương ưng với trí, nó có một gốc theo phương diện vô sân.

AI Translation Nissaya

anabhijjhā=Non-covetousness. ; ñāṇasampayuttacittena=with a mind associated with knowledge. ; abhijjhaṃ=from covetousness. ; viramantassa=for one who abstains. ; adosavasena=by way of non-hatred. ; ekamūlā=is one-rooted. ;

Myanmar Nissaya

anabhijjhā=သည်။ ; ñāṇasampayuttacittena=ဖြင့်။ ; abhijjhaṃ=ကို။ ; viramantassa=အား။ ; adosavasena=ဖြင့်။ ; ekamūlā=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4121 | Chunk: 69

Kusalakammapathakathā niṭṭhitā.

AI Translation based on Nissaya

The discourse on the wholesome paths of action is finished.

Vietnamese AI Translation

Phần luận về các nghiệp đạo thiện đã kết thúc.

AI Translation Nissaya

kusalakammapathakathā=The discourse on the wholesome paths of action. ; niṭṭhitā=is finished. ;

Myanmar Nissaya

kusalakammapathakathā=သည်။ ; niṭṭhitā=ပြီ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4122 | Chunk: 69

Evaṃ dasakusalakammapathavasena sīlaṃ dassetvā idāni nekkhammādīnaṃ arahattamaggapariyosānānaṃ sattatiṃsadhammānaṃ vasena dassetuṃ nekkhammena kāmacchandaṃ saṃvaraṭṭhena sīlaṃ , avītikkamaṭṭhena sīlan tiādimāha.

AI Translation based on Nissaya

Having thus shown morality by way of the ten wholesome paths of action, now, in order to show it by way of the thirty-seven factors beginning with renunciation and ending with the path of arahatship, he said the passage beginning: By renunciation there is restraint from sensual desire; by restraint it is morality; by non-transgression it is morality.

Vietnamese AI Translation

Sau khi đã trình bày giới theo phương diện mười nghiệp đạo thiện, bây giờ, để trình bày nó theo phương diện ba mươi bảy yếu tố bắt đầu bằng xuất ly và kết thúc bằng đạo A-la-hán, ngài đã nói đoạn kinh bắt đầu: Bằng sự xuất ly có sự thu thúc khỏi dục ái; bằng sự thu thúc nó là giới; bằng sự không vi phạm nó là giới.

AI Translation Nissaya

evaṃ=In this way. ; dasakusalakammapathavasena=by way of the ten wholesome paths of action. ; sīlaṃ=morality. ; dassetvā=having shown. ; īdāni=now. ; nekkhammādīnaṃ=beginning with renunciation. ; arahattamaggapariyosānaṃ=ending with the path of arahatship. ; sattatiṃ sadhammānaṃ=of the thirty-seven dhammas. ; vasena=by way of. ; dassetuṃ=in order to show. ; nekkhammena.la. sīlantiādiṃ=the passage beginning with 'By renunciation...morality'. ; dhammasenāpatitthero=the Elder, the General of the Dhamma. ; āha=said. ;

Myanmar Nissaya

evaṃ=နည်းဖြင့်။ ; dasakusalakammapathavasena=ဖြင့်။ ; sīlaṃ=ကို။ ; dassetvā=၍။ ; īdāni=၌။ ; nekkhammādīnaṃ=နေက္ခမ္မပုဒ်လျှင် အစရှိကုန်သော။ ; arahattamaggapariyosānaṃ=ကုန်သော။ ; sattatiṃ sadhammānaṃ=တို့၏။ ; vasena=ဖြင့်။ ; dassetuṃ=ငှါ။ ; nekkhammena.la. sīlantiādiṃ=ကို။ ; dhammasenāpatitthero=သည်။ ; āha=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4123 | Chunk: 69

Tattha yasmā nekkhammena kāmacchandaṃ saṃvarati na vītikkamati, tasmā nekkhammaṃ sīlanti adhippāyo.

AI Translation based on Nissaya

Therein, the intention of the passage beginning with, 'By renunciation...morality,' is: because one restrains and obstructs sensual desire by renunciation (i.e., jhāna) and does not transgress, therefore renunciation is called morality.

Vietnamese AI Translation

Trong đó, ý nghĩa của đoạn bắt đầu bằng, ‘Bằng sự xuất ly... là giới,’ là: vì người ta chế ngự và ngăn chặn dục tham bằng sự xuất ly (tức là, thiền-na) và không vi phạm, do đó sự xuất ly được gọi là giới.

AI Translation Nissaya

tattha=Therein. ; nekkhammena.la. sīlaṃ=in the passage beginning with 'By renunciation...morality'. ; yasmā=Because. ; nekkhammena=by jhāna (renunciation). ; kāmacchandaṃ=sensual desire. ; saṃvarati=one restrains and obstructs. ; navītikkamati=one does not transgress. ; tasmā=Therefore. ; nekkhammaṃ=jhāna (renunciation). ; sīlaṃ=is called morality. ; itiayaṃ=This. ; adhippāyo=is the intention. ;

Myanmar Nissaya

tattha=ကို။ ; nekkhammena.la. sīlaṃ=အစရှိသော ပါဌ်၌။ ; yasmā=ကြောင့်။ ; nekkhammena=ဈာန်ဖြင့်။ ; kāmacchandaṃ=ကို။ ; saṃvarati=စောင့်ရှောက်ပိတ်ပင်၏။ ; navītikkamati=မလွန်ကျူး။ ; tasmā=ကြောင့်။ ; nekkhammaṃ=ဈာန်သည်။ ; sīlaṃ=မည်၏။ ; itiayaṃ=ကား။ ; adhippāyo=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4124 | Chunk: 69

Paccattatthe vā karaṇavacanaṃ, nekkhammanti attho.

AI Translation based on Nissaya

Alternatively, the instrumental case is used in the sense of the agent (nominative). The meaning is: 'Renunciation is called morality.' (Note: As in the previous method, the word `nekkhammena` can be construed as a nominative agent to facilitate the connection).

Vietnamese AI Translation

Hoặc cách khác, công cụ cách được dùng theo nghĩa của tác nhân (chủ cách). Nghĩa là: ‘Sự xuất ly được gọi là giới.’ (Lưu ý: Giống như trong phương pháp trước, từ `nekkhammena` có thể được hiểu là một tác nhân ở chủ cách để thuận lợi cho việc kết nối).

AI Translation Nissaya

paccattatte=In the sense of the agent (nominative). ; karaṇavacanaṃ=the instrumental case is used. ; nekkhammaṃ=Renunciation. ; sīlaṃ=is called morality. ; itiayaṃ=This. ; attho=is the meaning. ; (As in the previous method, it is desired to assist the connection by making the word 'nekkhammena' the nominative agent.). ;

Myanmar Nissaya

paccattatte=၌။ ; karaṇavacanaṃ=ဝိဘတ်တည်း။ ; nekkhammaṃ=ဈာန်သည်။ ; sīlaṃ=မည်၏။ ; itiayaṃ=ကား။ ; attho=တည်း။ ; (ရှေ့နည်း၌ နေက္ခမ္မေန ဟူသော ပုဒ်ကို ပဌမာကတ္တားပြု၍ သမ္ဗန်ကူလို)။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4125 | Chunk: 69

Esa [P1.226] nayo [M1.210] sesesu.

AI Translation based on Nissaya

This [P1.226] same method [M1.210] applies to the remaining cases.

Vietnamese AI Translation

Phương pháp [P1.226] tương tự này [M1.210] được áp dụng cho các trường hợp còn lại.

AI Translation Nissaya

sesesu=In the remaining cases beginning with 'by non-ill will'. ; esa eso nayo=this is the method. ;

Myanmar Nissaya

sesesu=ကြွင်းသော အဗျာပါဒေန အစရှိသည်တို့၌။ ; esa eso nayo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4126 | Chunk: 69

Pāḷiyaṃ pana nekkhammaabyāpāde dassetvā heṭṭhā vuttanayattā sesaṃ saṅkhipitvā ante arahattamaggoyeva dassito.

AI Translation based on Nissaya

However, in the Pāḷi text, having shown renunciation and non-ill will, the rest is abbreviated due to the method mentioned before, and at the end, only the path of arahatship is shown. (Note: In the commentary, the thirty-seven factors are enumerated in full.)

Vietnamese AI Translation

Tuy nhiên, trong văn bản Pāḷi, sau khi đã trình bày về sự xuất ly và vô sân, phần còn lại được viết tắt do phương pháp đã được đề cập trước đó, và ở cuối, chỉ có đạo A-la-hán được trình bày. (Lưu ý: Trong phần chú giải, ba mươi bảy yếu tố được liệt kê đầy đủ.)

AI Translation Nissaya

pana=Now, to state a special point. ; pāḷiyaṃ=In this Paṭisambhidāmagga Pāḷi. ; nekkhammaabyāpāde=renunciation and non-ill will. ; dassetvā=having shown. ; heṭṭhā=previously. ; vuttanayattā=because of the method mentioned. ; sesaṃ=the remaining terms beginning with 'by the perception of non-greed'. ; saṅkhipitvā=having abbreviated. ; ante=at the end. ; arahattamaggoyeva=only the path of arahatship. ; dassito=is shown. ; (In the commentary, the thirty-seven factors are enumerated.). ;

Myanmar Nissaya

pana=ဆိုဖွယ်အထူးကို မိန့်ဆိုဦးအံ့။ ; pāḷiyaṃ=ဤ ပဋိသမ္ဘိဒါမဂ် ပါဠိ၌။ ; nekkhammaabyāpāde=တို့ကို။ ; dassetvā=၍။ ; heṭṭhā=၌။ ; vuttanayattā=ကြောင့်။ ; sesaṃ=ကြွင်းသော အလောဘသညာယ အစရှိသော ပုဒ်ကို။ ; saṅkhipitvā=ချုံး၍။ ; ante=၍။ ; arahattamaggoyeva=ကိုသာလျှင်။ ; dassito=ပြအပ်၏။ ; (သံဝဏ္ဏေတဗ္ဗ၌ သုံးဆယ့် ခုနစ်ပါးသော တရားတို့ကို သရုပ်ထုတ်လျက်ပင်ရှိ၏။) ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4127 | Chunk: 69

Evaṃ saṃvaraavītikkamavasena sīlaṃ dassetvā idāni tesaṃyeva dvinnaṃ pabhedadassanatthaṃ pañca sīlāni pāṇātipātassa pahānaṃ sīlan tiādimāha.

AI Translation based on Nissaya

Having thus shown morality by way of restraint and non-transgression, now, in order to show the divisions of just those two, he said the passage beginning: The five kinds of morality are: the abandonment of killing living beings is morality.

Vietnamese AI Translation

Sau khi đã trình bày về giới theo phương diện chế ngự và không vi phạm như vậy, bây giờ, để trình bày sự phân chia của chính hai điều đó, ngài đã nói đoạn văn bắt đầu bằng: Năm loại giới là: sự từ bỏ việc sát sanh là giới.

AI Translation Nissaya

evaṃ=In this way just mentioned. ; saṃvaraavītikkamavasena=by way of restraint and non-transgression. ; sīlaṃ=morality. ; dassetvā=having shown. ; idāni=now. ; tesaṃvayavadvinnaṃ=of just those two, restraint and non-transgression. ; pabhedadassanatthaṃ=in order to show the division. ; pañcasīlāni.la. sīlanti ādiṃ=the passage beginning with 'The five moralities...morality'. ; āha=he said. ;

Myanmar Nissaya

evaṃ=ဤဆိုအပ်ပြီးသော နည်းဖြင့်။ ; saṃvaraavītikkamavasena=စောင့်ရှောက်ခြင်းမလွန်ကျူးခြင်း၏ အစွမ်းအားဖြင့်။ ; sīlaṃ=ကို။ ; dassetvā=၍။ ; idāni=၌။ ; tesaṃvayavadvinnaṃ=ထိုနှစ်ပါးသော သံဝရ, အဝီတိက္ကမတို့၏သာလျှင်။ ; pabhedadassanatthaṃ=ငှါ။ ; pañcasīlāni.la. sīlanti ādiṃ=ကို။ ; āha=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4128 | Chunk: 69

Ettha ca pāṇātipātassa pahānaṃ sīlaṃ, pāṇātipātā veramaṇī sīlaṃ, pāṇātipātassa paṭipakkhacetanā sīlaṃ, pāṇātipātassa saṃvaro sīlaṃ, pāṇātipātassa avītikkamo sīlanti yojanā kātabbā.

AI Translation based on Nissaya

And here, in the passage beginning with 'The five kinds of morality', the connection should be made thus: the abandonment of killing living beings is morality; abstinence from killing living beings is morality; the volition that is the opposite of killing living beings is morality; restraint from killing living beings is morality; non-transgression of killing living beings is morality.

Vietnamese AI Translation

Và ở đây, trong đoạn văn bắt đầu bằng ‘Năm loại giới’, sự kết nối nên được thực hiện như sau: sự từ bỏ việc sát sanh là giới; sự kiêng tránh việc sát sanh là giới; tác ý đối nghịch với việc sát sanh là giới; sự chế ngự khỏi việc sát sanh là giới; sự không vi phạm việc sát sanh là giới.

AI Translation Nissaya

ca=Furthermore. ; ettha=here in this passage beginning with 'pañcasīlāni'. ; pāṇātipātassa=of the killing of living beings. ; pahānaṃ=the abandonment. ; sīlaṃ=is called morality. ; pāṇātipātā=from the killing of living beings. ; veramati=abstinence. ; sīlaṃ=is called morality. ; pāṇātipātassa=of the killing of living beings. ; paṭipakkhacetanā=the opposing volition. ; sīlaṃ=is called morality. ; pāṇātipātassa=the killing of living beings. ; saṃvaro=restraint. ; sīlaṃ=is called morality. ; pāṇātipātassa=the killing of living beings. ; avītikkamo=non-transgression. ; sīlaṃ=is called morality. ; iti=thus. ; yojanā=the connection of the Pāḷi. ; vā=or the connection of the meaning. ; kātabbā=should be made. ;

Myanmar Nissaya

ca=ဆက်။ ; ettha=ဤပဉ္ဏသီလာနိ အစရှိသော ပါဌ်၌။ ; pāṇātipātassa=ကို။ ; pahānaṃ=သည်။ ; sīlaṃ=မည်၏။ ; pāṇātipātā=မှ။ ; veramati=ကြဉ်ခြင်းသည်။ ; sīlaṃ=မည်၏။ ; pāṇātipātassa=၏။ ; paṭipakkhacetanā=သည်။ ; sīlaṃ=မည်၏။ ; pāṇātipātassa=ကို။ ; saṃvaro=ခြင်းသည်။ ; sīlaṃ=မည်၏။ ; pāṇātipātassa=ကို။ ; avītikkamo=ခြင်းသည်။ ; sīlaṃ=မည်၏။ ; iti=သို့။ ; yojanā=ပါဠိကို ယှဉ်ခြင်းကို။ ; vā=အနက်ယောဇနာခြင်းကို။ ; kātabbā=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4129 | Chunk: 69

Pahānan ti ca koci dhammo nāma natthi aññatra vuttappakārānaṃ pāṇātipātādīnaṃ anuppādamattato.

AI Translation based on Nissaya

And abandonment is not some separate dhamma in an ultimate sense, apart from the mere non-arising of the aforementioned killing of living beings and so on.

Vietnamese AI Translation

Và sự từ bỏ không phải là một pháp (dhamma) riêng biệt nào đó theo nghĩa chân đế, ngoài sự không khởi sanh đơn thuần của việc sát sanh đã được đề cập ở trên, v.v.

AI Translation Nissaya

pahānantica=And 'abandonment'. ; vuttappakārānaṃ=of the types mentioned. ; pāṇātipātādīnaṃ=of killing living beings and so on. ; anuppādamattato=from the mere non-arising. ; aññata=apart from. ; koci=any. ; dhammonāma=ultimate reality called a dhamma. ; natthi=does not exist. ;

Myanmar Nissaya

pahānantica=ပဟာနံ ဟူသည်လည်း။ ; vuttappakārānaṃ=ရှိကုန်သော။ ; pāṇātipātādīnaṃ=တို့၏။ ; anuppādamattato=ခြင်းမျှကို။ ; aññata=ကြဉ်၍။ ; koci=သော။ ; dhammonāma=ပရမတ္တတရားမည်သည်။ ; natthi=မရှိ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4130 | Chunk: 69

Yasmā pana taṃ taṃ pahānaṃ tassa tassa kusalassa dhammassa patiṭṭhānaṭṭhena upadhāraṇaṃ hoti, vippakiṇṇasabhāvākaraṇena ca samodhānaṃ, tasmā pubbe vutteneva upadhāraṇasamodhānasaṅkhātena sīlanaṭṭhena sīlanti vuttaṃ.

AI Translation based on Nissaya

However, because that particular abandonment serves as a foundation for that particular wholesome dhamma, it is a support. And because it does not create a scattered state, it is a collection. Therefore, because of this meaning of 'sīlana' (composing, founding)—which was previously described as being a foundation and a collection—it is called 'morality'.

Vietnamese AI Translation

Tuy nhiên, bởi vì sự từ bỏ cụ thể đó đóng vai trò làm nền tảng cho pháp (dhamma) thiện cụ thể đó, nó là một sự nâng đỡ. Và bởi vì nó không tạo ra một trạng thái tán loạn, nó là một sự thu gom. Do đó, vì ý nghĩa này của ‘sīlana’ (tổng hợp, thiết lập)—vốn đã được mô tả trước đó là nền tảng và sự thu gom—nó được gọi là ‘giới’.

AI Translation Nissaya

pana=However. ; yasmā=because. ; taṃ taṃ pahānaṃ=that particular abandonment. ; vā=of. ; kusalassa=wholesome. ; tassa tassa dhammassa=of that particular dhamma. ; patiṭṭhānaṭṭhena=by the meaning of being a foundation. ; upadhāraṇaṃ=is a foundation. ; hoti=is. ; vippakiṇṇasabhāvākaraṇenaca=and by not creating a scattered nature. ; samodhānaṃ=it is a collection. ; hoti=is. ; tasmā=Therefore. ; pubbe=previously, at the beginning of the Mātikā. ; vutteneva=which was spoken of. ; upadhāraṇasamodhānasaṅkhā- tena=called a foundation and a collection. ; sīlanaṭṭhena=by the meaning of 'sīlana' (composing/founding). ; sīlanti=as morality. ; vuttaṃ=it is said. ;

Myanmar Nissaya

pana=စင်စစ်သော်ကား။ ; yasmā=ကြောင့်။ ; taṃ taṃ pahānaṃ=ထိုထိုပါဏာတိပါတ အစရှိသည်ကို ပယ်ခြင်းသည်။ ; vā=ကို။ ; kusalassa=သော။ ; tassa tassa dhammassa=ထိုထိုတရား၏။ ; patiṭṭhānaṭṭhena=တည်ရာဟူသော အနက်သတ္တိကြောင့်။ ; upadhāraṇaṃ=တည်ရာ၏။ ; hoti=၏။ ; vippakiṇṇasabhāvākaraṇenaca=ဖရိုဖရဲ အစရှိသော သဘောကို မပြုခြင်းကြောင့်လည်း။ ; samodhānaṃ=ပေါင်းခြင်းသည်။ ; hoti=၏။ ; tasmā=ကြောင့်။ ; pubbe=ရှေ့ဖြစ်သော မာတိကာ၏ အစွန်း၌။ ; vutteneva=ဖြစ်သော။ ; upadhāraṇasamodhānasaṅkhā- tena=တည်ရာ ပေါင်းရာဟု ဆိုအပ်သော။ ; sīlanaṭṭhena=တည်ရာ ပေါင်းရာဟူသော အနက်ကြောင့်။ ; sīlanti=ဟူ၍။ ; vuttaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4131 | Chunk: 69

Itare cattāro dhammā tato tato veramaṇivasena tassa tassa saṃvaravasena tadubhayasampayuttacetanāvasena taṃ taṃ avītikkamantassa avītikkamavasena ca cetaso pavattisabhāvaṃ sandhāya vuttā.

AI Translation based on Nissaya

The other four dhammas were taught with reference to the natural mode of the mind's activity: by way of abstaining from this or that (unwholesome act), by way of restraining this or that, by way of the volition associated with both of these, and by way of the non-transgression of one who does not transgress this or that.

Vietnamese AI Translation

Bốn pháp (dhamma) còn lại được giảng dạy với sự quy chiếu đến phương thức hoạt động tự nhiên của tâm: qua phương diện kiêng tránh khỏi điều này hay điều kia (hành vi bất thiện), qua phương diện chế ngự điều này hay điều kia, qua phương diện tác ý liên quan đến cả hai điều này, và qua phương diện không vi phạm của một người không vi phạm điều này hay điều kia.

AI Translation Nissaya

itare=The other. ; cattāro=four. ; dhammā=dhammas, namely 'abstinence-morality', 'volition-morality', 'restraint-morality', and 'non-transgression-morality'. ; tato tato=from that particular killing of living beings and so on. ; veramaṇivasena=by way of abstaining. ; tadubhayasampayuttacetanāvasena=and by way of the volition associated with those two, abstinence and restraint. ; taṃtaṃ=that particular killing of living beings and so on. ; avītikkamantassa=for a person who does not transgress. ; avītikkamavasena=by way of not transgressing. ; cetaso=of the unwholesome mind. ; pavattisabhāvaṃ=the nature of its arising. ; sandhāya=with reference to. ; vuttā=they were taught as 'morality'. ;

Myanmar Nissaya

itare=ကုန်သော။ ; cattāro=ကုန်သော။ ; dhammā=ဝေရမဏိ သီလ စေတနာသီလ သံဝရောသီလ အဝီတက္ကမောသီလ ဟူသော တရားတို့ကို။ ; tato tato=ထိုထိုပါဏာတိပါတ အစရှိသည်မှ။ ; veramaṇivasena=ကြဉ်သည်၏ အစွမ်းဖြင့် လည်းကောင်း။ ; tadubhayasampayuttacetanāvasena=ထိုနှစ်ပါးသော ဝေရမဏိသံဝရတို့နှင့် ယှဉ်သော စေတနာ၏ အစွမ်းတို့ဖြင့်လည်းကောင်း။ ; taṃtaṃ=ထိုထိုပါဏာတိပါတ အစရှိသည်ကို။ ; avītikkamantassa=မလွန်ကျူးသော ပုဂ္ဂိုလ်အား။ ; avītikkamavasena=မလွန်ကျူးသည်၏ အစွမ်းဖြင့်လည်းကောင်း။ ; cetaso=အကုသိုလ်စိတ်၏။ ; pavattisabhāvaṃ=ဖြစ်သော သဘောကို။ ; sandhāya=ရည်၍။ ; vuttā=သီလဟူ၍ ဟောတော်မူ အပ်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4132 | Chunk: 69

Atha vā pahānampi dhammato atthiyeva.

AI Translation based on Nissaya

Alternatively, 'abandonment' does indeed exist in terms of its intrinsic nature.

Vietnamese AI Translation

Hoặc cách khác, ‘sự từ bỏ’ thực sự tồn tại xét về tự tánh của nó.

AI Translation Nissaya

athavā=Alternatively. ; pahānampi='abandonment' also. ; dhammato=in terms of its intrinsic nature. ; atthiyeva=certainly exists. ;

Myanmar Nissaya

athavā=ကား။ ; pahānampi=သည်လည်း။ ; dhammato=တရားကိုယ်အားဖြင့်။ ; atthiyeva=လျှင်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4133 | Chunk: 69

Kathaṃ ?

AI Translation based on Nissaya

How so?

Vietnamese AI Translation

Như thế nào?

AI Translation Nissaya

kathaṃ atthi=How does it exist?. ;

Myanmar Nissaya

kathaṃ atthi=ဟူမူ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4134 | Chunk: 69

Pahīyate anena pāṇātipātādipaṭipakkho, pajahati vā taṃ paṭipakkhanti pahānaṃ.

AI Translation based on Nissaya

The opponent of killing living beings and so on is abandoned by it, or it abandons its opponent; therefore it is called 'abandonment'.

Vietnamese AI Translation

Cái đối nghịch với việc sát sanh, v.v. bị nó từ bỏ, hoặc nó từ bỏ cái đối nghịch của nó; do đó nó được gọi là ‘sự từ bỏ’.

AI Translation Nissaya

anena kusalakkhandhena=By this aggregate of wholesomeness. ; pāṇātipāta paṭipakkho=the opponent of killing living beings and so on. ; pahīyate=is abandoned. ; iti tasmā=Therefore. ; pahānaṃ=it is called 'abandonment'. ; vā=Or. ; taṃ paṭipakkhaṃ=that opponent of killing living beings and so on. ; pajahati=it abandons. ; iti tasmā=Therefore. ; pahānaṃ=it is called 'abandonment'. ;

Myanmar Nissaya

anena kusalakkhandhena=ဤကုသိုလ်ခန္ဓာဖြင့်။ ; pāṇātipāta paṭipakkho=အစရှိသ‌ော ဆန့်ကျင်ဘက်တရားကို။ ; pahīyate=အပ်၏။ ; iti tasmā=ကြောင့်။ ; pahānaṃ=မည်၏။ ; vā=ကား။ ; taṃ paṭipakkhaṃ=ထိုပါဏာတိပါတ အစရှိသော ဆန့်ကျင်ဘက်ကို။ ; pajahati=တတ်၏။ ; iti tasmā=ကြောင့်။ ; pahānaṃ=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4135 | Chunk: 69

Kiṃ taṃ ?

AI Translation based on Nissaya

What is that?

Vietnamese AI Translation

Đó là gì?

AI Translation Nissaya

taṃ=That which is the cause of abandoning, or that which abandons. ; kiṃ=what is it?. ;

Myanmar Nissaya

taṃ=ထိုပယ်ခြင်းကြောင့်ဖြစ်သော တရား , ပယ်တတ်သော တရားဟူသည်။ ; kiṃ=နည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4136 | Chunk: 69

Sabbepi kusalā khandhā.

AI Translation based on Nissaya

All the wholesome aggregates.

Vietnamese AI Translation

Tất cả các uẩn thiện.

AI Translation Nissaya

sabbepi=All. ; kusalā=wholesome. ; khandhā=are the aggregates. ;

Myanmar Nissaya

sabbepi=ကုန်သော။ ; kusalā=ကုန်သော။ ; khandhā=တို့တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4137 | Chunk: 69

Aññe pana ācariyā ‘‘nekkhammādīsupi ‘ veramaṇī sīlan ’ ti vacanamattaṃ gahetvā sabbakusalesupi niyatayevāpanakabhūtā virati nāma atthī’’ ti vadanti, na tathā idhāti.

AI Translation based on Nissaya

However, other teachers, taking just the phrase 'abstinence is morality' in the later sections on renunciation and so on, say that in all wholesome states there exists what is called abstinence, which is a fixed 'occasional' mental factor. But it is not so here.

Vietnamese AI Translation

Tuy nhiên, các vị thầy khác, chỉ dựa vào cụm từ ‘sự kiêng tránh là giới’ trong các phần sau về sự xuất ly, v.v., nói rằng trong tất cả các trạng thái thiện đều tồn tại cái gọi là sự kiêng tránh, đó là một tâm sở ‘biệt cảnh’ cố định. Nhưng ở đây thì không phải vậy.

AI Translation Nissaya

aññe=Other. ; ācariyā pana=teachers, however. ; nekkhammādīsiupa=in the later terms beginning with 'renunciation'. ; veramaṇi sīlanti vacanamattaṃ=the mere phrase 'abstinence is morality'. ; gahetvā=having taken. ; sabbakusalepi=in all wholesome states also. ; niyatayevāpanakabhūtā=which arises as a fixed occasional mental factor. ; vīratīnāma=what is called abstinence. ; atthi=exists. ; iti=thus. ; vadanti=they say. ;

Myanmar Nissaya

aññe=ကုန်သော။ ; ācariyā pana=မူကား။ ; (ပန အဋ္ဌာနယောဂ)။ ; nekkhammādīsiupa=သော နောက်နောက်သော ပုဒ်တို့၌လည်း။ ; veramaṇi sīlanti vacanamattaṃ=ဝေရမဏိ သီလံ ဟူသော စကားမျှကို။ ; (ပဌမဈာန် စသည်၌ ဝိရတီမရှိရကား သဒ္ဒါမျှသာ၊ အနက်မရှိ ဟူလို။) ; gahetvā=ယူ၍။ ; sabbakusalepi=တို့၌လည်း။ ; niyatayevāpanakabhūtā=နိယတယေဝါပနကစေတသိက်ဖြစ်၍ ဖြစ်သော။ ; vīratīnāma=သည်။ ; atthi=၏။ ; iti=သို့။ ; vadanti=ဆိုကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4138 | Chunk: 69

Evamimehi pahānādīhi pañcahi padehi visesetvā pariyantāpariyantasīladvaye apariyantasīlameva [V1.193] vuttaṃ.

AI Translation based on Nissaya

Thus, having distinguished by these five terms beginning with 'abandonment', among the two kinds of morality—limited and unlimited—only unlimited morality [V1.193] was spoken of.

Vietnamese AI Translation

Như vậy, sau khi đã phân biệt bằng năm thuật ngữ bắt đầu với ‘sự từ bỏ’, giữa hai loại giới—giới hạn và không giới hạn—chỉ có giới không giới hạn [V1.193] được nói đến.

AI Translation Nissaya

tathā=As it is said. ; vā=in that manner. ; idha imasmiṃ samaye=here, at this time of developing the first jhāna and so on. ; na=it is not. ; tanaññaḥ= ; natthi=it is not. ; iti=Thus. ; daṭṭhabbaṃ=it should be seen. ; evaṃ iminā vuttanayena=In this way that was mentioned. ; pahānādīhi=beginning with abandonment. ; pañcahi=five. ; imeti padehi=by these terms 'abandonment', 'abstinence', 'volition', 'non-transgression', and 'restraint'. ; visesetvā=having specified. ; pariyantā pariyanta sīlameva=only unlimited morality. ; vuttaṃ=was spoken of. ;

Myanmar Nissaya

tathā=ထိုသို့ဆိုတိုင်း။ ; vā=ထိုအခြင်းအရားဖြင့်။ ; idha imasmiṃ samaye=ဤပဌမဈာန် စသည်ကိုပွားသောအခါ၌။ ; na=မဟုတ်။ ; tanaññaḥ= ; natthi=မရှိ။ ; iti=သို့။ ; daṭṭhabbaṃ=၏။ ; evaṃ iminā vuttanayena=နည်းဖြင့်။ ; pahānādīhi=ပဟာန အစရှိကုန်သော။ ; pañcahi=ကုန်သော။ ; imeti padehi=ဤပဟာနပုဒ် ဝေရမဏိပုဒ် စေတနာပုဒ် ဝီတိက္ကမပုဒ် သံဝရပုဒ်တို့ဖြင့်။ ; visesetvā=၍။ ; pariyantā pariyanta sīlameva=ကိုသာလျှင်။ ; vuttaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4139 | Chunk: 69

Tasmā eva hi evarūpāni sīlāni cittassa avippaṭisārāya saṃvattanti … pe … sacchikātabbaṃ sacchikaronto sikkhatīti vuttaṃ.

AI Translation based on Nissaya

It is for this very reason that it was said: Such moralities conduce to the non-remorse of the mind…pe…one trains by realizing what should be realized.

Vietnamese AI Translation

Chính vì lý do này mà có lời nói rằng: Những giới như vậy đưa đến sự không hối tiếc của tâm…pe…người ta tu tập bằng cách liễu tri những gì cần được liễu tri.

AI Translation Nissaya

hi saccaṃ=Truly. ; tasmāeva=for that very reason. ; evarūpāni.la. sikkhatīti=the passage beginning 'Such moralities...'. ; vuttaṃ=was said. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; tasmāeva=သာလျှင်။ ; evarūpāni.la. sikkhatīti=ဟူ၍။ ; vuttaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4140 | Chunk: 69

Tattha avippaṭisārāya saṃvattantīti ‘‘saṃvaro avippaṭisāratthāyā’’ ti ( pari. 366) ca ‘‘avippaṭisāratthāni kho, ānanda, kusalāni sīlāni avippaṭisārānisaṃsānī’’ ti ( a. ni. 10.1;11.1) ca vacanato avippaṭisāratthāya saṃvattanti.

AI Translation based on Nissaya

Therein, as for conduce to non-remorse: they conduce to non-remorse in accordance with the sayings, “Restraint is for the sake of non-remorse” (pari. 366), and “Wholesome moralities, Ānanda, have non-remorse as their purpose, non-remorse as their benefit” (A.10.1; 11.1).

Vietnamese AI Translation

Trong đó, đối với đưa đến sự không hối tiếc: chúng đưa đến sự không hối tiếc phù hợp với những lời dạy, “Sự chế ngự là vì mục đích không hối tiếc” (pari. 366), và “Này Ānanda, các giới thiện có sự không hối tiếc làm mục đích, có sự không hối tiếc làm lợi ích” (A.10.1; 11.1).

AI Translation Nissaya

tattha=Therein, in that passage beginning 'evarūpāni'. ; avippaṭisārāya saṃvattatīti=as for 'conduce to non-remorse'. ; saṃvaro avippaṭisāratthāyātica=and because of the saying 'restraint is for the sake of non-remorse'. ; vacanato=from the Pāḷi (in the Parivāra). ; avippaṭisāratthāni.la. nisaṃsānīti=and because of the saying 'wholesome moralities have non-remorse as their benefit...'. ; vacanatoca=from the Pāḷi (in the Ekādasaka-aṅguttara). ; avippaṭisāratthāya=for the sake of not being remorseful. ; saṃvattanti=they conduce. ; saṃvaro=Restraint. ; avippaṭisārattāya=for the sake of non-remorse. ; hoti=is. ; ānanda=Ānanda. ; kho=indeed. ; kusalāni=wholesome. ; sīlāni=moralities. ; avippaṭisāratthāni=have non-remorse as their purpose. ; avippaṭisārāni=have non-remorse as their benefit. ;

Myanmar Nissaya

tattha=ထိုဧဝရူပါနိ စသော ပါဌ်၌။ ; avippaṭisārāya saṃvattatīti=ကား။ ; saṃvaro avippaṭisāratthāyātica=ဟူ၍လည်း။ ; vacanato=(ပရိဝါရပါဠိ၌) ဟောတော်မူခြင်းကြောင့်။ ; avippaṭisāratthāni.la. nisaṃsānīti=ဟူ၍။ ; vacanatoca=(ဧကာဒသင်္ဂုတ္တိုရပါဠိ၌) ဟောတော်မူခြင်းကြောင့်လည်းကောင်း။ ; avippaṭisāratthāya=နှလုံးမသာမယာမဖြစ်ခြင်းငှါ။ ; saṃvattanti=ကုန်၏။ ; saṃvaro=သည်။ ; avippaṭisārattāya=ငှါ။ ; hoti=၏။ ; ānanda=အာနန္ဒာ။ ; kho=စင်စစ်။ ; kusalāni=ကုန်သော။ ; sīlāni=တို့သည်။ ; avippaṭisāratthāni=နှလုံးမသာယာခြင်းလျှင် အကျိုးရှိကုန်၏။ ; avippaṭisārāni=နှလုံးသာယာခြင်းလျှင် အကျိုးဆက်ရှိကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4141 | Chunk: 69

‘‘Avippaṭisāro pāmojjatthāyā’’ ti ( pari. 366) ca ‘‘yoniso manasikaroto pāmojjaṃ jāyatī’’ ti ( paṭi. ma. 1.74) ca vacanato pāmojjāya saṃvattanti.

AI Translation based on Nissaya

They conduce to joy in accordance with the sayings, “Non-remorse is for the sake of joy” (pari. 366), and “For one who pays wise attention, joy arises” (Paṭi. Ma. 1.74).

Vietnamese AI Translation

Chúng đưa đến hỷ phù hợp với những lời dạy, “Sự không hối tiếc là vì mục đích hỷ” (pari. 366), và “Đối với người như lý tác ý, hỷ khởi sanh” (Paṭi. Ma. 1.74).

AI Translation Nissaya

avippaṭisāro pāmojjatthāyāti=and because of the saying 'non-remorse is for the sake of joy'. ; vacanatoca=from the Pāḷi (in the Parivāra). ; yoniso.la. jāyatīti=and because of the saying 'for one who pays wise attention, joy arises'. ; vacanatoca=. ; pāmojjāya=for the sake of slight joy. ; saṃvattanti=they conduce. ; avippaṭisāro=Non-remorse. ; pāmojjatthāya=is for the sake of slight joy. ; hoti=is. ; yoniso=wisely. ; manasikāroto=for one who pays attention. ; pāmojjaṃ=slight joy. ; jāyati=arises. ; (avippaṭisāroti means the absence of mental remorse due to deeds done or not done, both evil and good. (Vibhaṅga-aṭṭhakathā 4, 208). ; vippaṭisārapaṭipakkho kusalacittuppādo avippaṭisāro=The arising of a wholesome mind which is the opposite of remorse is non-remorse. ; so pana visesato lābhā vatame=And that in particular is to be understood as arising by way of reflecting on one's own purity of morals, thinking, 'It is a gain for me. ; suladdhaṃ vata me=It is a great gain for me. ; tassa me parisuddhiṃ sīlanti attano sīlassa paccavekkhaṇavasena pavatto veditabbo=I have pure morality.'. ; (Visuddhimagga-ṭīkā)). ;

Myanmar Nissaya

avippaṭisāro pāmojjatthāyāti=ဟူ၍။ ; vacanatoca=(ပရိဝါပါဠိ၌) ဟောတော်မူခြင်းကြောင့်လည်းကောင်း။ ; yoniso.la. jāyatīti=ဟူ၍။ ; vacanatoca=ကြောင့်လည်းကောင်း။ ; pāmojjāya=အားနည်းသော ဝမ်းမြောက်ခြင်းငှါ။ ; saṃvattanti=ကုန်၏။ ; avippaṭisāro=နှလုံးသာယာခြင်းသည်။ ; pāmojjatthāya=အားနည်းသော ဝမ်းမြောက်ခြင်းငှါ။ ; hoti=၏။ ; yoniso=ဖြင့်။ ; manasikāroto=နှလုံးသွင်းသော ပုဂ္ဂိုလ်အား။ ; pāmojjaṃ=အားနည်းသော ဝမ်းမြောက်ခြင်းသည်။ ; jāyati=၏။ ; (အဝိပ္ပဋိသာရောတိ ပါပပုညာနံ ကတာကတဝသေန စိတ္တဝိပ္ပဋိသာရာဘာဝါ။ (ပရိဝါ ဝိ- ဋ္ဌ- ၄၊ ၂၀၈။) ; vippaṭisārapaṭipakkho kusalacittuppādo avippaṭisāro= ; so pana visesato lābhā vatame= ; suladdhaṃ vata me= ; tassa me parisuddhiṃ sīlanti attano sīlassa paccavekkhaṇavasena pavatto veditabbo= ; (ဝိသုဒ္ဓိမဂ်ဋီကာ)။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4142 | Chunk: 69

‘‘Pāmojjaṃ pītatthāyā’’ ti [P1.227] ( pari. 366) ca ‘‘pamuditassa pīti jāyatī’’ ti ( a. ni. 5.26; saṃ. ni. 5.376; dī. ni. 3.322) ca vacanato pītiyā [M1.211] saṃvattanti.

AI Translation based on Nissaya

They conduce to rapture [M1.211] in accordance with the sayings, “Joy is for the sake of rapture” [P1.227] (pari. 366), and “For one who is joyful, rapture arises” (A.5.26; S.5.376; D.3.322).

Vietnamese AI Translation

Chúng đưa đến phỉ [M1.211] phù hợp với những lời dạy, “Hỷ là vì mục đích phỉ” [P1.227] (pari. 366), và “Đối với người có tâm hỷ, phỉ khởi sanh” (A.5.26; S.5.376; D.3.322).

AI Translation Nissaya

pāmojjaṃ pītatthāyāti=and because of the saying 'joy is for the sake of rapture'. ; vacanato=from the Parivāra Pāḷi. ; pamuditassa pīti jāyatīti=and because of the saying 'for one who is joyful, rapture arises'. ; vacanatoca=. ; pītiyā=for the sake of strong rapture. ; saṃvattati=they conduce. ;

Myanmar Nissaya

pāmojjaṃ pītatthāyāti=ဟူ၍။ ; vacanato=ပရိဝါပါဠိ၌ ဟောတော်မူခြင်းကြောင့်လည်းကောင်း။ ; pamuditassa pīti jāyatīti=ဟူ၍။ ; vacanatoca=ဟောတော်မူခြင်းကြောင့်လည်းကောင်း။ ; pītiyā=အားကြီးသော ပီတ်ိအလို့ငှါ။ ; saṃvattati=ဖြစ်ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4143 | Chunk: 69

‘‘Pīti passaddhatthāyā’’ ti ( pari. 366) ca ‘‘pītimanassa kāyo passambhatī’’ ti ( a. ni. 5.26; saṃ. ni. 5.376; dī. ni. 3.322) ca vacanato passaddhiyā saṃvattanti.

AI Translation based on Nissaya

They conduce to tranquility in accordance with the sayings, “Rapture is for the sake of tranquility” (pari. 366), and “For one with a rapturous mind, the body becomes tranquil” (A.5.26; S.5.376; D.3.322).

Vietnamese AI Translation

Chúng đưa đến sự khinh an phù hợp với những lời dạy, “Phỉ là vì mục đích khinh an” (pari. 366), và “Đối với người có tâm phỉ, thân trở nên khinh an” (A.5.26; S.5.376; D.3.322).

AI Translation Nissaya

pāmojjaṃ=Slight joy. ; pītatthāya=is for the sake of strong rapture. ; hoti=is. ; pamuditassa=For one who has slight joy. ; pīti=strong rapture. ; jāyati=arises. ; pītipassaddhatthāyāti=and because of the saying. ; vacanatoca=. ; pītimanassa kāyo passambhatīti=and because of the saying 'for one with a rapturous mind, the body becomes tranquil'. ; vacanatoca=. ; passaddhiyā=for the sake of tranquility of body and mind. ; saṃvattanti=they conduce. ; pīti=Strong rapture. ; passaddhattāya=is for the sake of tranquility of body and mind. ; hoti=is. ; pītimanassa=For one with a rapturous mind. ; kāyo=the body. ; passambhati=becomes tranquil. ; passaddhi sukhatthāyāti=and because of the saying. ; vacanatoca=. ; passaddhakāyo sukhaṃ vedetīti=and because of the saying 'one with a tranquil body experiences happiness'. ; vacanatoca=. ; somanassāya=for the sake of. ; saṃvattanti=they conduce. ;

Myanmar Nissaya

pāmojjaṃ=အားနည်းသော ဝမ်းမြောက်ခြင်းသည်။ ; pītatthāya=အားကြီးသော ပီတိအလို့ငှါ။ ; hoti=၏။ ; pamuditassa=အားနည်းသော ဝမ်းမြောက် ခြင်းရှိသော ပုဂ္ဂိုလ်အား။ ; pīti=အားကြီးသော ပီတိသည်။ ; jāyati=ဖြစ်၏။ ; pītipassaddhatthāyāti=ဟူ၍။ ; vacanatoca=ကြောင့်လည်းကောင်း။ ; pītimanassa kāyo passambhatīti=ဟူ၍။ ; vacanatoca=ကြောင့်လည်းကောင်း။ ; passaddhiyā=ကိုယ်စိတ်၏ ငြိမ်းချမ်းခြင်းငှါ။ ; saṃvattanti=ကုန်၏။ ; pīti=အားကြီးသော ပီတိသည်။ ; passaddhattāya=ကိုယ်စိတ်၏ ငြိမ်းချမ်းခြင်းငှါ။ ; hoti=၏။ ; pītimanassa=နှစ်သက်သော စိတ်ရှိသော ပုဂ္ဂိုလ်အား။ ; kāyo=သည်။ ; passambhati=ငြိမ်း၏။ ; passaddhi sukhatthāyāti=ဟူ၍။ ; vacanatoca=ကြောင့်လည်းကောင်း။ ; passaddhakāyo sukhaṃ vedetīti=ဟူ၍။ ; vacanatoca=ကြောင့်လည်းကောင်း။ ; somanassāya=အလို့ငှါ။ ; saṃvattanti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4144 | Chunk: 69

‘‘Passaddhi sukhatthāyā’’ ti ( pari. 366) ca ‘‘passaddhakāyo sukhaṃ vedetī’’ ti ( a. ni. 5.26; saṃ. ni. 5.376; dī. ni. 3.322) ca vacanato somanassāya saṃvattanti.

AI Translation based on Nissaya

They conduce to gladness in accordance with the sayings, “Tranquility is for the sake of happiness” (pari. 366), and “One with a tranquil body experiences happiness” (A.5.26; S.5.376; D.3.322).

Vietnamese AI Translation

Chúng đưa đến sự hân hoan phù hợp với những lời dạy, “Sự khinh an là vì mục đích lạc” (pari. 366), và “Người có thân khinh an thì cảm nghiệm được lạc” (A.5.26; S.5.376; D.3.322).

AI Translation Nissaya

passaddhi=Tranquility. ; sukhatthāya=is for the sake of physical and mental happiness. ; hoti=is. ; passaddhikāyo=A person with a tranquil body and mind. ; sukhaṃ=happiness. ; vedeti=experiences. ;

Myanmar Nissaya

passaddhi=ခြင်းသည်။ ; sukhatthāya=ကာယိက သုခ စေတသိကသုခ အလို့ငှါ။ ; hoti=၏။ ; passaddhikāyo=သော ကိုယ်စိတ်ရှိသော ပုဂ္ဂိုလ်သည်။ ; sukhaṃ=ကို။ ; vedeti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4145 | Chunk: 69

Cetasikaṃ sukhañhi somanassanti vuccati.

AI Translation based on Nissaya

Indeed, mental happiness is called gladness.

Vietnamese AI Translation

Thật vậy, tâm lạc được gọi là sự hân hoan.

AI Translation Nissaya

hisaccaṃ=Truly. ; cetasikaṃ=Mental. ; somanassanti=as gladness. ; vuccati=is called. ;

Myanmar Nissaya

hisaccaṃ=၏။ ; cetasikaṃ=စိတ်၌ဖြစ်သော။ ; somanassanti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4146 | Chunk: 69

Āsevanāyāti bhusā sevanā āsevanā.

AI Translation based on Nissaya

For cultivation: `Āsevanā` (cultivation) is intense practice.

Vietnamese AI Translation

Để tu tập: `Āsevanā` (tu tập) là sự thực hành chuyên sâu.

AI Translation Nissaya

āsevanāyāti=As for 'for cultivation'. ; susāsevanā=Intense practice. ; āsevanā=is called cultivation. ;

Myanmar Nissaya

āsevanāyāti=ကား။ ; susāsevanā=လွန်စွာ မှီဲဝဲခြင်းသည်။ ; āsevanā=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4147 | Chunk: 69

Kassa āsevanā ?

AI Translation based on Nissaya

The cultivation of what?

Vietnamese AI Translation

Tu tập cái gì?

AI Translation Nissaya

kassa=Of what dhamma. ; āsevanā=is it the intense practice?. ;

Myanmar Nissaya

kassa=အဘယ်တရားကို။ ; āsevanā=လွန်စွာမှီဝဲသနည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4148 | Chunk: 69

Anantaraṃ somanassavacanena sukhassa vuttattā sukhaṃ siddhaṃ.

AI Translation based on Nissaya

Since happiness was just mentioned by the word 'gladness', happiness is established.

Vietnamese AI Translation

Vì lạc vừa được đề cập qua từ ‘sự hân hoan’, nên lạc được xác lập.

AI Translation Nissaya

anantaraṃ=Immediately following. ; somanassavacanena=by the word 'gladness'. ; sukhassa=happiness. ; vuttattā=because it was spoken of. ; sukhaṃ=happiness. ; siddhaṃ=is established. ;

Myanmar Nissaya

anantaraṃ=အခြားမဲ့၌။ ; somanassavacanena=သောမနဿသဒ္ဒါသည်။ ; sukhassa=ကို။ ; vuttattā=ကြောင့်။ ; sukhaṃ=သည်။ ; siddhaṃ=ပြီး၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4149 | Chunk: 69

‘‘Sukhino cittaṃ samādhiyatī’’ ti ( a. ni. 5.26; saṃ. ni. 5.376; dī. ni. 3.322) ca vacanato tena sukhena samādhi siddho hoti.

AI Translation based on Nissaya

And because of the saying, “The mind of one who is happy becomes concentrated” (A.5.26; S.5.376; D.3.322), concentration is established by that happiness.

Vietnamese AI Translation

Và do lời dạy, “Tâm của người có lạc trở nên định tĩnh” (A.5.26; S.5.376; D.3.322), định được xác lập bởi lạc ấy.

AI Translation Nissaya

sukhino cittaṃ samādhiyatīti=and because of the saying 'the mind of one who is happy becomes concentrated'. ; vacanatoca=from the Pāḷi (in Sāmaññaphala Sutta, Saṅgīti Sutta, Dasuttara Sutta, Mūlapaṇṇāsa, Pañcaka-aṅguttara). ; tena sukhena=by that happiness. ; samādhi=concentration. ; siddho=is established. ; hoti=is. ;

Myanmar Nissaya

sukhino cittaṃ samādhiyatīti=ဟူ၍။ ; vacanatoca=(သာမညဖလသုတ်၊ သင်္ဂီတိသုတ်၊ ဒသုတ္တရသုတ်၊ မူလပဏ္ဏာသ၊ ပဉ္စကအင်္ဂုတ္တိုရ်ပါဠိတို့၌) ဟောတော်မူခြင်း ကြောင့်လည်း။ ; tena sukhena=ထိုသုခဖြင့်။ ; samādhi=သည်။ ; siddho=သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4150 | Chunk: 69

Evaṃ siddhassa samādhissa āsevanā.

AI Translation based on Nissaya

It is the cultivation of concentration thus established.

Vietnamese AI Translation

Đó là sự tu tập định đã được xác lập như vậy.

AI Translation Nissaya

evaṃ=Thus. ; siddhassa=established by happiness. ; samādhissa=of concentration. ; āsevanā=it is the intense cultivation. ;

Myanmar Nissaya

evaṃ=သို့။ ; siddhassa=သုခဖြင့်ပြီးသော။ ; samādhissa=ကို။ ; āsevanā=လွန်စွာမှီဲဝဲသည်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4151 | Chunk: 69

Tassa samādhissa āsevanāya saṃvattanti , paguṇabalavabhāvāya saṃvattantīti attho.

AI Translation based on Nissaya

They conduce to the cultivation of that concentration; the meaning is that they conduce to its proficient and strong state.

Vietnamese AI Translation

Chúng đưa đến sự tu tập định ấy; nghĩa là chúng đưa đến trạng thái thuần thục và vững mạnh của nó.

AI Translation Nissaya

tassa samādhissa=of that concentration established by happiness. ;

Myanmar Nissaya

tassa samādhissa=ထိုသုခဖြင့် ပြီးသော သမာဓိကို သာလျှင်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4152 | Chunk: 69

Bahulīkammāyāti tasseva samādhissa punappunaṃ kiriyāya.

AI Translation based on Nissaya

For making much of: for the sake of practicing that same concentration again and again.

Vietnamese AI Translation

Để làm cho sung mãn: vì mục đích thực hành chính định đó lặp đi lặp lại.

AI Translation Nissaya

punappunaṃ=again and again. ; kiriyāya=for the sake of doing. ;

Myanmar Nissaya

punappunaṃ=တလုံလဲလဲ။ ; kiriyāya=ပြုခြင်းငှါ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4153 | Chunk: 69

Avippaṭisārādipavattiyā mūlakāraṇaṃ hutvā samādhissa saddhindriyādialaṅkārasādhanena alaṅkārāya saṃvattanti.

AI Translation based on Nissaya

By being the root cause for the arising of non-remorse and so on, and by accomplishing the adornment of concentration with the faith faculty and so on, they conduce to its adornment.

Vietnamese AI Translation

Bằng cách là nguyên nhân gốc rễ cho sự khởi sanh của sự không hối tiếc, v.v., và bằng cách hoàn thành sự trang hoàng cho định với tín quyền, v.v., chúng đưa đến sự trang hoàng cho định.

AI Translation Nissaya

avippaṭisārādipavattiyā=of the arising of non-remorse and so on. ; mūlakāraṇaṃ=the root cause. ; hutvā=being. ; samādhissa=concentration. ; vā=for. ; saddhindriyādialaṅkārasādhanena=by accomplishing the adornment with the faith faculty and so on. ; alaṅkārāya=for the sake of adornment. ; saṃvattanti=they conduce. ;

Myanmar Nissaya

avippaṭisārādipavattiyā=နှလုံးသာယာခြင်း အစရှိသည်တို့၏ ဖြစ်ခြင်း၏။ ; mūlakāraṇaṃ=မူလအကြောင်းသည်။ ; hutvā=၍။ ; samādhissa=ကို။ ; vā=အား။ ; saddhindriyādialaṅkārasādhanena=သဒ္ဓိန္ဒြေ အစရှိသည်တို့ဖြင့် တန်ဆာဆင်ခြင်းကို ပြီးစေသောအားဖြင့်။ ; alaṅkārāya=တန်ဆာဆင်ခြင်းငှါ။ ; saṃvattanti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4154 | Chunk: 69

Avippaṭisārādikassa samādhisambhārassa sādhanena parikkhārāya saṃvattanti.

AI Translation based on Nissaya

By accomplishing the equipment for concentration, which consists of non-remorse and so on, they conduce to its support.

Vietnamese AI Translation

Bằng cách hoàn bị các trang bị cho định, bao gồm sự không hối tiếc, v.v., chúng đưa đến sự hỗ trợ cho định.

AI Translation Nissaya

avippaṭisārāditassa=of non-remorse and so on. ; samādhisambhārassa=of the equipment for concentration. ; sādhanena=because of accomplishing. ; samādhissa=of concentration. ; parikkhārāya=for the sake of support/equipment. ; saṃvattanti=they conduce. ;

Myanmar Nissaya

avippaṭisārāditassa=နှလုံးသာယာခြင်းအစရှိသော။ ; samādhisambhārassa=သမာဓိအဆောက်အအုံ၏။ ; sādhanena=ပြီးခြင်းကြောင့်။ ; samādhissa=၏။ ; parikkhārāya=အဆောက်အအုံအလို့ငှါ။ ; saṃvattanti=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4155 | Chunk: 69

‘‘Ye ca kho ime pabbajitena jīvitaparikkhārā samudānetabbā’’ tiādīsu ( ma. ni. 1.192) viya hi ettha sambhārattho parikkhārasaddo.

AI Translation based on Nissaya

For here, the word `parikkhāra` has the meaning of 'equipment', as in passages such as, “Whatever life-requisites are to be acquired by one who has gone forth…” (M.1.192).

Vietnamese AI Translation

Vì ở đây, từ `parikkhāra` có nghĩa là ‘trang bị’, như trong các đoạn kinh như, “Bất cứ vật dụng sinh hoạt nào cần được một người xuất gia thọ nhận…” (M.1.192).

AI Translation Nissaya

hi saccaṃ=Indeed. ; ye ca kho ime.la. samudānetabbāti ādīsu viya=just as in the Pāḷi passages beginning with 'Whatever life-requisites are to be acquired by one who has gone forth...'. ; ettha=here in this word 'parikkhārāya'. ; parikkhārasaddo=the word 'parikkhāra'. ; sambhārattho=has the meaning of equipment. ; pabbajitena=A person who has gone forth. ; yekeci=whatever. ; ime jīvitaparikkhārā=these requisites of life. ; samudānetabbā=should be well acquired. ; pana saccaṃ=Indeed. ; parikkhārasaddo=the word 'parikkhāra'. ; alaṅkārattho=has the meaning of adornment. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; ye ca kho ime.la. samudānetabbāti ādīsu viya=ဤသို့ အစရှိသော ပါဠိတို့ကဲ့သို့။ ; ettha=ဤပရိက္ခာရာယ ဟူသော ပုဒ်၌။ ; parikkhārasaddo=သည်။ ; sambhārattho=အဆောက်အအုံဟူသော အနက်ရှိ၏။ ; pabbajitena=ရဟန်းဖြစ်သော သူသည်။ ; yekeci=ကုန်သော။ ; ime jīvitaparikkhārā=ဤအသက်၏ အဆောက်အအုံတို့ကို။ ; samudānetabbā=ကောင်းစွာဆောက်အပ်ကုန်၏။ ; pana saccaṃ=၏။ ; parikkhārasaddo=သည်။ ; alaṅkārattho=တန်ဆာဟူသော အနက်ရှိ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4156 | Chunk: 69

‘‘Ratho sīlaparikkhāro, jhānakkho cakkavīriyo’’ tiādīsu ( saṃ. ni. 3.54) pana alaṅkārattho.

AI Translation based on Nissaya

But in passages such as, “The chariot with morality as its adornment, jhāna as its axle, and energy as its wheel…” (S.3.54), it has the meaning of 'adornment'.

Vietnamese AI Translation

Nhưng trong các đoạn kinh như, “Cỗ xe với giới làm vật trang hoàng, thiền-na làm trục xe, và tinh tấn làm bánh xe…” (S.3.54), nó có nghĩa là ‘vật trang hoàng’.

AI Translation Nissaya

ratho=The chariot, which is the Noble Eightfold Path. ; sīlaparikkhāro=has the pure adornment which is the Fourfold Purification of Morality. ; jhānakkho=It also has jhāna as its axle. ; cakkavīriyo=It also has energy as its wheel. ;

Myanmar Nissaya

ratho=အဋ္ဌင်္ဂိကမဂ်တည်းဟူသော ရထားသည်။ ; sīlaparikkhāro=စတုပါရိသုဒ္ဓိသီလတည်းဟူသော ဖြူစင်သော တန်ဆင်ရှိ၏။ ; jhānakkho=ဈာန်တည်းဟူသော ဝင်ရိုးလည်းရှိ၏။ ; cakkavīriyo=ဝီရိယတည်းဟူသော ရထားဘီးလည်းရှိ၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4157 | Chunk: 69

‘‘Sattahi nagaraparikkhārehi suparikkhataṃ hotī’’ tiādīsu ( a. ni. 7.67) parivārattho.

AI Translation based on Nissaya

In passages such as, “It is well fortified with the seven city-fortifications…” (A.7.67), it has the meaning of 'retinue' or 'fortification'.

Vietnamese AI Translation

Trong các đoạn kinh như, “Nó được phòng hộ kỹ lưỡng với bảy thành trì…” (A.7.67), nó có nghĩa là ‘tuỳ tùng’ hoặc ‘thành trì’.

AI Translation Nissaya

sattahi.la. hotītiādīsu=in passages such as this. ; parikkhārasaddo=the word 'parikkhāra'. ; parivārattho=has the meaning of 'retinue' or 'fortification'. ; sattahi=with seven. ; nagaraparikkhārehi=fortifications of a city. ; suparikkhataṃ=it is well fortified. ; hoti=is. ;

Myanmar Nissaya

sattahi.la. hotītiādīsu=ဤသို့ အစရှိသော ပါဌ်တို့၌။ ; parikkhārasaddo=သည်။ ; parivārattho=အခြံအရံ ဟူသော အနက်ရှိ၏။ ; sattahi=ကုန်သော။ ; nagaraparikkhārehi=မြို့၏ အခြံအရံတို့ဖြင့်။ ; suparikkhataṃ=ကောင်းစွာ ခြံရံအပ်သည်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4158 | Chunk: 69

Idha pana alaṅkāraparivārānaṃ visuṃ āgatattā sambhāratthoti vuttaṃ.

AI Translation based on Nissaya

Here, however, since 'adornment' and 'retinue' are mentioned separately, it is said that it has the meaning of 'equipment'.

Vietnamese AI Translation

Tuy nhiên, ở đây, vì ‘vật trang hoàng’ và ‘tuỳ tùng’ được đề cập riêng biệt, nên được nói rằng nó có nghĩa là ‘trang bị’.

AI Translation Nissaya

panatathāpi=Although it conveys those three meanings. ; idha=here in this Paṭisambhidāmagga Pāḷi. ; alaṅkāraparivārānaṃ=of the words 'adornment' and 'retinue'. ; visuṃ=separately. ; āgatattā=because they appear. ; sambhārattoti=it has the meaning of 'equipment'. ; vuttaṃ=it is said. ;

Myanmar Nissaya

panatathāpi=ထိုသုံးပါးသော အနက်ကို ဟောလျှင်မူလည်း။ ; idha=ဤပဋိသမ္ဘိဒါမဂ်ပါဠိ၌။ ; alaṅkāraparivārānaṃ=အလင်္ကာရသဒ္ဒါပရိဝါရ သဒ္ဒါတို့၏။ ; visuṃ=အသီးအခြား။ ; āgatattā=ကြောင့်။ ; sambhārattoti=သမ္ဘာရအနက်ရှိ၏ ဟူ၍။ ; vuttaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4159 | Chunk: 69

Sambhārattho ca paccayatthoti.

AI Translation based on Nissaya

And it should be understood that the meaning of 'equipment' is the meaning of 'condition'.

Vietnamese AI Translation

Và cần phải hiểu rằng ý nghĩa của ‘trang bị’ là ý nghĩa của ‘điều kiện’.

AI Translation Nissaya

sambhārattheca=And the meaning of 'equipment'. ; paccayattho=is precisely the meaning of 'condition'. ; iti=Thus. ; veditabbaṃ=it should be understood. ;

Myanmar Nissaya

sambhārattheca=သမ္ဘာရအနက်ဟူသည်လည်း။ ; paccayattho=အကြောင်းဟူသော အနက်ပင်တည်း။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4160 | Chunk: 69

Mūlakāraṇabhāveneva samādhisampayuttaphassādidhammasampattisādhanena parivārāya saṃvattanti.

AI Translation based on Nissaya

By being the very root cause and by accomplishing the perfection of the dhammas associated with concentration, such as contact, they conduce to its retinue.

Vietnamese AI Translation

Bằng cách là chính nguyên nhân gốc rễ và bằng cách hoàn thành sự viên mãn của các pháp (dhamma) liên quan đến định, chẳng hạn như xúc, chúng đưa đến sự tuỳ tùng cho định.

AI Translation Nissaya

mūlakāraṇabhāveneva=precisely by being the root cause. ; samādhisampayuttaphassādidhammasammattisādhanena=by accomplishing the perfection of the dhammas associated with concentration, such as contact. ; parivārāya=for the sake of a retinue. ; saṃvattanti=they conduce. ; (In the Visuddhimagga-ṭīkā, it says: 'parivārāyāti' means they conduce to the perfection of the retinue by being the root cause and by accomplishing the special dhammas such as mindfulness and energy which are the retinue of concentration.). ;

Myanmar Nissaya

mūlakāraṇabhāveneva=မူလအကြောင်းအရင်း၏ အဖြစ်သည်သာလျှင်။ ; samādhisampayuttaphassādidhammasammattisādhanena=သမာဓိနှင့်ယှဉ်သော ဖဿ အစရှိသော တရားတို့၏ ပြည့်စုံခြင်း၏ ပြီးခြင်းကြောင့်။ ; parivārāya=အခြံအရံ အလို့ငှါ။ ; saṃvattanti=ကုန်၏။ ; (ဝိသုဒ္ဓိ မဂ်ဋီကာ၌ကား- ပရိဝါရာယာတိ မူလကာရဏဘာဝေနေဝ သမာဓိဿ ပရိဝါရ ဘူတသတိဝီရိယာဒိဓမ္မဝိသေသသာဓနေန ပရိဝါရသမ္ပတ္တိယာ သံဝတ္တန္တိ။) ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4161 | Chunk: 69

Samādhissa vipassanāya ca padaṭṭhānabhāvapāpanena vasībhāvapāpanena ca paripuṇṇabhāvasādhanato pāripūriyā saṃvattanti.

AI Translation based on Nissaya

By bringing concentration to the state of being a proximate cause for insight and by bringing it to a state of mastery, thus accomplishing its state of completeness, they conduce to its fulfillment.

Vietnamese AI Translation

Bằng cách đưa định đến trạng thái là nhân cận cho tuệ và bằng cách đưa nó đến trạng thái thuần thục, do đó hoàn thành trạng thái viên mãn của nó, chúng đưa đến sự viên mãn cho định.

AI Translation Nissaya

vipassanāyaca=and of insight. ; padaṭṭhānabhāvapāpanena=by bringing it to the state of a proximate cause. ; samādhissa=of concentration. ; vasībhāvapāpaneca=and by bringing it to the state of mastery. ; paripuṇṇabhāvasādhanato=because of accomplishing the state of completeness. ; samādhissa=of concentration. ; pāripūriyā=for the sake of fulfillment. ; saṃvattanti=they conduce. ; (In the Visuddhimagga-ṭīkā, it says: 'pāripūriyāti' means they conduce to the fulfillment of concentration by accomplishing the state of mastery and by bringing it to the state of a proximate cause for insight.). ;

Myanmar Nissaya

vipassanāyaca=၏လည်း။ ; padaṭṭhānabhāvapāpanena=နီးစွာသော အကြောင်း၏ အဖြစ်သို့ ရောက်သဖြင့် လည်းကောင်း။ ; samādhissa=၏။ ; vasībhāvapāpaneca=လေ့လာသည်၏ အဖြစ်သို့ ရောက်သဖြင့်လည်းကောင်း။ ; paripuṇṇabhāvasādhanato=ပြည့်စုံသည်၏ အဖြစ်၏ ပြီးခြင်းကြောင့်။ ; samādhissa=၏။ ; pāripūriyā=ပြည့်စုံခြင်းငှါ။ ; saṃvattanti=ကုန်၏။ ; (ဝိသုဒ္ဓိမဂ် ဋီကာ၌ကား- ပါဠိပူရိယာတိ ဝသီဘာဝသမ္မာပနေန ဝိပဿနာ ပဒဋ္ဌာနဘာဝပါပနေန စ ပရိပုဏ္ဏဘာဝသာဓနတော သမာဓိဿ ပါရိပူရိယာသံဝတ္တန္တိ ဟုလာ၏။) ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4162 | Chunk: 69

Evaṃ [V1.194] sīlūpanissayena sabbākāraparipūraṃ samādhiṃ dassetvā idāni ‘‘samāhite citte yathābhūtaṃ jānāti passati, yathābhūtaṃ jānaṃ passaṃ nibbindati, nibbindaṃ virajjati, virāgā vimuccatī’’ ti ( paṭi. ma. 1.73; dī. ni. 3.359) vacanato sīlamūlakāni samādhipadaṭṭhānāni yathābhūtañāṇadassanādīni dassento ekantanibbidāyātiādimāha.

AI Translation based on Nissaya

Having thus shown concentration that is complete in all aspects through the decisive support of virtue, now, because of the teaching "When the mind is concentrated, one knows and sees things as they really are; knowing and seeing things as they really are, one becomes disenchanted; being disenchanted, one becomes dispassionate; through dispassion, one is liberated" (paṭi. ma. 1.73; dī. ni. 3.359), the General of the Dhamma, showing the knowledge and vision of things as they really are, etc., which have virtue as their root and concentration as their proximate cause, said the passage beginning with **"for utter disenchantment"**.

Vietnamese AI Translation

Sau khi đã trình bày như vậy về định được viên mãn về mọi mặt nhờ sự hỗ trợ quyết định của giới, bây giờ, do lời dạy “Khi tâm định tĩnh, người ta biết và thấy các pháp như chúng thực sự là; khi biết và thấy các pháp như chúng thực sự là, người ta trở nên nhàm chán; do nhàm chán, người ta trở nên ly tham; nhờ ly tham, người ta được giải thoát” (paṭi. ma. 1.73; dī. ni. 3.359), vị Tướng quân Chánh pháp, khi trình bày về tri kiến như thật, v.v., vốn có giới làm gốc rễ và định làm nhân cận, đã nói đoạn văn bắt đầu bằng **"vì sự nhàm chán hoàn toàn"**.

AI Translation Nissaya

evaṃ=in this way. ; sīlūpanissayena=due to the decisive support condition that is virtue. ; sabbākāraparipūraṃ=which is complete in all aspects. ; samādhiṃ=concentration. ; dassetvā=having shown. ; idāni=now. ; samāhite.la. vimuccatīti=as in "when the mind is concentrated... one is liberated". ; vacanato=because of this teaching. ; sīlamūlakāni=which have virtue as their root cause. ; samādhipadaṭṭhānāni=which have concentration as their proximate cause. ; yathābhūtañāṇadassanādīni=the knowledge and vision of things as they really are, and so on. ; dassento=showing. ; dhammasenāpati=the General of the Dhamma. ; ekantanibbidāyātiādiṃ="for utter disenchantment," etc. ; āha=he said. ; citte=the mind. ; samāhite=when concentrated. ; yathābhūtaṃ=as it really is. ; jānāti=knows. ; passati=sees. ; yathābhūtaṃ=as it really is. ; jānaṃ jānanto=the person who knows. ; passaṃ passanto=the person who sees. ; nibbindati=becomes disenchanted. ; nibbindaṃnibbindanto=the person who is disenchanted. ; vā=or, the person who is inclined towards. ; virajjati=becomes dispassionate. ; virāgā=due to dispassion. ; vimuccati=is liberated from. ;

Myanmar Nissaya

evaṃ=နည်းဖြင့်။ ; sīlūpanissayena=သီလတည်းဟူသော ပကတူပနိဿယပစ္စည်းကြောင့်။ ; sabbākāraparipūraṃ=ခပ်သိမ်းသော အခြင်းအရာအားဖြင့် ပြည့်စုံသော။ ; samādhiṃ=ကို။ ; dassetvā=၍။ ; idāni=၌။ ; samāhite.la. vimuccatīti=ဟူ၍။ ; vacanato=ဟောတော်မူခြင်းကြောင့်။ ; sīlamūlakāni=သီလလျှင် အကြောင်းအရင်းရှိကုန်သော။ ; samādhipadaṭṭhānāni=သမာဓိလျှင် နီးစွာသော အကြောင်းရှိကုန်သော။ ; yathābhūtañāṇadassanādīni=သည်တို့ကို။ ; dassento=သော။ ; dhammasenāpati=သည်။ ; ekantanibbidāyātiādiṃ=ကို။ ; āha=၏။ ; citte=သည်။ ; samāhite=သော်။ ; yathābhūtaṃ=စွာ။ ; jānāti=၏။ ; passati=၏။ ; yathābhūtaṃ=စွာ။ ; jānaṃ jānanto=သိသော ပုဂ္ဂိုလ်သည်။ ; passaṃ passanto=မြင်သော ပုဂ္ဂိုလ်သည်။ ; nibbindati=၏။ ; nibbindaṃnibbindanto=သော ပုဂ္ဂိုလ်သည်။ ; vā=ဦးလေးသော ပုဂ္ဂိုလ်သည်။ ; virajjati=တပ်ခြင်းကင်း၏။ ; virāgā=ကြောင့်။ ; vimuccati=တို့မှလွတ်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4163 | Chunk: 70

Nibbidāya hi dassitāya tassā padaṭṭhānabhūtaṃ [P1.228] yathābhūtañāṇadassanaṃ [M1.212] dassitameva hoti.

AI Translation based on Nissaya

For when disenchantment is shown, the knowledge and vision of things as they really are, which has become its proximate cause, is indeed also shown.

Vietnamese AI Translation

Vì khi sự nhàm chán được trình bày, thì tri kiến như thật, vốn đã trở thành nhân cận của nó, quả thực cũng được trình bày.

AI Translation Nissaya

hisaccaṃ=indeed. ; nibbidāya=the knowledge of disenchantment. ; dassitāya=when it is shown. ; tassā=of that knowledge of disenchantment. ; padaṭṭhānabhūtaṃ=which has become its proximate cause. ; yathābhūtañāṇadassanaṃ=the knowledge and vision of things as they really are. ; dassitameva=is indeed shown. ; hoti=it is. ;

Myanmar Nissaya

hisaccaṃ=၏။ ; nibbidāya=နိဗ္ဗီဒါဉာဏ်ကို။ ; dassitāya=ပြအပ်သည်ရှိသော်။ ; tassā=ထိုနိဗ္ဗိဒါဉာဏ်၏။ ; padaṭṭhānabhūtaṃ=နီးစွာသော အကြောင်းဖြစ်၍ ဖြစ်သော။ ; yathābhūtañāṇadassanaṃ=ကို။ ; dassitameva=သာလျှင်။ ; hoti=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4164 | Chunk: 70

Tasmiñhi asiddhe nibbidā na sijjhatīti.

AI Translation based on Nissaya

For when that knowledge and vision of things as they really are is not accomplished, disenchantment is not accomplished. Thus it should be understood.

Vietnamese AI Translation

Vì khi tri kiến như thật đó không được hoàn thành, thì sự nhàm chán cũng không được hoàn thành. Cần phải hiểu như vậy.

AI Translation Nissaya

hi saccaṃ=Indeed. ; tasmiṃ=that knowledge of the vision of things as they really are. ; asiddhe=when not accomplished. ; nibbidā=the knowledge of disenchantment. ; nasijjhati=is not accomplished. ; iti=thus. ; veditabbaṃ=should be understood. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; tasmiṃ=ထိုယထာဘူတဉာဏဒဿနဉာဏ်သည်။ ; asiddhe=သော်။ ; nibbidā=ဉာဏ်သည်။ ; nasijjhati=မပြီး။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4165 | Chunk: 70

Tāni pana vuttatthāneva.

AI Translation based on Nissaya

Now, those terms have already had their meanings explained.

Vietnamese AI Translation

Bây giờ, những thuật ngữ đó đã được giải thích ý nghĩa rồi.

AI Translation Nissaya

pana=now, setting aside the weightiness of the text. ; tāni=those terms beginning with disenchantment (nibbidā). ; vuttatthāneva=have already had their meanings explained. ;

Myanmar Nissaya

pana=ဂန္ထဂရုကို ပယ်ဦးအံ့။ ; tāni=ထိုနိဗ္ဗိဒါ အစရှိသော ပုဒ်တို့သည်။ ; vuttatthāneva=လျှငတည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4166 | Chunk: 70

Yathābhūtañāṇadassanaṃ panettha sappaccayanāmarūpapariggaho.

AI Translation based on Nissaya

Here, the knowledge and vision of things as they really are is the comprehension of name-and-form together with its causes.

Vietnamese AI Translation

Ở đây, tri kiến như thật là sự liễu tri danh-sắc cùng với các nguyên nhân của nó.

AI Translation Nissaya

pana=now, to elaborate on the nature of the knowledge and vision of things as they really are. ; ettha=here, in this context. ; yathābhūtañāṇadassanaṃ=the knowledge and vision of things as they really are means. ; sappaccayanāmarūpapariggaho=the knowledge which comprehends name-and-form together with its causes. ;

Myanmar Nissaya

pana=ယထာဘူတဉာဏဒဿန၏ သရုပ်ကို ထုတ်၍ဦးအံံ့။ ; ettha=ဤအရာ၌။ ; yathābhūtañāṇadassanaṃ=ဟူသည်။ ; sappaccayanāmarūpapariggaho=နာမ်ရုပ်၏ အကြောင်းကို သိမ်းဆည်းတတ်သော ဉာဏ်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4167 | Chunk: 70

Evaṃ amatamahānibbānapariyosānaṃ sīlappayojanaṃ dassetvā idāni tassa sīlassa adhisīlasikkhābhāvaṃ tammūlakā ca adhicittaadhipaññāsikkhā dassetukāmo evarūpānaṃ sīlānaṃ saṃvarapārisuddhi adhisīlan tiādimāha.

AI Translation based on Nissaya

Having thus shown the benefit of virtue which culminates in the deathless, the great Nibbāna, the Elder, now desiring to show how that virtue is the training in higher virtue, and to show the trainings in higher mind and higher wisdom which are rooted in it, said the passage beginning with **"The purity of restraint of such virtues is higher virtue."**

Vietnamese AI Translation

Sau khi đã trình bày như vậy về lợi ích của giới mà đỉnh cao là sự bất tử, đại Niết-bàn, vị Trưởng lão, bây giờ mong muốn trình bày giới đó là sự tu tập tăng thượng giới như thế nào, và trình bày các sự tu tập tăng thượng tâm và tăng thượng tuệ bắt nguồn từ nó, đã nói đoạn văn bắt đầu bằng **"Sự thanh tịnh do chế ngự của những giới như vậy là tăng thượng giới."**

AI Translation Nissaya

evaṃ=in this way. ; amatamahānibbānapariyosānaṃ=which culminates in the deathless, the great Nibbāna. ; sīlappayojanaṃ=the benefit of virtue. ; vā=or, the benefit attained due to the decisive support condition that is virtue. ; dassetvā=having shown. ; idāni=now. ; tassa sīlassa=of that virtue. ; adhisīlasikkhābhāvañca=the state of being the training in higher virtue, and. ; tammūlakā=which have that training in virtue as their root cause. ; adhicitta adhipaññāsikkhāca=the training in higher mind and the training in higher wisdom, and. ; dassetukāmo=the Elder, desiring to show. ; evarūpānaṃ. la. adhisīlantiādiṃ=the passage beginning with "Of such virtues... higher virtue". ; āha=said. ;

Myanmar Nissaya

evaṃ=နည်းဖြင့်။ ; amatamahānibbānapariyosānaṃ=အမတမဟာနိဗ္ဗာန်လျှင် အဆုံးရှိကုန်သော။ ; sīlappayojanaṃ=သီလကို ဖြည့်ခြင်း၌ အကျိုးကို။ ; vā=သီလတည်းဟူသော ပကတူပနိဿယ ပစ္စည်းကြောင့် ရောက်အပ်သော အကျိုးကို။ ; dassetvā=၍။ ; idāni=၌။ ; tassa sīlassa=၏။ ; adhisīlasikkhābhāvañca=အဓိသီလ သိက္ခာမည်သည်၏ အ ဖြစ်ကို လည်းကောင်း။ ; tammūlakā=ထိုသီလသိက္ခာလျှင် အကြောင်းအရင်းရှိကုန်သော။ ; adhicitta adhipaññāsikkhāca=အဓိစိတ္တသိက္ခာ အဓိပညာသိက္ခာတို့ကိုလည်းကောင်း။ ; dassetukāmo=မထေရ်သည်။ ; evarūpānaṃ. la. adhisīlantiādiṃ=ကို။ ; āha=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4168 | Chunk: 70

Tattha saṃvaroyeva pārisuddhi saṃvarapārisuddhi.

AI Translation based on Nissaya

Therein, restraint itself is purity; hence, **purity of restraint**.

Vietnamese AI Translation

Trong đó, tự thân sự chế ngự là thanh tịnh; do đó, là sự thanh tịnh do chế ngự.

AI Translation Nissaya

tattha=Therein, in the passage beginning with "Evarūpānaṃ". ; saṃvaro yeva=restraint itself. ; pārisuddhi=is called purity. ; saṃvarapārisuddhi=the purity of restraint is restraint itself which is called purity. ;

Myanmar Nissaya

tattha=ထိုဧဝရူပါနံ အစရှိသော ပါဌ်၌။ ; saṃvaro yeva=သီလကို စောင့်ရှောက်ခြင်း သည်သာလျှင်။ ; pārisuddhi=မည်သည်တည်း။ ; saṃvarapārisuddhi=သီလကို စောင့်ရှောက်ခြင်း သည်ပင်လျှင် ပါရိသုဒ္ဓိ မည်သည်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4169 | Chunk: 70

Evarūpānaṃ apariyantabhūtānaṃ vivaṭṭanissitānaṃ sīlānaṃ saṃvarapārisuddhi vivaṭṭanissitattā sesasīlato adhikaṃ sīlanti adhisīlan ti vuccati.

AI Translation based on Nissaya

The purity of restraint of such virtues—which are unlimited and dependent on that which turns away from the round of rebirth—is called **"higher virtue"** because, due to its being dependent on that which turns away from the round of rebirth, it is a virtue superior to the other virtues.

Vietnamese AI Translation

Sự thanh tịnh do chế ngự của những giới như vậy—vốn không giới hạn và phụ thuộc vào cái hướng đến sự thoát ly vòng luân hồi—được gọi là **"tăng thượng giới"** bởi vì, do nó phụ thuộc vào cái hướng đến sự thoát ly vòng luân hồi, nó là một giới cao hơn các giới khác.

AI Translation Nissaya

evarūpānaṃ=of such. ; apariyantabhūtānaṃ=which have become unlimited. ; vā=or, which are unlimited with respect to gain, fame, relatives, limbs, and life. ; vivaṭṭanissitānaṃ=which are dependent on the nine supramundane states (that turn away from the round of rebirth). ; sīlānaṃ=of the virtues. ; saṃvarapārisuddhi=the purity which is restraint. ; vivaṭṭanissitattā=because of being dependent on the nine supramundane states. ; sesasīlato=than the remaining virtues dependent on the round of rebirth. ; adhikaṃ=superior. ; sīlaṃ=is the virtue. ; iti iminā vacanatthena=because of this verbal meaning. ; adhisīlanti=as "higher virtue". ; vuccati=is called. ;

Myanmar Nissaya

evarūpānaṃ=ကုန်သော။ ; apariyantabhūtānaṃ=အပရိယန္တဖြစ်၍ ဖြစ်ကုန်သော။ ; vā=လာဘ ယသ ဉာတိ အင်္ဂ ဇီဝီတ အာဖြင့် အပိုင်းအခြားမရှိကုန်သော။ ; vivaṭṭanissitānaṃ=လောကုတတရာတရား ကိုပါးကို မှီကုန်သော။ ; sīlānaṃ=တို့ကို။ ; saṃvarapārisuddhi=စောင့်ရှောက်ခြင်းတည်းဟူသော စင်ကြယ်ခြင်းကို။ ; vivaṭṭanissitattā=လောကုတ္တရာကိုးပါးကို မှီသည်၏ အဖြစ်ကြောင့်။ ; sesasīlato=ကြွင်းသော ဝဋ္ဋနိဿိတသီလထက်။ ; adhikaṃ=လွန်သော။ ; sīlaṃ=သီလတည်း။ ; iti iminā vacanatthena=ကြောင့်။ ; adhisīlanti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4170 | Chunk: 70

Saṃvarapārisuddhiyā ṭhitaṃ cittan ti edisāya sīlasaṃvarapārisuddhiyā patiṭṭhitaṃ cittaṃ suṭṭhu avippaṭisārādīnaṃ āvahanato na vikkhepaṃ gacchati, samādhismiṃ patiṭṭhātīti attho.

AI Translation based on Nissaya

**The mind established in the purity of restraint**: a mind established in such purity of restraint of virtue, because it brings about non-remorse and so on, does not go to distraction; it becomes established in concentration. This is the meaning.

Vietnamese AI Translation

Tâm được thiết lập trong sự thanh tịnh do chế ngự: một tâm được thiết lập trong sự thanh tịnh do chế ngự của giới như vậy, bởi vì nó mang lại sự không hối tiếc, v.v., không đi đến tán loạn; nó được thiết lập trong định. Đây là ý nghĩa.

AI Translation Nissaya

saṃvarapārisuddhiyā=in the purity of restraint. ; patiṭṭhitaṃ=established. ; cittaṃ=the mind accomplished through virtue. ; vā=or, the concentration accomplished through virtue. ; suṭṭhu=well. ; avippaṭisārādīnaṃ=non-remorse, etc. ; āvahanato=because of bringing about. ; vikkhepaṃ=to distraction. ; nagacchati=does not go. ; samādhismiṃ=in concentration. ; patiṭṭhāti=it is established. ; itiayaṃ=this. ; attho=is the meaning. ;

Myanmar Nissaya

saṃvarapārisuddhiyā=၌။ ; patiṭṭhitaṃ=သော။ ; cittaṃ=သီလဖြင့် ပြီးသော စိတ်သည်။ ; vā=သီလဖြင့် ပြီးသော သမာဓိသည်။ ; suṭṭhu=စွာ။ ; avippaṭisārādīnaṃ=အစရှိသည်တို့ကို။ ; āvahanato=အားထုတ်တတ်သော ကြောင့်။ ; vikkhepaṃ=ခြင်းသို့။ ; nagacchati=မရောက်။ ; samādhismiṃ=၌။ ; patiṭṭhāti=တည်၏။ ; itiayaṃ=ကား။ ; attho=တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4171 | Chunk: 70

Avikkhepoyeva pārisuddhi avikkhepapārisuddhi.

AI Translation based on Nissaya

Non-distraction itself is purity; hence, **purity of non-distraction**.

Vietnamese AI Translation

Tự thân sự không tán loạn là thanh tịnh; do đó, là sự thanh tịnh do không tán loạn.

AI Translation Nissaya

avikkhepoyeva=sensual-sphere concentration itself. ; vā=or, absorption-concentration itself. ; pārisuddhi=is purity. ; avikkhepapārisuddhi=is called purity of non-distraction. ;

Myanmar Nissaya

avikkhepoyeva=ကာမာဝစရသမာဓိသည်ပင်လျှင်။ ; vā=အပ္ပနာသမာဓိသည်ပင်လျှင်။ ; pārisuddhi=တည်း။ ; avikkhepapārisuddhi=မည်သည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4172 | Chunk: 70

So sabbamalavirahito nibbedhabhāgiyo samādhi sesasamādhito adhikattā adhicittan ti vuccati.

AI Translation based on Nissaya

That concentration, which is free from all stains and partakes of the knowledge leading to penetration, is called **"higher mind"** because it is superior to other concentration.

Vietnamese AI Translation

Định đó, vốn không có mọi vết nhơ và có phần trong trí tuệ dẫn đến sự thâm nhập, được gọi là **"tăng thượng tâm"** bởi vì nó cao hơn các loại định khác.

AI Translation Nissaya

sabbamalavirahito=free from all stains, i.e., the stain of craving for absorption. ; nibbedhabhāgiyo=which partakes of the knowledge of disenchantment. ; so samādhi=that sensual-sphere concentration or absorption-concentration. ; sesasamādhito=than the remaining concentration that does not partake of penetration. ; adhikattā=because it is superior. ; adhicittanti=as "higher mind". ; vuccati=is called. ;

Myanmar Nissaya

sabbamalavirahito=ဈာန်၌ တပ်ခြင်းတဏှာတည်းဟူသော ဥဿုံသော အညစ်အကြေးမှ ကင်းသော။ ; nibbedhabhāgiyo=နိဗ္ဗိဒါဉာဏ်လျှင် အဖို့ရှိသော။ ; so samādhi=ထိုကာမာဝစရသမာဓိ အပ္ပနာသမာဓိကို။ ; sesasamādhito=ကြွင်းသော အနိဗ္ဗေဓဘာဂိယ သမာဓိထက်။ ; adhikattā=ကြောင့်။ ; adhicittanti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4173 | Chunk: 70

Cittasīsena hettha samādhi niddiṭṭho.

AI Translation based on Nissaya

Indeed, here concentration is pointed out under the heading of mind.

Vietnamese AI Translation

Thật vậy, ở đây định được chỉ ra dưới tiêu đề của tâm.

AI Translation Nissaya

hi saccaṃ=Indeed. ; ettha=here in this higher mind-virtue. ; cittasīsena=with the heading of mind. ; samādhi=concentration. ; niddiṭṭho=is pointed out. ;

Myanmar Nissaya

hi saccaṃ=၏။ ; ettha=ဤအဓိစိတ္တသီလ၌။ ; cittasīsena=သ ဖြင့်။ ; samādhi=ကို။ ; niddiṭṭho=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4174 | Chunk: 70

Saṃvarapārisuddhiṃ sammā passatīti parisuddhaṃ sīlasaṃvaraṃ ñātapariññāvasena tīraṇapariññāvasena ca sammā passati, evameva avikkhepapārisuddhisaṅkhātaṃ parisuddhaṃ samādhiṃ sammā passati.

AI Translation based on Nissaya

**"One rightly sees the purity of restraint"**: one rightly discerns the pure restraint of virtue by way of comprehension as knowledge and comprehension as judgment. In the same way, one rightly discerns the pure concentration called the purity of non-distraction.

Vietnamese AI Translation

"Người ta thấy đúng sự thanh tịnh do chế ngự": người ta phân biệt đúng sự chế ngự thanh tịnh của giới bằng tuệ tri và bằng thẩm sát. Tương tự như vậy, người ta phân biệt đúng sự định tĩnh thanh tịnh được gọi là sự thanh tịnh do không tán loạn.

AI Translation Nissaya

saṃvarapārisuddhiṃ sammāpassatīti=The phrase "sees the purity of restraint rightly" means. ; pārisuddhiṃ=pure. ; sīlasaṃvaraṃ=virtuous restraint. ; ñātapariññāvasena=by way of knowledge as comprehension, and. ; tīraṇapariññāvasenaca=by way of judging as comprehension. ; sammā=rightly. ; passati=one discerns. ; vā=or, contemplates. ; evameva=just so. ; avikkhepapārisuddhisaṅkhātaṃ=called the purity of non-distraction. ; parisuddhiṃ=pure. ; samādhiṃ=concentration. ; ñātapariññāvasena=by way of knowledge as comprehension, and. ; tīraṇapariññāvasenaca=by way of judging as comprehension. ; sammā=rightly. ; passati=one discerns. ; vā=or, contemplates. ; evameva=just so. ; avikkhepapārisuddhisaṅkhātaṃ=called the purity of non-distraction. ; parisuddhiṃ=pure. ; samādhiṃ=concentration. ; ñātapariññāvasena=by way of knowledge as comprehension, and. ; tīraṇa- pariññāvasenaca=by way of judging as comprehension. ; sammā=rightly. ; passati=one discerns. ; vā=or, contemplates. ;

Myanmar Nissaya

saṃvarapārisuddhiṃ sammāpassatīti=ကား။ ; pārisuddhiṃ=သော။ ; sīlasaṃvaraṃ=ခြင်းကို။ ; ñātapariññāvasena=ဖြင့်လည်းကောင်း။ ; tīraṇapariññāvasenaca=ဖြင့်လည်းကောင်း။ ; sammā=စွာ။ ; passati=ပိုင်းခြား၏။ ; vā=ရှု၏။ ; evameva=သာလျှင်။ ; avikkhepapārisuddhisaṅkhātaṃ=ဟု ဆိုအပ်သော။ ; parisuddhiṃ=သော။ ; samādhiṃ=ကို။ ; ñātapariññāvasena=ဖြင့် လည်းကောင်း။ ; tīraṇapariññāvasenaca=ဖြင့်လည်းကောင်း။ ; sammā=စွာ။ ; passati=ပိုင်းခြား၏။ ; vā=ရှု၏။ ; evameva=သာလျှင်။ ; avikkhepapārisuddhisaṅkhātaṃ=ဟု ဆိုအပ်သော။ ; parisuddhiṃ=သော။ ; samādhiṃ=ကို။ ; ñātapariññāvasena=ဖြင့်လည်းကောင်း။ ; tīraṇa- pariññāvasenaca=ဖြင့်လည်းကောင်း။ ; sammā=စွာ။ ; passati=၏။ ; vā=ရှု၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4175 | Chunk: 70

Evaṃ passato cassa dassanasaṅkhātā pārisuddhi dassanapārisuddhi.

AI Translation based on Nissaya

For one who contemplates thus, the purity called vision is **purity of vision**.

Vietnamese AI Translation

Đối với người quán chiếu như vậy, sự thanh tịnh được gọi là tri kiến là sự thanh tịnh do tri kiến.

AI Translation Nissaya

evaṃ=thus. ; passatoca=one who also contemplates. ; vā=or, one who also is able to discern and contemplate with the two kinds of full understanding. ; assa=of that yogi person. ; dassanasaṅkhātā=called vision. ; vā=or, called discerning and contemplating. ; pārisuddhi=purity. ; dassanapārisuddhi=is called purity of vision. ;

Myanmar Nissaya

evaṃ=သို့။ ; passatoca=ရှုသည်လည်းဖြစ်သော။ ; vā=ပရိညာနှစ်ပါးဖြင့် ပိုင်းခြားတတ် ရှုတတ်သည်လည်းဖြစ်သော။ ; assa=ထို ယောဂီ ပုဂ္ဂိုလ်၏။ ; dassanasaṅkhātā=ဒဿနဆိုအပ်သော။ ; vā=ပိုင်းခြားခြင်း ရှုခြင်းဟု ဆိုအပ်သော။ ; pārisuddhi=သည်။ ; dassanapārisuddhi=မည်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4176 | Chunk: 70

Sāyeva sesapaññāya adhikattā adhipaññāti vuccati.

AI Translation based on Nissaya

That same purity of vision is called **"higher wisdom"** because it is superior to other wisdom.

Vietnamese AI Translation

Chính sự thanh tịnh do tri kiến đó được gọi là **"tăng thượng tuệ"** bởi vì nó cao hơn các loại tuệ khác.

AI Translation Nissaya

sāyeva=that same purity of vision itself. ; sesapaññāya=than the remaining wisdom which is not purity of vision. ; adhikattā=because it is superior. ; adhipaññāti=as "higher wisdom". ; vuccati=is called. ;

Myanmar Nissaya

sāyeva=ထိုဒဿနပါရိသုဒ္ဓိကို ပင်လျှင်။ ; sesapaññāya=ကြွင်းသော အဒဿနပါရိသုဒ္ဓိပညာထက်။ ; adhikattā=လွန်သည်၏ အဖြစ်ကြောင့်။ ; adhipaññāti=ဟူ၍။ ; vuccati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4177 | Chunk: 70

Yo tatthāti yo tattha saṃvaraavikkhepadassanesu.

AI Translation based on Nissaya

**Whatever there**: Among that purity of restraint, purity of non-distraction, and purity of vision...

Vietnamese AI Translation

Bất cứ điều gì ở đó: Trong số sự thanh tịnh do chế ngự, sự thanh tịnh do không tán loạn, và sự thanh tịnh do tri kiến đó...

AI Translation Nissaya

yo tatthāti=The phrase "Whatever there..." means. ; tattha saṃvaraavikkhepadassanesu=among that purity of restraint, purity of non-distraction, and purity of vision. ; yo saṃvaraṭṭho=whatever is the nature of restraint. ;

Myanmar Nissaya

yo tatthāti=ကား။ ; tattha saṃvaraavikkhepadassanesu=ထိုသံဝရပါရိသုဒ္ဓိ အဝိက္ခေပပါရိသုဒ္ဓိ ဒဿနပါရိသုဒ္ဓိတို့တွင်။ ; yo saṃvaraṭṭho=အကြင်စောင့်ရှောက်ခြင်းသဘောသည်။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4178 | Chunk: 70

Saṃvaraṭṭhoti saṃvarabhāvo.

AI Translation based on Nissaya

**The nature of restraint** is the state of being restraint.

Vietnamese AI Translation

Bản chất của sự chế ngự là trạng thái của sự chế ngự.

AI Translation Nissaya

saṃvaraṭṭhoti=The nature of restraint means. ; saṃvarabhāvo=the state of being restraint. ;

Myanmar Nissaya

saṃvaraṭṭhoti=ကား။ ; saṃvarabhāvo=စောင့်ရှောက်သည်၏ အဖြစ်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4179 | Chunk: 70

Evameva avikkhepaṭṭhadassanaṭṭhā ca veditabbā.

AI Translation based on Nissaya

In the same way, the nature of non-distraction and the nature of vision should be understood.

Vietnamese AI Translation

Tương tự như vậy, bản chất của sự không tán loạn và bản chất của tri kiến cũng cần được hiểu.

AI Translation Nissaya

evameva=just so. ; avikkhepaṭṭhadassanaṭṭhāca=the terms 'nature of non-distraction' and 'nature of vision' also. ; veditabbā=should be understood. ;

Myanmar Nissaya

evameva=သာလျှင်။ ; avikkhepaṭṭhadassanaṭṭhāca=အဝိက္ခေပဋ္ဌဟူသော ပုဒ် ဒဿနဋ္ဌဟူသော ပုဒ်တို့ကိုလည်း။ ; veditabbā=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4180 | Chunk: 70

Adhisīlameva sikkhā adhisīlasikkhā.

AI Translation based on Nissaya

Higher virtue itself is the training; hence, **training in higher virtue**.

Vietnamese AI Translation

Tự thân tăng thượng giới là sự tu tập; do đó, là sự tu tập tăng thượng giới.

AI Translation Nissaya

adhisīlameva=higher virtue itself. ; sikkhā=is the training. ; adhisīlasikkhā=training in higher virtue. ;

Myanmar Nissaya

adhisīlameva=သည်သာလျှင်။ ; sikkhā=တည်း။ ; adhisīlasikkhā=သိက္ခာ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4181 | Chunk: 70

Evaṃ itarāpi veditabbā.

AI Translation based on Nissaya

The others should be understood in the same way.

Vietnamese AI Translation

Các trường hợp khác cũng cần được hiểu theo cách tương tự.

AI Translation Nissaya

evaṃ=in this way. ; itarāpi=the others also. ; veditabbā=should be understood. ;

Myanmar Nissaya

evaṃ=ဖြင့်။ ; itarāpi=တို့ကိုလည်း။ ; veditabbā=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4182 | Chunk: 70

Evaṃ tisso sikkhāyo dassetvā idāni tāsaṃ pāripūrikkamaṃ dassetuṃ imā tisso sikkhāyo āvajjanto sikkhatītiādimāha.

AI Translation based on Nissaya

Having shown the three trainings in this way, now, in order to show the sequence of their fulfillment, the Elder said the passage beginning with **"Adverting to these three trainings, one trains."**

Vietnamese AI Translation

Sau khi đã trình bày ba sự tu tập theo cách này, bây giờ, để trình bày trình tự hoàn thành của chúng, vị Trưởng lão đã nói đoạn văn bắt đầu bằng **"Hướng tâm đến ba sự tu tập này, người ta tu tập."**

AI Translation Nissaya

evaṃ=in this way. ; tisso=the three. ; sikkhāyo=trainings. ; dassetvā=having shown. ; idāni=now. ; tāsaṃ=of those. ; vā=or them. ; pāripūriimaṃ=the sequence of fulfillment. ; vā=or the sequence of factors to be fulfilled by practice. ; dassetuṃ=in order to show. ; imā tisso sikkhāyo āvajjanto sikkhatītiādiṃ=the passage beginning with "Adverting to these three trainings, one trains". ; thero=the Elder. ; āha=said. ;

Myanmar Nissaya

evaṃ=သောနည်းဖြင့်။ ; tisso=ကုန်သော။ ; sikkhāyo=တို့ကို။ ; dassetvā=၍။ ; idāni=၌။ ; tāsaṃ=တို့၏။ ; vā=တို့ကို။ ; pāripūriimaṃ=ပြည့်စုံခြင်းအစဉ်ကို။ ; vā=ဖြည့်ကျင့်အပ်သော အင်္ဂါအစဉ်ကို။ ; dassetuṃ=ငှါ။ ; imā tisso sikkhāyo āvajjanto sikkhatītiādiṃ=ကို။ ; thero=သည်။ ; āha=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4183 | Chunk: 70

Tassattho – paccekaṃ paripūretuṃ āvajjantopi sikkhati nāma, āvajjetvā ‘‘ayaṃ nāma sikkhā’’ ti jānantopi sikkhati nāma, jānitvā punappunaṃ passantopi sikkhati nāma, passitvā yathādiṭṭhaṃ paccavekkhantopi sikkhati nāma, paccavekkhitvā tattheva cittaṃ acalaṃ katvā patiṭṭhapentopi sikkhati nāma, taṃtaṃsikkhāsampayuttasaddhāvīriyasatisamādhipaññāhi sakasakakiccaṃ karontopi sikkhati nāma, abhiññeyyābhijānanādikālepi taṃ taṃ kiccaṃ karonto tissopi sikkhāyo sikkhati nāmāti [V1.195].

AI Translation based on Nissaya

Its meaning is this: one who adverts in order to fulfill each training individually is called "one who trains"; having adverted, one who knows "This is a training," is called "one who trains"; having known, one who sees it again and again is called "one who trains"; having seen, one who reviews it just as it was seen is called "one who trains"; having reviewed, one who makes the mind unshakable and establishes it right there is called "one who trains"; one who performs their respective functions through the faith, energy, mindfulness, concentration, and wisdom associated with those respective trainings is called "one who trains"; even at the time of directly knowing what is to be directly known, one who performs the respective functions (of comprehension, abandoning, realization, and development) is called "one who trains in the three trainings."

Vietnamese AI Translation

Ý nghĩa của nó là như sau: người hướng tâm để hoàn thành từng sự tu tập riêng lẻ được gọi là "người đang tu tập"; sau khi hướng tâm, người biết "Đây là một sự tu tập," được gọi là "người đang tu tập"; sau khi biết, người thấy nó lặp đi lặp lại được gọi là "người đang tu tập"; sau khi thấy, người thẩm xét lại nó đúng như đã thấy được gọi là "người đang tu tập"; sau khi thẩm xét, người làm cho tâm không lay động và thiết lập nó ngay tại đó được gọi là "người đang tu tập"; người thực hiện các chức năng tương ứng của mình thông qua tín, tấn, niệm, định, và tuệ liên quan đến các sự tu tập tương ứng đó được gọi là "người đang tu tập"; ngay cả vào thời điểm thắng tri những gì cần được thắng tri, người thực hiện các chức năng tương ứng (của liễu tri, đoạn tận, chứng ngộ và tu tập) được gọi là "người đang tu tập trong ba sự tu tập."

AI Translation Nissaya

tassa=of that passage beginning with "Imā tisso...". ; (attho=the meaning. ; evaṃ=in this way which will be explained. ; veditabbo=should be understood.) ; paccekaṃ=each one individually. ; paripūretuṃ=in order to fulfill. ; āvajjantopi=even a person who adverts. ; sikkhatināma=is called one who trains. ; āvajjetvā=having adverted. ; ayaṃnāma="This so-and-so dhamma". ; sikkhā=is a training. ; vā=is a dhamma that should be practiced. ; iti=thus. ; pūretuṃ=in order to fulfill. ; jānantopi=even a person who knows. ; sikkhātināma=is called one who trains. ; jānitvā=having known. ; punappunaṃ=again and again. ; pūretuṃ=in order to. ; passantopi=even a person who sees. ; sikkhātināma=is called one who trains. ; passitvā=having seen. ; yathādiṭṭhaṃ=just as seen. ; pūretuṃ=in order to. ; paccavekkhantopi=even a person who reviews. ; sikkhātināma=is called one who trains. ; paccavekkhitvā=having reviewed. ; tattheva=right in that training-precept as seen. ; cittaṃ=the mind. ; acalaṃ=unshakable. ; katvā=having made. ; pūretuṃ=in order to. ; patiṭṭhapentopi=even a person who establishes. ; sikkhātināma=is called one who trains. ; taṃtaṃsikkhāsampayuttasaddhāvīriyasasatisamādhipaññāhi=due to the faith, energy, mindfulness, concentration, and wisdom associated with those respective trainings in higher virtue, higher mind, and higher wisdom. ; vā=or, by means of those wisdoms. ; sakasakakiccaṃ=their own respective functions, i.e., of the dhammas beginning with faith. ; karontopi=a person who performs. ; esa eso puggalo=this person. ; sikkhatināma=trains. ; tanaññaḥ=. ; taṃtaṃ sikkhāsampayuttasaddhāvīriyasatisamādhipaññāhi=those faith, energy, mindfulness, concentration, and wisdom associated with the respective trainings. ; sakasakakiccaṃ=their respective functions. ; karontova=the three trainings that cause to be performed. ; sikkhātināma=are called training. ; abhiññeyyābhijānanādikālepi=even at the time of directly knowing that which is to be directly known, etc. ; taṃtaṃ kiccaṃ=those respective functions of knowing by comprehension, abandoning, realizing, and developing. ; karontopi=a person who causes to be performed. ; tisso=the three. ; sikkhāyo=trainings. ; sikkhatināma=trains in. ; iti ayaṃ attho=this meaning. ; veditabbo=should be understood. ;

Myanmar Nissaya

tassa=ထိုဣမာ တိဿော- အစရှိသော ပါဌ်၏။ ; (attho=ကို။ ; evaṃ=ဤဆိုလတ္တံ့သော နည်းဖြင့်။ ; veditabbo=၏။) ; paccekaṃ=အသီးအသီ။ ; paripūretuṃ=ပြည့်စုံခြင်းငှါ။ ; āvajjantopi=ဆင်ခြင်သော ပုဂ္ဂိုလ်သည်လည်း။ ; sikkhatināma=ကျင့်သည်မည်၏။ ; āvajjetvā=ဆင်ခြင်ပြီး၍။ ; ayaṃnāma=ဤမည်သော တရားသည်ကား။ ; sikkhā=သိက္ခာတည်း။ ; vā=ကျင့်အပ်သော တရားတည်း။ ; iti=ဤသို့။ ; pūretuṃ=ပြည့်ခြင်းငှါ။ ; jānantopi=သည်လည်း။ ; sikkhātināma=မည်၏။ ; jānitvā=ပြီး၍။ ; punappunaṃ=လဲလဲ။ ; pūretuṃ=ငှာ။ ; passantopi=သည်လည်း။ ; sikkhātināma=မည်၏။ ; passitvā=၍။ ; yathādiṭṭhaṃ=မြင်သောအတိုင်း။ ; pūretuṃ=ငှါ။ ; paccavekkhantopi=သည်လည်း။ ; sikkhātināma=မည်၏။ ; paccavekkhitvā=ပြီး၍။ ; tattheva=ထိုမြင်တိုင်းသော သိက္ခာပုဒ်၌သာလျှင်။ ; cittaṃ=ကို။ ; acalaṃ=ခြင်းမရှိသည်ကို။ ; katvā=၍။ ; pūretuṃ=ငှါ။ ; patiṭṭhapentopi=တည်စေအပ်သော ပုဂ္ဂိုလ်သည်လည်း။ ; sikkhātināma=မည်၏။ ; taṃtaṃsikkhāsampayuttasaddhāvīriyasasatisamādhipaññāhi=ထိုထိုအဓိသီလ အဓိစိတ္တ အဓိပညာ သိက္ခာတို့နှင့် ယှဉ်ကုန်သော သဒ္ဓါ ဝီရိယ သတိ သမာဓိ ပညာတို့ကြောင့်။ ; vā=ပညာတို့ဖြင့်။ ; sakasakakiccaṃ=သဒ္ဓါ အစရှိသော တရားတည်းဟူသော မိမိတို့၏ ကိစ္စကို။ ; karontopi=ပြုသည်လည်း ဖြစ်သော။ ; esa eso puggalo=သည်။ ; sikkhatināma=၏။ ; tanaññaḥ= ; taṃtaṃ sikkhāsampayuttasaddhāvīriyasatisamādhipaññāhi=တို့ကို။ ; sakasakakiccaṃ=ကို။ ; karontova=ပြုစေသော သိက္ခာသုံးပါးသည်လည်း။ ; sikkhātināma=၏။ ; abhiññeyyābhijānanādikālepi=အဘိညေယျတရားကို သိခြင်း အစရှိသောအခါ၌လည်း။ ; taṃtaṃ kiccaṃ=ထိုထိုပိုင်းခြား၍ သိခင်း ပယ်ခင်း မျက်မှောက်ပြုခြင်း ပွားခြင်းတည်းဟူသော ကိစ္စကို။ ; karontopi=ပြုစေသော ပုဂ္ဂိုလ်သည်လည်း။ ; tisso=ကုန်သော။ ; sikkhāyo=တို့ကို။ ; sikkhatināma=၏။ ; iti ayaṃ attho=ကို။ ; veditabbo=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4184 | Chunk: 70

Puna [P1.229] pañca sīlānītiādīni vuttatthāneva.

AI Translation based on Nissaya

Again, the terms beginning with **the five precepts** have already had their meanings explained.

Vietnamese AI Translation

Một lần nữa, các thuật ngữ bắt đầu bằng năm giới đã được giải thích ý nghĩa.

AI Translation Nissaya

puna=again. ; vuttāni=explained. ; pañcasīlānītiādīni=these terms beginning with "the five precepts". ; vuttatthāneva=have already had their meanings explained. ;

Myanmar Nissaya

puna=ဖန်။ ; vuttāni=ကုန်သော။ ; pañcasīlānītiādīni=ဤသို့ အစရှိသော ပုဒ်တို့သည်။ ; vuttatthāneva=လျှင်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4185 | Chunk: 70

Arahattamaggena sabbakilesānan tiādīsu pana [M1.213] arahantānaṃ suṭṭhu vippaṭisārādiabhāvato āsevanādibhāvato ca tāni padāni yujjanteva.

AI Translation based on Nissaya

In the passages beginning with **"By the path of Arahatship, all defilements..."**, for the Arahants, due to the complete absence of remorse and so on, and the manifestation of cultivation and so on, those phrases are indeed suitable.

Vietnamese AI Translation

Trong các đoạn bắt đầu bằng "Do đạo A-la-hán, tất cả các phiền não...", đối với các vị A-la-hán, do sự vắng mặt hoàn toàn của sự hối tiếc, v.v., và sự biểu hiện của sự tu tập, v.v., những cụm từ đó quả thực là phù hợp.

AI Translation Nissaya

pana=Now, to speak of a special point. ; arahattamaggena sabbakilesānantiādīsu=In the passages beginning with "by the path of arahatship, all defilements...". ; arahantānaṃ=for the arahants. ; suṭṭhu=exceedingly. ; (hitanhacakhyaka၏ kriyā visesana) vippaṭisārādiabhāvato=due to the absence of remorse, etc., and. ; (with 'etc.', joy and so on should be included.) ; āsevanādibhāvatoca=due to the manifestation of cultivation, etc., and. ; (with 'etc.', development and making much of should be included.) ; tāni padāni=those terms, such as "conduce to non-remorse... conduce to fulfillment". ; yujjanteva=are indeed suitable. ;

Myanmar Nissaya

pana=ဆိုဖွယ်အထူး မိန့်ဆိုဦးအံ့။ ; arahattamaggena sabbakilesānantiādīsu=ဤသို့ အစရှိသော ပါဌ်တို့၌။ ; arahantānaṃ=တို့အား။ ; suṭṭhu=လွန်မင်းစွာ။ ; (hitanhacakhyaka၏ kriyā visesana) vippaṭisārādiabhāvato=ဝိပ္ပဋိသာရ အစရှိသည်တို့၏ မရှိခြင်းကြောင့်လည်းကောင်း။ ; (အာဒိသဒ္ဒါဖြင့်၊ အပါမောဇ္ဇ အစရှိသည်ကိုယူ။) ; āsevanādibhāvatoca=အာသေဝန အစရှိသည်၏ ထင်ရှားခြင်းကြောင့်လည်းကောင်း။ ; (ဘာဝနာဗဟုလီကမ္မ စသည်ကို အာဒိသဒ္ဒါဖြင့် ယူပါ။) ; tāni padāni=ထိုအဝိပ္ပဋိသာရာယ သံဝတ္တန္တိ ။လ။ ပါရိပူရိယာ သံဝတ္တန္တိ ဟူသော ပုဒ်တို့သည်။ ; yujjanteva=သင့်လျော်ကုန်သည်သာလျှင်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4186 | Chunk: 70

Ekantanibbidāyātiādīni pana satipaṭṭhānasammappadhānāni viya maggakkhaṇeyeva yojetabbāni.

AI Translation based on Nissaya

The terms beginning with **"for utter disenchantment"**, however, should be applied only at the moment of the path, just like the foundations of mindfulness and the right strivings.

Vietnamese AI Translation

Tuy nhiên, các thuật ngữ bắt đầu bằng "vì sự nhàm chán hoàn toàn", chỉ nên được áp dụng vào khoảnh khắc của đạo, giống như các niệm xứ và các chánh cần.

AI Translation Nissaya

pana=Now, to state the reason for the suitability of the terms starting with 'ekantanibbidāya'. ; ekantanibbidāyātiādīni=these terms beginning with "for utter disenchantment". ; satipaṭṭhānasammappadhānāni vīya=like the foundations of mindfulness and the right strivings. ; maggakkhaṇeyeva=only at the moment of the path of arahatship. ; yojetabbāni=should be applied. ;

Myanmar Nissaya

pana=ဧကန္တနိဗ္ဗိဒါယ စသော ပုဒ်တို့၏ သင့်လျော်ကြောင်းကို ဆိုဦးအံ့။ ; ekantanibbidāyātiādīni=ဤသို့ အစရှိသော ပုဒ်တို့ကို။ ; satipaṭṭhānasammappadhānāni vīya=တို့ကဲ့သို့။ ; maggakkhaṇeyeva=အရဟတ္တမဂ် ခဏ၌သာလျှင်။ ; yojetabbāni=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4187 | Chunk: 70

Saṃvarapārisuddhiṃ sammā passati , avikkhepapārisuddhiṃ sammā passatīti idaṃ pana vacanadvayaṃ phalasamāpattatthāya vipassanāvasena yojetabbaṃ, dutiyavacanaṃ pana nirodhasamāpattatthāya vipassanāvasenāpi yujjati.

AI Translation based on Nissaya

The pair of phrases, **"one rightly sees the purity of restraint, one rightly sees the purity of non-distraction"**, should be applied by way of insight for the sake of attaining the fruition attainment. The second phrase, however, is also suitable by way of insight for the sake of attaining the attainment of cessation.

Vietnamese AI Translation

Cặp cụm từ, "người ta thấy đúng sự thanh tịnh do chế ngự, người ta thấy đúng sự thanh tịnh do không tán loạn", nên được áp dụng theo phương diện tuệ vì mục đích đạt được quả chứng. Tuy nhiên, cụm từ thứ hai cũng phù hợp theo phương diện tuệ vì mục đích đạt được diệt tận định.

AI Translation Nissaya

pana=Now, to state the reason for the suitability of the terms starting with 'saṃvarapārisuddhiṃ sammā passati'. ; saṃvarapārisuddhiṃ sammā passati=The pair of phrases "one rightly sees the purity of restraint, one rightly sees the purity of non-distraction". ; phalasamāpattattāya=for the sake of the attainment of fruition. ; pavattena=which occurs. ; vipassanā vasena=by way of insight. ; yojetabbaṃ=should be applied. ; dutiyavacanaṃ pana=the second phrase, "one rightly sees the purity of non-distraction," however. ; nirodhasamāpattatthāya=for the sake of the attainment of cessation. ; pavattena=which occurs. ; vipassanā vasenāpi=also by way of insight. ; yujjati=is suitable. ;

Myanmar Nissaya

pana=သံဝရပါရိသုဒ္ဓိံ သမ္မာ ပဿတိ အစရှိသော ပုဒ်တို့၏ သင့်ကြောင်းကို ဆိုဦးအံ့။ ; saṃvarapārisuddhiṃ sammā passati=အဝိက္ခေပပါရိသုဒ္ဓိံ သမ္မာ ပဿတီတိ ဣဒံ ဝစနဒွယံ ဟူသော သဒ္ဒါနှစ်ပါးတို့၏ အပေါင်းကို။ ; phalasamāpattattāya=အလို့ငှါ။ ; pavattena=ဖြစ်သော။ ; vipassanā vasena=ဖြင့်။ ; yojetabbaṃ=၏။ ; dutiyavacanaṃ pana=အဝိက္ခေပပါရိသုဒ္ဓိံ သမ္မာ ပဿတိ ဟူသော ဒုတိယသဒ္ဒါသည်ကား။ ; nirodhasamāpattatthāya=အလို့ငွှ။ ; pavattena=သော။ ; vipassanā vasenāpi=ဖြင့်လည်း။ ; yujjati=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4188 | Chunk: 70

Āvajjanto sikkhatītiādīsu pañcasu vacanesu arahato sikkhitabbābhāvepi asekkhasīlakkhandhādisabhāvato ‘‘sikkhatī’’ ti vuttanti veditabbaṃ.

AI Translation based on Nissaya

In the five phrases beginning with **"Adverting, one trains"**, it should be understood that although for an Arahant there is no training to be undertaken, it is said "one trains" due to the nature of the aggregates of a non-trainee's virtue and so on.

Vietnamese AI Translation

Trong năm cụm từ bắt đầu bằng "Hướng tâm, người ta tu tập", cần hiểu rằng mặc dù đối với một vị A-la-hán không có sự tu tập nào cần phải thực hiện, nhưng nó được nói là "người ta tu tập" do bản chất của các uẩn giới của bậc vô học, v.v.

AI Translation Nissaya

āvajjanto sikkhatīti ādīsu=In the five phrases beginning with. ; pañcasu="Adverting, one trains". ; vacanesu=in these phrases. ; arahato=for an Arahant. ; vā=or, an Arahant. ; sikkhitabbābhāvepi=although there is no training to be undertaken. ; asekkhasīlakkhandhādisabhāvato=due to the nature of the aggregates of a non-trainee's virtue, etc. ; vā=due to the nature of the aggregates of a non-trainee's virtue, wisdom, liberation, and knowledge and vision of liberation. ; sikkhatīti=as "one trains". ; vuttaṃ=it is said. ; iti=thus. ; veditabbaṃ=should be understood. ;

Myanmar Nissaya

āvajjanto sikkhatīti ādīsu=ဤသို့ အစရှိကုန်သော။ ; pañcasu=ကုန်သော။ ; vacanesu=သဒ္ဒါတို့၌။ ; arahato=အား။ ; vā=သည်။ ; sikkhitabbābhāvepi=ကျင့်အပ်သော သိက္ခာ မရှိလျှင်မူလည်း။ ; asekkhasīlakkhandhādisabhāvato=အသေက္ခ သီလက္ခန္ဓ အစရှိသော တရားတို့၏ အဖြစ်ကြောင့်။ ; vā=အသေက္ခသီလက္ခန္ဓ ပညာက္ခန္ဓ ဝိမုတ္တိက္ခန္ဓ ဝီမုတ္တိဉာဏဒဿနက္ခန္ဓ တရားတို့၏ အဖြစ်ကြောင့်။ ; sikkhatīti=ဟူ၍။ ; vuttaṃ=၏။ ; iti=သို့။ ; veditabbaṃ=၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4189 | Chunk: 70

Saddhāya adhimuccanto sikkhatītiādīni pana maggakkhaṇaññeva sandhāya vuttāni.

AI Translation based on Nissaya

The phrases beginning with **"Being resolved through faith, one trains"** are spoken with reference only to the moment of the path.

Vietnamese AI Translation

Các cụm từ bắt đầu bằng "Quyết định qua đức tin, người ta tu tập" được nói chỉ liên quan đến khoảnh khắc của đạo.

AI Translation Nissaya

pana=Furthermore. ; saddhāya adhimuccanto sikkhatīti ādīni=the phrases beginning with "Being resolved through faith, one trains". ; maggakkhaṇaññeva=only the moment of the path of arahatship. ; sandhāya=with reference to. ; vuttāni=are spoken. ;

Myanmar Nissaya

pana=ထိုမှ တစ်ပါး။ ; saddhāya adhimuccanto sikkhatīti ādīni=ဤသို့ အစရှိသော ပုဒ်တို့ကို။ ; maggakkhaṇaññeva=အရဟတ္တမဂ် ခဏကိုသာလျှင်။ ; sandhāya=၍။ ; vuttāni=ကုန်၏။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4190 | Chunk: 70

Aññānipi upacārappanāvipassanāmaggavasena vuttāni vacanāni yathāyogaṃ yojetabbānīti.

AI Translation based on Nissaya

Other phrases spoken by way of access, absorption, insight, and path should be applied as is appropriate.

Vietnamese AI Translation

Các cụm từ khác được nói theo phương diện cận hành, an chỉ, tuệ và đạo nên được áp dụng khi thích hợp.

AI Translation Nissaya

aññānipi=other. ; upacārappanāvipassanāmaggavasena=by way of access-development, absorption, insight, and path. ; vuttāni=spoken. ; vacanāni=phrases beginning with 'cultivation' etc. ; yathāyogaṃ=as is appropriate. ; yojetabbāni=should be applied. ; iti=This is the end of the section on the knowledge based on virtue. ;

Myanmar Nissaya

aññānipi=ကုန်သော။ ; upacārappanāvipassanāmaggavasena=ဥပစာရဘာဝနာ အပ္ပနာ ဝိပဿနာမဂ်၏ အစွမ်းဖြင့်။ ; vuttāni=ကုန်သော။ ; vacanāni=အာသေဝန အစရှီသော သဒ္ဒါတို့ကို။ ; yathāyogaṃ=စွာ။ ; yojetabbāni=အပ်ကုန်၏။ ; iti=ဤသည်လျှင် သီလမယဉာဏ်ကို ဆိုသော စကားရပ်အပြီးသတ်တည်း။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4191 | Chunk: 70

Sīlamayañāṇaniddesavaṇṇanā niṭṭhitā.

AI Translation based on Nissaya

The commentary on the explanation of the knowledge based on virtue is finished.

Vietnamese AI Translation

Phần chú giải về sự giải thích trí tuệ dựa trên giới đã kết thúc.

AI Translation Nissaya

sīlamayañāṇaniddesavaṇṇanā=The commentary on the explanation of the knowledge based on virtue. ; niṭṭhitā=is finished. ;

Myanmar Nissaya

sīlamayañāṇaniddesavaṇṇanā=သည်။ ; niṭṭhitā=ပြီ။ ;

📜 Go TOC | __2. Sīlamayañāṇaniddesavaṇṇanā | Para: | ID: 4192 | Chunk: 70